COMBINATION THERAPY OF ANTI-TYRP1/ANTI-CD3 BISPECIFIC ANTIBODIES AND TYRP1-SPECIFIC ANTIBODIES

Abstract
The present invention relates to the combination therapy of a bispecific antibody which binds human TYRP1 and CD3 and a second TYRP1-specific antibody.
Description
SEQUENCE LISTING

The instant application contains a Sequence Listing which has been submitted electronically in XML format and is hereby incorporated by reference in its entirety. Said XML copy, created on May 20, 2024, is named “P37240-US_sequence_listing.xml” and is 19,600 bytes in size.


FIELD OF THE INVENTION

The present invention relates to the combination therapy of bispecific antibodies which bind to human TYRP1 and CD3 and TYRP1-specific antibodies.


BACKGROUND

Cancer is the leading cause of death in economically developed countries and the second leading cause of death in developing countries. Despite recent advances in chemotherapy and the development of agents targeted at the molecular level to interfere with the transduction and regulation of growth signals in cancer cells, the prognosis of patients with advanced cancer remains poor in general. Consequently, there is a persisting and urgent medical need to develop new therapies that can be added to existing treatments to increase survival without causing unacceptable toxicity.


CD3 (cluster of differentiation 3) is a protein complex composed of four subunits, the CD3γ chain, the CD3δ chain, and two CD3ε chains. CD3 associates with the T-cell receptor and the (chain to generate an activation signal in T lymphocytes. CD3 has been extensively explored as drug target. Monoclonal antibodies targeting CD3 have been used as immunosuppressant therapies in autoimmune diseases such as type I diabetes, or in the treatment of transplant rejection. The CD3 antibody muromonab-CD3 (OKT3) was the first monoclonal antibody ever approved for clinical use in humans, in 1985.


A more recent application of CD3 antibodies is in the form of bispecific antibodies, binding CD3 on the one hand and a tumor cell antigen on the other hand (Clynes and Desjarlais (2019) Annu. Rev. Med. 70:437-50). The simultaneous binding of such an antibody to both of its targets will force a temporary interaction between target cell and T cell, causing activation of any cytotoxic T cell and subsequent lysis of the target cell. For this purpose bispecific antibodies binding CD3 and the tumor cell antigen TYRP1 have been developed; as described e.g. in WO 2020/127619 A1. TYRP1 as a target is present in melanoma cells and in melanocytes where it is involved in melanin synthesis and also affects melanocyte proliferation and survival in humans. TYRP1 antibodies have been previously described (Boross et al. (2014) Immunol Lett. 160(2):151-7) and been tested in clinical trials (Khalil et al. (2016) Clin Cancer Res. 22(21):5204-5210). For use in mouse models, TYRP1 and T cell bispecific surrogate antibodies have been described (Benonisson et al. (2019) Mol Cancer Ther. (2):312-322; Labrijn et al. (2017) Sci Rep. 7(1):2476) where they mediated anti-tumor efficacy, but could not induce long-term response/cure.


There is still a need for new compounds and combinations which have the potential to significantly contribute to the treatment of patients. Thus, we herein describe a novel combination therapy of TYRP1 antibodies and bispecific antibodies which bind to TYRP1 and CD3.


SUMMARY OF THE INVENTION

The invention comprises an anti-TYRP1/anti-CD3 bispecific antibody in combination with a second TYRP1-specific antibody for use as a combination therapy in the treatment of cancer, for use as a combination therapy in the prevention or treatment of metastasis, wherein the anti-TYRP1/anti-CD3 bispecific antibody comprises a first antigen binding moiety which specifically binds to TYRP1 comprising a heavy chain variable domain VH of SEQ ID NO: 1 and a light chain variable domain VL of SEQ ID NO: 2, and a second antigen binding moiety which specifically binds to CD3 comprising a heavy chain variable domain VH of SEQ ID NO: 3 and a light chain variable domain VL of SEQ ID NO: 4, and wherein the second TYRP1-specific antibody comprises an antigen binding moiety which specifically binds to TYRP1.


Further the invention provides the use of an anti-TYRP1/anti-CD3 bispecific antibody in combination with a second TYRP1-specific antibody in the manufacture of a medicament for the treatment of cancer, wherein the anti-TYRP1/anti-CD3 bispecific antibody comprises a first antigen binding moiety which specifically binds to TYRP1 comprising a heavy chain variable domain VH of SEQ ID NO: 1 and a light chain variable domain VL of SEQ ID NO: 2, and a second antigen binding moiety which specifically binds to CD3 comprising a heavy chain variable domain VH of SEQ ID NO: 3 and a light chain variable domain VL of SEQ ID NO: 4, and wherein the second TYRP1-specific antibody comprises an antigen binding moiety which specifically binds to TYRP1.


Moreover, the invention provides a method of treating cancer in an individual comprising administering to said individual a therapeutically effective amount of an anti-TYRP1/anti-CD3 bispecific antibody in combination with a second TYRP1-specific antibody, wherein the anti-TYRP1/anti-CD3 bispecific antibody comprises a first antigen binding moiety which specifically binds to TYRP1 comprising a heavy chain variable domain VH of SEQ ID NO: 1 and a light chain variable domain VL of SEQ ID NO: 2, and a second antigen binding moiety which specifically binds to CD3 comprising a heavy chain variable domain VH of SEQ ID NO: 3 and a light chain variable domain VL of SEQ ID NO: 4, and wherein the second TYRP1-specific antibody comprises an antigen binding moiety which specifically binds to TYRP1.


In one aspect, the second TYRP1-specific antibody comprises a heavy chain variable domain VH of SEQ ID NO: 1 and a light chain variable domain VL of SEQ ID NO: 2.


In a further aspect, the anti-TYRP1/anti-CD3 bispecific antibody is of human IgG1 or human IgG4 subclass. In one aspect, the second TYRP1-specific antibody is of human IgG1 subclass.


In one aspect, the anti-TYRP1/anti-CD3 bispecific antibody has reduced or minimal effector function. In yet a further aspect, the minimal effector function results from an effectorless Fc mutation. In one aspect, the effectorless Fc mutation is L234A/L235A or L234A/L235A/P329G or N297A or D265A/N297A.


In one aspect, the second TYRP1-specific antibody comprises an Fc domain with improved effector function, particularly improved ADCC function. In one aspect, the second TYRP1-specific antibody is afucosylated.


In one aspect, the invention provides an anti-TYRP1/anti-CD3 bispecific antibody in combination with a second TYRP1-specific antibody for use, the use or the method according to any of the preceding aspects, wherein the anti-TYRP1/anti-CD3 bispecific antibody comprises i) a polypeptide sequence of SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8, ii) a polypeptide sequence of SEQ ID NO: 5 and SEQ ID NO: 6 and SEQ ID NO: 7 and SEQ ID NO: 8, or iii) a polypeptide sequence of SEQ ID NO: 9 and SEQ ID NO: 10 and SEQ ID NO: 11 and SEQ ID NO: 12.


In another aspect, the invention provides an anti-TYRP1/anti-CD3 bispecific antibody in combination with a second TYRP1-specific antibody for use, the use or the method according to any of the preceding aspects, wherein the anti-TYRP1/anti-CD3 bispecific antibody comprises i) a polypeptide sequence of SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8, ii) a polypeptide sequence of SEQ ID NO: 5 and SEQ ID NO: 6 and SEQ ID NO: 7 and SEQ ID NO: 8, or iii) a polypeptide sequence of SEQ ID NO: 9 and SEQ ID NO: 10 and SEQ ID NO: 11 and SEQ ID NO: 12, and wherein the second TYRP1-specific antibody comprises i) a polypeptide sequence of SEQ ID NO: 13 or SEQ ID NO: 14, or ii) a polypeptide sequence of SEQ ID NO: 13 and SEQ ID NO: 14, or iii) a polypeptide sequence of SEQ ID NO: 15 and SEQ ID NO: 16.


In one aspect, the invention provides an anti-TYRP1/anti-CD3 bispecific antibody in combination with a second TYRP1-specific antibody for use in i) Inhibition of tumor growth in a tumor; and/or ii) Enhancing median and/or overall survival of subjects with a tumor; wherein the anti-TYRP1/anti-CD3 bispecific antibody comprises i) a polypeptide sequence of SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8, ii) a polypeptide sequence of SEQ ID NO: 5 and SEQ ID NO: 6 and SEQ ID NO: 7 and SEQ ID NO: 8, or iii) a polypeptide sequence of SEQ ID NO: 9 and SEQ ID NO: 10 and SEQ ID NO: 11 and SEQ ID NO: 12, and wherein the second TYRP1-specific antibody comprises i) a polypeptide sequence of SEQ ID NO: 13 or SEQ ID NO: 14, or ii) a polypeptide sequence of SEQ ID NO: 13 and SEQ ID NO: 14, or iii) a polypeptide sequence of SEQ ID NO: 15 and SEQ ID NO: 16.


In a further aspect, the invention provides an anti-TYRP1/anti-CD3 bispecific antibody in combination with a second TYRP1-specific antibody, for use, the use or the method according to any of the preceding aspects wherein the cancer is selected from the group of breast cancer, lung cancer, colon cancer, ovarian cancer, melanoma cancer, bladder cancer, renal cancer, kidney cancer, liver cancer, head and neck cancer, colorectal cancer, melanoma, pancreatic cancer, gastric carcinoma cancer, esophageal cancer, mesothelioma, prostate cancer, leukemia, lymphomas, myelomas. In one aspect, the patient is treated with or was pre-treated with immunotherapy. In one aspect, said immunotherapy comprises adoptive cell transfer, administration of monoclonal antibodies, administration of cytokines, administration of a cancer vaccine, T cell engaging therapies, or any combination thereof. In one aspect, the adoptive cell transfer comprises administering chimeric antigen receptor expressing T-cells (CAR T-cells), T-cell receptor (TCR) modified T-cells, tumor-infiltrating lymphocytes (TIL), chimeric antigen receptor (CAR)-modified natural killer cells, T cell receptor (TCR) transduced cells, or dendritic cells, or any combination thereof.





BRIEF DESCRIPTION OF THE FIGURES


FIG. 1. Presents the results of an efficacy experiment evaluating muTYRP1-IgG and muTYRP1-TCB as single agents and in combination. The B16-muFAP-Fluc double transfectant melanoma cell line was injected intravenously in Black 6 albino mice to study survival in a lung metastatic syngeneic model. The amount of antibodies injected per mouse in mg/kg is the following: 20 mg/kg muTYRP1-IgG and 10 mg/kg muTYRP1-TCB. The antibodies were injected intravenously once weekly for 4 weeks. Significant superior median and overall survival was observed in the combination 10 mg/kg muTYRP1-TCB+20 mg/kg muTYRP1-IgG group compared to the single agents and vehicle groups tested.





DETAILED DESCRIPTION OF THE INVENTION

Anti-TYRP1/anti-CD3 bispecific antibodies are described in WO 2020/127619 A1.


The anti-TYRP1/anti-CD3 bispecific antibody used in the combination therapy described herein comprises a first antigen binding moiety capable of binding TYRP1 and a second antigen binding moiety capable of binding CD3. The anti-TYRP1/anti-CD3 bispecific antibody used in the combination therapy described herein may comprise a first antigen binding moiety comprising a heavy chain variable region sequence that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 1 or a variant thereof that retains functionality and a light chain variable region sequence that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 2 or a variant thereof that retains functionality, and a second antigen binding moiety comprising a heavy chain variable region sequence that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 3 or a variant thereof that retains functionality and a light chain variable region sequence that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 4 or a variant thereof that retains functionality. The anti-TYRP1/anti-CD3 bispecific antibody used in the combination therapy described herein may comprise a first antigen binding moiety comprising a heavy chain variable domain VH of SEQ ID NO: 1 and a light chain variable domain VL of SEQ ID NO: 2 and second antigen binding moiety comprising a heavy chain variable domain VH of SEQ ID NO: 3 and a light chain variable domain VL of SEQ ID NO: 4.


The anti-TYRP1/anti-CD3 bispecific antibody used in the combination therapy described herein may comprise a third antigen binding moiety which is identical to the first antigen binding moiety. In one embodiment, the first antigen binding moiety and the third antigen moiety which bind to TYRP1 are conventional Fab molecules. In such embodiments, the second antigen binding moiety that binds to CD3 is a crossover Fab molecule, i.e. a Fab molecule wherein the variable domains VH and VL of the Fab heavy and light chains are exchanged/replaced by each other.


The anti-TYRP1/anti-CD3 bispecific antibody used in the combination therapy may comprise amino acid substitutions in Fab molecules comprised therein which are particularly efficient in reducing mispairing of light chains with non-matching heavy chains (Bence-Jones-type side products), which can occur in the production of Fab-based multispecific antibodies with a VH/VL exchange in one (or more, in case of molecules comprising more than two antigen-binding Fab molecules) of their binding arms (see also PCT publication no. WO 2015/150447, particularly the examples therein, incorporated herein by reference in its entirety). The ratio of a desired (multispecific) antibody compared to undesired side products, in particular Bence Jones-type side products occurring in multispecific antibodies with a VH/VL domain exchange in one of their binding arms, can be improved by the introduction of charged amino acids with opposite charges at specific amino acid positions in the CH1 and CL domains (sometimes referred to herein as “charge modifications”).


Accordingly, anti-TYRP1/anti-CD3 bispecific antibodies used in the combination therapy wherein the first and the second (and, where present, third) antigen binding moieties of the (multispecific) antibody are Fab molecules, and in one of the antigen binding moieties (particularly the second antigen binding moiety) the variable domains VL and VH of the Fab light chain and the Fab heavy chain are replaced by each other, in the constant domain CL of the first (and, where present, third) antigen binding moiety the amino acid at position 124 and the amino acid at position 213 may be substituted by a positively charged amino acid (numbering according to Kabat), and wherein in the constant domain CH1 of the first (and, where present, third) antigen binding moiety the amino acid at position 147 and the amino acid at position 213 may be substituted by a negatively charged amino acid (numbering according to Kabat EU index). The constant domains CL and CH1 of the antigen binding moiety having the VH/VL exchange are not replaced by each other (i.e. remain unexchanged). The amino acid at position 124 and the amino acid at position 213 of the constant domain CL may be substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), the amino acid at position 147 and the amino acid at position 213 of the constant domain CH1 may be substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat EU index). The anti-TYRP1/anti-CD3 bispecific antibody used in the combination therapy may in the constant domain CL of the first (and, where present, third) antigen binding moiety at the amino acid at position 124 be substituted by lysine (K) (numbering according to Kabat) and the amino acid at position 123 be substituted by arginine (R) (numbering according to Kabat), and in the constant domain CH1 of the first (and, where present, third) antigen binding domain the amino acid at position 147 be substituted by glutamic acid (E) (numbering according to Kabat EU index) and the amino acid at position 213 be substituted by glutamic acid (E) (numbering according to Kabat EU index).


The anti-TYRP1/anti-CD3 bispecific antibody used in the combination therapy described herein may have the sequences shown as SEQ ID NOs: 5, 6, 7 and 8 or a variant thereof that retains functionality.


The anti-TYRP1/anti-CD3 bispecific antibody having the sequences shown as SEQ ID NOs: 5, 6, 7 and 8 is referred to herein as “TYRP1 TCB” or “TYRP1-TCB”. The anti-TYRP1/anti-CD3 bispecific antibody having the sequences shown as SEQ ID NOs: 9, 10, 11 and 12 is referred to herein as “muTYRP1 TCB”, which is a murine surrogate.


The anti-TYRP1/anti-CD3 bispecific antibody may comprise an Fc domain comprising a modification promoting heterodimerization of two non-identical polypeptide chains. A “modification promoting heterodimerization” is a manipulation of the peptide backbone or the post-translational modifications of a polypeptide that reduces or prevents the association of the polypeptide with an identical polypeptide to form a homodimer. A modification promoting heterodimerization as used herein particularly includes separate modifications made to each of two polypeptides desired to form a dimer, wherein the modifications are complementary to each other so as to promote association of the two polypeptides. For example, a modification promoting heterodimerization may alter the structure or charge of one or both of the polypeptides desired to form a dimer so as to make their association sterically or electrostatically favorable, respectively. Heterodimerization occurs between two non-identical polypeptides, such as two subunits of an Fc domain wherein the subunits are not the same. In the bispecific antibodies according to the present invention, the modification promoting heterodimerization is in the Fc domain. In some embodiments the modification promoting heterodimerization comprises an amino acid mutation, specifically an amino acid substitution. In a particular embodiment, the modification promoting heterodimerization comprises a separate amino acid mutation, specifically an amino acid substitution, in each of the two subunits of the Fc domain. The site of most extensive protein-protein interaction between the two polypeptide chains of a human IgG Fc domain is in the CH3 domain of the Fc domain. Thus, in one embodiment said modification is in the CH3 domain of the Fc domain. In a specific embodiment said modification is a knob-into-hole modification, comprising a knob modification in one of the two subunits of the Fc domain and a hole modification in the other one of the two subunits of the Fc domain.


The knob-into-hole technology is described e.g. in U.S. Pat. Nos. 5,731,168; 7,695,936; Ridgway et al., Prot Eng 9, 617-621 (1996) and Carter, J Immunol Meth 248, 7-15 (2001). Generally, the method involves introducing a protuberance (“knob”) at the interface of a first polypeptide and a corresponding cavity (“hole”) in the interface of a second polypeptide, such that the protuberance can be positioned in the cavity so as to promote heterodimer formation and hinder homodimer formation. Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g. tyrosine or tryptophan). Compensatory cavities of identical or similar size to the protuberances are created in the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). The protuberance and cavity can be made by altering the nucleic acid encoding the polypeptides, e.g. by site-specific mutagenesis, or by peptide synthesis. In a specific embodiment a knob modification comprises the amino acid substitution T366W in one of the two subunits of the Fc domain, and the hole modification comprises the amino acid substitutions T366S, L368A and Y407V in the other one of the two subunits of the Fc domain. In a further specific embodiment, the subunit of the Fc domain comprising the knob modification additionally comprises the amino acid substitution S354C, and the subunit of the Fc domain comprising the hole modification additionally comprises the amino acid substitution Y349C. Introduction of these two cysteine residues results in formation of a disulfide bridge between the two subunits of the Fc region, further stabilizing the dimer (Carter, J Immunol Methods 248, 7-15 (2001)). Numbering of amino acid residues in the Fc region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991. A “subunit” of an Fc domain as used herein refers to one of the two polypeptides forming the dimeric Fc domain, i.e. a polypeptide comprising C-terminal constant regions of an immunoglobulin heavy chain, capable of stable self-association. For example, a subunit of an IgG Fc domain comprises an IgG CH2 and an IgG CH3 constant domain.


In an alternative embodiment a modification promoting heterodimerization of two non-identical polypeptide chains comprises a modification mediating electrostatic steering effects, e.g. as described in WO 2009/089004. Generally, this method involves replacement of one or more amino acid residues at the interface of the two polypeptide chains by charged amino acid residues so that homodimer formation becomes electrostatically unfavorable but heterodimerization electrostatically favorable.


The Fc domain of the anti-TYRP1/anti-CD3 bispecific antibodies may be engineered to have altered binding affinity to an Fc receptor, specifically altered binding affinity to an Fcγ receptor, as compared to a non-engineered Fc domain, as described in WO 2012/146628. Binding of the Fc domain to a complement component, specifically to C1q, may be altered, as described in WO 2012/146628. The Fc domain confers to the antibodies favorable pharmacokinetic properties, including a long serum half-life which contributes to good accumulation in the target tissue and a favorable tissue-blood distribution ratio. At the same time it may, however, lead to undesirable targeting to cells expressing Fc receptors rather than to the preferred antigen-bearing cells.


Accordingly, the Fc domain of the anti-TYRP1/anti-CD3 bispecific antibodies may be engineered to have reduced binding affinity to an Fc receptor. In one such embodiment, the Fc domain comprises one or more amino acid mutation that reduces the binding affinity of the Fc domain to an Fc receptor. Typically, the same one or more amino acid mutation is present in each of the two subunits of the Fc domain. In one embodiment said amino acid mutation reduces the binding affinity of the Fc domain to the Fc receptor by at least 2-fold, at least 5-fold, or at least 10-fold. In embodiments where there is more than one amino acid mutation that reduces the binding affinity of the Fc domain to the Fc receptor, the combination of these amino acid mutations may reduce the binding affinity of the Fc domain to the Fc receptor by at least 10-fold, at least 20-fold, or even at least 50-fold. In one embodiment the antibodies comprising an engineered Fc domain exhibit less than 20%, particularly less than 10%, more particularly less than 5% of the binding affinity to an Fc receptor as compared to antibodies comprising a non-engineered Fc domain. In one embodiment the Fc receptor is an activating Fc receptor. In a specific embodiment the Fc receptor is an Fcγ receptor, more specifically an Fcγ RIIIa, Fcγ RI or Fcγ RIIa receptor. Preferably, binding to each of these receptors is reduced. In some embodiments binding affinity to a complement component, specifically binding affinity to C1q, is also reduced. In one embodiment, binding affinity to neonatal Fc receptor (FcRn) is not reduced. Substantially similar binding to FcRn, i.e. preservation of the binding affinity of the Fc domain to said receptor, is achieved when the Fc domain (or the antibody comprising said Fc domain) exhibits greater than about 70% of the binding affinity of a non-engineered form of the Fc domain (or the antibody comprising said non-engineered form of the Fc domain) to FcRn. Fc domains, or antibodies of the invention comprising said Fc domains, may exhibit greater than about 80% and even greater than about 90% of such affinity. In one embodiment the amino acid mutation is an amino acid substitution. In one embodiment the Fc domain comprises an amino acid substitution at position P329. In a more specific embodiment, the amino acid substitution is P329A or P329G, particularly P329G. In one embodiment, the Fc domain comprises a further amino acid substitution at a position selected from S228, E233, L234, L235, N297 and P331. In a more specific embodiment the further amino acid substitution is S228P, E233P, L234A, L235A, L235E, N297A, N297D or P331S. In a particular embodiment, the Fc domain comprises amino acid substitutions at positions P329, L234 and L235. In a more particular embodiment, the Fc domain comprises the amino acid mutations L234A, L235A and P329G (LALA P329G). This combination of amino acid substitutions almost completely abolishes Fcγ receptor binding of a human IgG Fc domain, as described in WO 2012/130831, incorporated herein by reference in its entirety. WO 2012/130831 also describes methods of preparing such mutant Fc domains and methods for determining its properties such as Fc receptor binding or effector functions. Numbering of amino acid residues in the Fc region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.


Mutant Fc domains can be prepared by amino acid deletion, substitution, insertion or modification using genetic or chemical methods well known in the art and as described in WO 2012/146628. Genetic methods may include site-specific mutagenesis of the encoding DNA sequence, PCR, gene synthesis, and the like. The correct nucleotide changes can be verified for example by sequencing.


In one embodiment the Fc domain is engineered to have decreased effector function, compared to a non-engineered Fc domain, as described in WO 2012/146628. The decreased effector function can include, but is not limited to, one or more of the following: decreased complement dependent cytotoxicity (CDC), decreased antibody-dependent cell-mediated cytotoxicity (ADCC), decreased antibody-dependent cellular phagocytosis (ADCP), decreased cytokine secretion, decreased immune complex-mediated antigen uptake by antigen-presenting cells, decreased binding to NK cells, decreased binding to macrophages, decreased binding to monocytes, decreased binding to polymorphonuclear cells, decreased direct signaling inducing apoptosis, decreased crosslinking of target-bound antibodies, decreased dendritic cell maturation, or decreased T cell priming.


IgG4 antibodies exhibit reduced binding affinity to Fc receptors and reduced effector functions as compared to IgG1 antibodies. Hence, in some embodiments the Fc domain of the antibodies of the invention is an IgG4 Fc domain, particularly a human IgG4 Fc domain. In one embodiment the IgG4 Fc domain comprises amino acid substitutions at position 5228, specifically the amino acid substitution S228P. To further reduce its binding affinity to an Fc receptor and/or its effector function, in one embodiment the IgG4 Fc domain comprises an amino acid substitution at position L235, specifically the amino acid substitution L235E. In another embodiment, the IgG4 Fc domain comprises an amino acid substitution at position P329, specifically the amino acid substitution P329G. In a particular embodiment, the IgG4 Fc domain comprises amino acid substitutions at positions S228, L235 and P329, specifically amino acid substitutions S228P, L235E and P329G. Such IgG4 Fc domain mutants and their Fcγ receptor binding properties are described in European patent application no. WO 2012/130831, incorporated herein by reference in its entirety.


The TYRP1-specific antibody used in the combination therapy described herein comprises an antigen binding moiety capable of binding TYRP1. The TYRP1-specific antibody used in the combination therapy described herein may comprise an antigen binding moiety comprising a heavy chain variable region sequence that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 1 or a variant thereof that retains functionality and a light chain variable region sequence that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 2 or a variant thereof that retains functionality. The TYRP1-specific antibody used in the combination therapy described herein may comprise an antigen binding moiety comprising a heavy chain variable domain VH of SEQ ID NO: 1 and a light chain variable domain VL of SEQ ID NO: 2.


The TYRP1-specific antibody having the sequences shown as SEQ ID NO: 13 and SEQ ID NO: 14 is referred to herein as “TYRP1 IgG” or “TYRP1-IgG”. The TYRP1-specific antibody having the sequences shown as SEQ ID NO: 15 and SEQ ID NO: 16 is referred to herein as “muTYRP1 IgG” or “muTYRP1-IgG”, which is a murine surrogate.


The TYRP1-specific antibody used in the combination therapy described herein may be an antibody of subclass IgG1. The Fc domain of the TYRP1-specific antibody may have ADCC activity in the presence of human effector cells or have increased ADCC activity in the presence of human effector cells compared to the otherwise same antibody comprising a human wild-type IgG1 Fc region.


In certain embodiments, an antibody provided herein is altered to increase or decrease the extent to which the antibody is glycosylated. Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.


Where the antibody comprises an Fc region, the oligosaccharide attached thereto may be altered. Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, e.g., Wright et al. TIBTECH 15:26-32 (1997). The oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the “stem” of the biantennary oligosaccharide structure. In some embodiments, modifications of the oligosaccharide in an antibody of the invention may be made in order to create antibody variants with certain improved properties.


In one embodiment, antibody variants are provided having a non-fucosylated oligosaccharide, i.e. an oligosaccharide structure that lacks fucose attached (directly or indirectly) to an Fc region. Such non-fucosylated oligosaccharide (also referred to as “afucosylated” oligosaccharide) particularly is an N-linked oligosaccharide which lacks a fucose residue attached to the first GlcNAc in the stem of the biantennary oligosaccharide structure. In one embodiment, antibody variants are provided having an increased proportion of non-fucosylated oligosaccharides in the Fc region as compared to a native or parent antibody. For example, the proportion of non-fucosylated oligosaccharides may be at least about 20%, at least about 40%, at least about 60%, at least about 80%, or even about 100% (i.e. no fucosylated oligosaccharides are present). The percentage of non-fucosylated oligosaccharides is the (average) amount of oligosaccharides lacking fucose residues, relative to the sum of all oligosaccharides attached to Asn 297 (e. g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2006/082515, for example. Asn297 refers to the asparagine residue located at about position 297 in the Fc region (EU numbering of Fc region residues); however, Asn297 may also be located about ±3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such antibodies having an increased proportion of non-fucosylated oligosaccharides in the Fc region may have improved FcγRIIIa receptor binding and/or improved effector function, in particular improved ADCC function. See, e.g., US 2003/0157108; US 2004/0093621.


Examples of cell lines capable of producing antibodies with reduced fucosylation include Lec13 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US 2003/0157108; and WO 2004/056312, especially at Example 11), and knockout cell lines, such as alpha-1,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87:614-622 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and WO 2003/085107), or cells with reduced or abolished activity of a GDP-fucose synthesis or transporter protein (see, e.g., US2004259150, US2005031613, US2004132140, US2004110282).


In a further embodiment, antibody variants are provided with bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function as described above. Examples of such antibody variants are described, e.g., in Umana et al., Nat Biotechnol 17, 176-180 (1999); Ferrara et al., Biotechn Bioeng 93, 851-861 (2006); WO 99/54342; WO 2004/065540, WO 2003/011878.


Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided. Such antibody variants may have improved CDC function. Such antibody variants are described, e.g., in WO 1997/30087; WO 1998/58964; and WO 1999/22764.


The Fc domain of the TYRP1-specific antibody may comprise one or more amino acid substitutions which improve ADCC through increased binding to Fc receptors, preferentially to FcγRIII. The Fc domain may comprise amino acid substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues) (Shields et al., J Biol Chem. 276(9):6591-604 (2001)). Further examples of such Fc variants are described in Wang et al., Protein Cell. 9(1):63-73 (2018); and Nordstrom et al., Breast Cancer Res. 13(6):R123 (2011).


In certain embodiments, the TYRP1-specific antibody variants comprising an Fc region described herein are capable of binding to an FcγRIII. In certain embodiments, the antibody variants comprising an Fc region described herein have ADCC activity in the presence of human effector cells or have increased ADCC activity in the presence of human effector cells compared to the otherwise same antibody comprising a human wild-type IgG1 Fc region.


Definitions

The term “antibody” herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, and antibody fragments so long as they exhibit the desired antigen-binding activity. An “antibody fragment” refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds. Examples of antibody fragments include but are not limited to Fv, Fab, Fab′, Fab′-SH, F(ab′)2, diabodies, linear antibodies, single-chain antibody molecules (e.g. scFv), and single-domain antibodies. For a review of certain antibody fragments, see Hudson et al., Nat Med 9, 129-134 (2003).


The term “antigen binding moiety”, “antigen binding domain” or “antigen-binding portion of an antibody” when used herein refers to the part of an antibody that comprises the area which specifically binds to and is complementary to part or all of an antigen. The term thus refers to the amino acid residues of an antibody which are responsible for antigen-binding. An antigen binding domain may be provided by, for example, one or more antibody variable domains (also called antibody variable regions). Particularly, an antigen binding domain comprises an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH). The antigen-binding portion of an antibody comprises amino acid residues from the “complementary determining regions” or “CDRs”. “Framework” or “FR” regions are those variable domain regions other than the hypervariable region residues as herein defined. Therefore, the light and heavy chain variable domains of an antibody comprise from N- to C-terminus the domains FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. Especially, CDR3 of the heavy chain is the region which contributes most to antigen binding and defines the antibody's properties. CDR and FR regions are determined according to the standard definition of Kabat et al., Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, MD (1991) and/or those residues from a “hypervariable loop”. The term “variable region” or “variable domain” refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen. The variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HVRs). See, e.g., Kindt et al., Kuby Immunology, 6th ed., W.H. Freeman and Co., page 91 (2007). A single VH or VL domain may be sufficient to confer antigen-binding specificity.


The term “epitope” denotes a protein determinant of an antigen, such as a TYRP1 or human CD3, capable of specifically binding to an antibody. Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually epitopes have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and nonconformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.


The term “Fc domain” or “Fc region” herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an IgG heavy chain might vary slightly, the human IgG heavy chain Fc region is usually defined to extend from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991. The Fc domain of an antibody is not involved directly in binding of an antibody to an antigen, but exhibit various effector functions. A “Fc domain of an antibody” is a term well known to the skilled artisan and defined on the basis of papain cleavage of antibodies. Depending on the amino acid sequence of the constant region of their heavy chains, antibodies or immunoglobulins are divided in the classes: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgG1, IgG2, IgG3, and IgG4, IgA1, and IgA2. According to the heavy chain constant regions the different classes of immunoglobulins are called ?, ?, ????, and ?, respectively. The Fc domain of an antibody is directly involved in ADCC (antibody-dependent cell-mediated cytotoxicity) and CDC (complement-dependent cytotoxicity) based on complement activation, C1q binding and Fc receptor binding. Complement activation (CDC) is initiated by binding of complement factor C1q to the Fc domain of most IgG antibody subclasses. While the influence of an antibody on the complement system is dependent on certain conditions, binding to C1q is caused by defined binding sites in the Fc domain. Such binding sites are known in the state of the art and described e.g. by Boackle, R. J., et al., Nature 282 (1979) 742-743; Lukas, T. J., et al., J. Immunol. 127 (1981) 2555-2560; Brunhouse, R., and Cebra, J. J., Mol. Immunol. 16 (1979) 907-917; Burton, D. R., et al., Nature 288 (1980) 338-344; Thommesen, J. E., et al., Mol. Immunol. 37 (2000) 995-1004; Idusogie, E. E., et al., J. Immunol. 164 (2000) 4178-4184; Hezareh, M., et al., J. Virology 75 (2001) 12161-12168; Morgan, A., et al., Immunology 86 (1995) 319-324; EP 0 307 434. Such binding sites are e.g. L234, L235, D270, N297, E318, K320, K322, P331 and P329 (numbering according to EU index of Kabat, E. A., see above). Antibodies of subclass IgG1, IgG2 and IgG3 usually show complement activation and C1q and C3 binding, whereas IgG4 do not activate the complement system and do not bind C1q and C3.


In one embodiment the antibodies described herein comprises an Fc domain derived from human origin and preferably all other parts of the human constant regions. As used herein the term “Fc domain derived from human origin” denotes a Fc domain which is either a Fc domain of a human antibody of the subclass IgG1, IgG2, IgG3 or IgG4, preferably a Fc domain from human IgG1 subclass, a mutated Fc domain from human IgG1 subclass, a Fc domain from human IgG4 subclass or a mutated Fc domain from human IgG4 subclass. In one embodiment, the anti-TRYP1/anti-CD3 bispecific antibodies have reduced or minimal effector function. In one embodiment the minimal effector function results from an effectorless Fc mutation. In one embodiment, the effectorless Fc mutation is L234A/L235A or L234A/L235A/P329G or N297A or D265A/N297A. In one embodiment the effectorless Fc mutation is selected for each of the antibodies independently of each other from the group comprising (consisting of) L234A/L235A, L234A/L235A/P329G, N297A and D265A/N297A (EU numbering). In one embodiment, the TYRP1-specific antibodies have ADCC activity in the presence of human effector cells or have increased ADCC activity in the presence of human effector cells compared to the otherwise same antibody comprising a human wild-type IgG1 Fc region. In one embodiment, antibody variants are provided comprising an Fc region wherein a carbohydrate structure attached to the Fc region has reduced fucose or lacks fucose.


An “activating Fc receptor” is an Fc receptor that following engagement by an Fc region of an antibody elicits signaling events that stimulate the receptor-bearing cell to perform effector functions. Activating Fc receptors include FcγRIIIa (CD16a), FcγRI (CD64), FcγRIIa (CD32), and FcαRI (CD89). The term “effector functions” when used in reference to antibodies refer to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Examples of antibody effector functions include: C1q binding and complement dependent cytotoxicity (CDC), Fc receptor binding, antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), cytokine secretion, immune complex-mediated antigen uptake by antigen presenting cells, down regulation of cell surface receptors (e.g. B cell receptor), and B cell activation.


In one embodiment, the antibodies described herein are of human IgG class (i.e. of IgG1, IgG2, IgG3 or IgG4 subclass).


In a preferred embodiment, the antibodies described herein are of human IgG1 subclass or of human IgG4 subclass. In one embodiment, the antibodies described herein are of human IgG1 subclass. In one embodiment, the antibodies described herein are of human IgG4 subclass.


In one embodiment, an antibody described herein is characterized in that the constant chains are of human origin. Such constant chains are well known in the state of the art and e.g. described by Kabat, E. A., (see e.g. Johnson, G. and Wu, T. T., Nucleic Acids Res. 28 (2000) 214-218).


As used herein, the terms “first”, “second” or “third” with respect to antibodies, Fc domain subunits, antigen binding moieties etc., are used for convenience of distinguishing when there is more than one distinct form of each type, .i.e. diverse antibodies, Fc domain subunits, antigen binding moieties. Use of these terms is not intended to confer a specific order or orientation unless explicitly so stated.


The terms “nucleic acid” or “nucleic acid molecule”, as used herein, are intended to include DNA molecules and RNA molecules. A nucleic acid molecule may be single-stranded or double-stranded, but preferably is double-stranded DNA.


The term “amino acid” as used within this application denotes the group of naturally occurring carboxy alpha-amino acids comprising alanine (three letter code: ala, one letter code: A), arginine (arg, R), asparagine (asn, N), aspartic acid (asp, D), cysteine (cys, C), glutamine (gin, Q), glutamic acid (glu, E), glycine (gly, G), histidine (his, H), isoleucine (ile, I), leucine (leu, L), lysine (lys, K), methionine (met, M), phenylalanine (phe, F), proline (pro, P), serine (ser, S), threonine (thr, T), tryptophan (trp, W), tyrosine (tyr, Y), and valine (val, V).


“Percent (%) amino acid sequence identity” with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087. The ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, California, or may be compiled from the source code. The ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary. In situations where ALIGN-2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows:





100 times the fraction X/Y


where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A. Unless specifically stated otherwise, all % amino acid sequence identity values used herein are obtained as described in the immediately preceding paragraph using the ALIGN-2 computer program. By a nucleic acid or polynucleotide having a nucleotide sequence at least, for example, 95% “identical” to a reference nucleotide sequence of the present invention, it is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence. In other words, to obtain a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence, up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence. These alterations of the reference sequence may occur at the 5′ or 3′ terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence. As a practical matter, whether any particular polynucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a nucleotide sequence of the present invention can be determined conventionally using known computer programs, such as the ones discussed above for polypeptides (e.g. ALIGN-2).


A method of producing antibodies described herein is provided, wherein the method comprises culturing a host cell comprising a polynucleotide encoding an antibody, as provided herein, under conditions suitable for expression of the antibody, and recovering the antibody from the host cell (or host cell culture medium).


The antibodies comprise at least an antibody variable region capable of binding an antigenic determinant. Variable regions can form part of and be derived from naturally or non-naturally occurring antibodies and fragments thereof. Methods to produce polyclonal antibodies and monoclonal antibodies are well known in the art (see e.g. Harlow and Lane, “Antibodies, a laboratory manual”, Cold Spring Harbor Laboratory, 1988). Non-naturally occurring antibodies can be constructed using solid phase-peptide synthesis, can be produced recombinantly (e.g. as described in U.S. Pat. No. 4,186,567) or can be obtained, for example, by screening combinatorial libraries comprising variable heavy chains and variable light chains (see e.g. U.S. Pat. No. 5,969,108 to McCafferty). Antigen binding moieties and methods for producing the same are also described in detail in PCT publication WO 2011/020783, the entire content of which is incorporated herein by reference.


Any animal species of antibody, antibody fragment, antigen binding domain or variable region can be used in the antibodies described herein. Non-limiting antibodies, antibody fragments, antigen binding domains or variable regions useful in the present invention can be of murine, primate, or human origin. Where the antibodies are intended for human use, a chimeric form of antibody may be used wherein the constant regions of the antibody are from a human. A humanized or fully human form of the antibody can also be prepared in accordance with methods well known in the art (see e. g. U.S. Pat. No. 5,565,332). Humanization may be achieved by various methods including, but not limited to (a) grafting the non-human (e.g., donor antibody) CDRs onto human (e.g. recipient antibody) framework and constant regions with or without retention of critical framework residues (e.g. those that are important for retaining good antigen binding affinity or antibody functions), (b) grafting only the non-human specificity-determining regions (SDRs or a-CDRs; the residues critical for the antibody-antigen interaction) onto human framework and constant regions, or (c) transplanting the entire non-human variable domains, but “cloaking” them with a human-like section by replacement of surface residues. Humanized antibodies and methods of making them are reviewed, e.g., in Almagro and Fransson, Front Biosci 13, 1619-1633 (2008), and are further described, e.g., in Riechmann et al., Nature 332, 323-329 (1988); Queen et al., Proc Natl Acad Sci USA 86, 10029-10033 (1989); U.S. Pat. Nos. 5,821,337, 7,527,791, 6,982,321, and 7,087,409; Jones et al., Nature 321, 522-525 (1986); Morrison et al., Proc Natl Acad Sci 81, 6851-6855 (1984); Morrison and Oi, Adv Immunol 44, 65-92 (1988); Verhoeyen et al., Science 239, 1534-1536 (1988); Padlan, Molec Immun 31(3), 169-217 (1994); Kashmiri et al., Methods 36, 25-34 (2005) (describing SDR (a-CDR) grafting); Padlan, Mol Immunol 28, 489-498 (1991) (describing “resurfacing”); Dall'Acqua et al., Methods 36, 43-60 (2005) (describing “FR shuffling”); and Osbourn et al., Methods 36, 61-68 (2005) and Klimka et al., Br J Cancer 83, 252-260 (2000) (describing the “guided selection” approach to FR shuffling). Human antibodies and human variable regions can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr Opin Pharmacol 5, 368-74 (2001) and Lonberg, Curr Opin Immunol 20, 450-459 (2008). Human variable regions can form part of and be derived from human monoclonal antibodies made by the hybridoma method (see e.g. Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987)). Human antibodies and human variable regions may also be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge (see e.g. Lonberg, Nat Biotech 23, 1117-1125 (2005). Human antibodies and human variable regions may also be generated by isolating Fv clone variable region sequences selected from human-derived phage display libraries (see e.g., Hoogenboom et al. in Methods in Molecular Biology 178, 1-37 (O'Brien et al., ed., Human Press, Totowa, NJ, 2001); and McCafferty et al., Nature 348, 552-554; Clackson et al., Nature 352, 624-628 (1991)). Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments.


In certain embodiments, antibodies are engineered to have enhanced binding affinity according to, for example, the methods disclosed in PCT publication WO 2011/020783 (see Examples relating to affinity maturation) or U.S. Pat. Appl. Publ. No. 2004/0132066, the entire contents of which are hereby incorporated by reference. The ability of the antibodies to bind to a specific antigenic determinant can be measured either through an enzyme-linked immunosorbent assay (ELISA) or other techniques familiar to one of skill in the art, e.g. surface plasmon resonance technique (analyzed on a BIACORE T100 system) (Liljeblad, et al., Glyco J 17, 323-329 (2000)), and traditional binding assays (Heeley, Endocr Res 28, 217-229 (2002)). Competition assays may be used to identify an antibody, antibody fragment, antigen binding domain or variable domain that competes with a reference antibody for binding to a particular antigen. In certain embodiments, such a competing antibody binds to the same epitope (e.g. a linear or a conformational epitope) that is bound by the reference antibody. Detailed exemplary methods for mapping an epitope to which an antibody binds are provided in Morris (1996) “Epitope Mapping Protocols,” in Methods in Molecular Biology vol. 66 (Humana Press, Totowa, NJ). In an exemplary competition assay, immobilized antigen is incubated in a solution comprising a first labeled antibody that binds to the antigen and a second unlabeled antibody that is being tested for its ability to compete with the first antibody for binding to the antigen. The second antibody may be present in a hybridoma supernatant. As a control, immobilized antigen is incubated in a solution comprising the first labeled antibody but not the second unlabeled antibody. After incubation under conditions permissive for binding of the first antibody to the antigen, excess unbound antibody is removed, and the amount of label associated with immobilized antigen is measured. If the amount of label associated with immobilized antigen is substantially reduced in the test sample relative to the control sample, then that indicates that the second antibody is competing with the first antibody for binding to the antigen. See Harlow and Lane (1988) Antibodies: A Laboratory Manual ch.14 (Cold Spring Harbor Laboratory, Cold Spring Harbor, NY).


Anti-TYRP1/anti-CD3 bispecific antibodies described herein may be prepared as described in the Examples of WO 2020/127619 A1.


Antibodies described herein are preferably produced by recombinant means. Such methods are widely known in the state of the art and comprise protein expression in prokaryotic and eukaryotic cells with subsequent isolation of the antibody polypeptide and usually purification to a pharmaceutically acceptable purity. For the protein expression nucleic acids encoding light and heavy chains or fragments thereof are inserted into expression vectors by standard methods. Expression is performed in appropriate prokaryotic or eukaryotic host cells, such as CHO cells, NS0 cells, SP2/0 cells, HEK293 cells, COS cells, yeast, or E. coli cells, and the antibody is recovered from the cells (from the supernatant or after cells lysis).


Recombinant production of antibodies is well-known in the state of the art and described, for example, in the review articles of Makrides, S. C., Protein Expr. Purif. 17 (1999) 183-202; Geisse, S., et al., Protein Expr. Purif. 8 (1996) 271-282; Kaufman, R. J., Mol. Biotechnol. 16 (2000) 151-161; Werner, R. G., Drug Res. 48 (1998) 870-880.


The antibodies may be present in whole cells, in a cell lysate, or in a partially purified, or substantially pure form. Purification is performed in order to eliminate other cellular components or other contaminants, e.g. other cellular nucleic acids or proteins, by standard techniques, including alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis, and others well known in the art. See Ausubel, F., et al., ed. Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York (1987).


Expression in NS0 cells is described by, e.g., Barnes, L. M., et al., Cytotechnology 32 (2000) 109-123; Barnes, L. M., et al., Biotech. Bioeng. 73 (2001) 261-270. Transient expression is described by, e.g., Durocher, Y., et al., Nucl. Acids. Res. 30 (2002) E9. Cloning of variable domains is described by Orlandi, R., et al., Proc. Natl. Acad. Sci. USA 86 (1989) 3833-3837; Carter, P., et al., Proc. Natl. Acad. Sci. USA 89 (1992) 4285-4289; Norderhaug, L., et al., J. Immunol. Methods 204 (1997) 77-87. A preferred transient expression system (HEK 293) is described by Schlaeger, E.-J. and Christensen, K., in Cytotechnology 30 (1999) 71-83, and by Schlaeger, E.-J., in J. Immunol. Methods 194 (1996) 191-199.


The heavy and light chain variable domains according to the invention are combined with sequences of promoter, translation initiation, constant region, 3′ untranslated region, polyadenylation, and transcription termination to form expression vector constructs. The heavy and light chain expression constructs can be combined into a single vector, co-transfected, serially transfected, or separately transfected into host cells which are then fused to form a single host cell expressing both chains.


The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to utilize promoters, enhancers and polyadenylation signals.


Nucleic acid is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, “operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading frame. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.


The monoclonal antibodies are suitably separated from the culture medium by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography. DNA and RNA encoding the monoclonal antibodies are readily isolated and sequenced using conventional procedures. The hybridoma cells can serve as a source of such DNA and RNA. Once isolated, the DNA may be inserted into expression vectors, which are then transfected into host cells such as HEK 293 cells, CHO cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of recombinant monoclonal antibodies in the host cells.


As used herein, the expressions “cell”, “cell line”, and “cell culture” are used interchangeably and all such designations include progeny. Thus, the words “transformants” and “transformed cells” include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that all progeny may not be precisely identical in DNA content, due to deliberate or inadvertent mutations. Variant progeny that have the same function or biological activity as screened for in the originally transformed cell are included.


Therapeutic Methods and Compositions

The invention comprises a method for the treatment of a patient in need of therapy, characterized by administering to the patient a therapeutically effective amount of the combination therapy of an anti-TYRP1/anti-CD3 bispecific antibody and a TYRP1-specific antibody.


The invention comprises the use of an anti-TYRP1/anti-CD3 bispecific antibody and TYRP1-specific antibody according to the invention for the described combination therapy.


One preferred embodiment of the invention is the combination therapy of an anti-TYRP1/anti-CD3 bispecific antibody with a TYRP1-specific antibody of the present invention for use in the treatment of cancer or tumor. Thus one embodiment of the invention is an anti-TYRP1/anti-CD3 bispecific antibody described herein for use in the treatment of cancer or tumor in combination with a TYRP1-specific antibody as described herein. Another embodiment of the invention is a TYRP1-specific antibody described herein for use in the treatment of cancer of tumor in combination with an anti-TYRP1/anti-CD3 bispecific antibody as described herein.


The term “cancer” as used herein may be, for example, lung cancer, non small cell lung (NSCL) cancer, bronchioloalviolar cell lung cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, gastric cancer, colon cancer, breast cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, prostate cancer, cancer of the bladder, cancer of the kidney or ureter, renal cell carcinoma, carcinoma of the renal pelvis, mesothelioma, hepatocellular cancer, biliary cancer, neoplasms of the central nervous system (CNS), spinal axis tumors, brain stem glioma, glioblastoma multiforme, astrocytomas, schwanomas, ependymonas, medulloblastomas, meningiomas, squamous cell carcinomas, pituitary adenoma, lymphoma, lymphocytic leukemia, including refractory versions of any of the above cancers, or a combination of one or more of the above cancers. In one preferred embodiment such cancer is a breast cancer, colorectal cancer, melanoma, head and neck cancer, lung cancer or prostate cancer. In one preferred embodiment such cancer is a breast cancer, ovarian cancer, cervical cancer, lung cancer or prostate cancer. In another preferred embodiment such cancer is breast cancer, lung cancer, colon cancer, ovarian cancer, melanoma cancer, bladder cancer, renal cancer, kidney cancer, liver cancer, head and neck cancer, colorectal cancer, pancreatic cancer, gastric carcinoma cancer, esophageal cancer, mesothelioma, prostate cancer, leukemia, lymphoma, myelomas. In one preferred embodiment such cancer is a TYRP1 expressing cancer.


An embodiment of the invention is an anti-TYRP1/anti-CD3 bispecific antibody as described herein in combination with a TYRP1-specific antibody as described herein for use in the treatment of any of the above described cancers or tumors. Another embodiment of the invention is an anti-TYRP1/anti-CD3 bispecific antibody as described herein in combination with a TYRP1-specific antibody as described herein for use in the treatment of any of the above described cancers or tumors. The invention comprises the combination therapy with an anti-TYRP1/anti-CD3 bispecific antibody as described herein with a TYRP1-specific antibody as described herein for the treatment of cancer. The invention comprises the combination therapy with an anti-TYRP1/anti-CD3 bispecific antibody as described herein with TYRP1-specific antibody as described herein for the prevention or treatment of metastasis.


The invention comprises a method for the treatment of cancer in a patient in need thereof, characterized by administering to the patient an anti-TYRP1/anti-CD3 bispecific antibody as described herein and a TYRP1-specific antibody as described herein. The invention comprises a method for the prevention or treatment of metastasis in a patient in need thereof, characterized by administering to the patient an anti-TYRP1/anti-CD3 bispecific antibody as described herein and a TYRP1-specific antibody being as described herein.


The invention comprises an anti-TYRP1/anti-CD3 bispecific antibody as described herein for use in the treatment of cancer in combination with a TYRP1-specific antibody as described herein, or alternatively for the manufacture of a medicament for the treatment of cancer in combination with a TYRP1-specific antibody as described herein.


The invention comprises an anti-TYRP1/anti-CD3 bispecific antibody as described herein for use in the prevention or treatment of metastasis in combination with a TYRP1-specific antibody as described herein, or alternatively for the manufacture of a medicament for the prevention or treatment of metastasis in combination with a TYRP1-specific antibody as described herein.


The invention comprises a TYRP1-specific antibody as described herein for use in the treatment of cancer in combination with an anti-TYRP1/anti-CD3 bispecific antibody as described herein, or alternatively for the manufacture of a medicament for the treatment of cancer in combination with an anti-TYRP1/anti-CD3 bispecific antibody as described herein.


The invention comprises a TYRP1-specific antibody as described herein for use in the prevention or treatment of metastasis in combination with an anti-TYRP1/anti-CD3 bispecific antibody as described herein, or alternatively for the manufacture of a medicament for the prevention or treatment of metastasis in combination with an anti-TYRP1/anti-CD3 bispecific antibody as described herein.


In a preferred embodiment of the invention, the anti-TYRP1/anti-CD3 bispecific antibody used in the above described combination treatments and medical uses of different diseases is an anti-TYRP1/anti-CD3 bispecific antibody characterized in comprising the polypeptide sequences of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8, and the TYRP1-specific antibody used in such combination treatments is characterized in comprising the polypeptide sequences of SEQ ID NO: 13 and SEQ ID NO: 14.


In another aspect, the present invention provides a composition, e.g. a pharmaceutical composition, containing an anti-TYRP1/anti-CD3 bispecific antibody as described herein and a TYRP1-specific antibody, as described herein formulated together with a pharmaceutically acceptable carrier.


As used herein, “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption/resorption delaying agents, and the like that are physiologically compatible. Preferably, the carrier is suitable for injection or infusion.


A composition of the present invention can be administered by a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results.


Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art. In addition to water, the carrier can be, for example, an isotonic buffered saline solution.


Regardless of the route of administration selected, the compounds of the present invention, which may be used in a suitable hydrated form, and/or the pharmaceutical compositions of the present invention, are formulated into pharmaceutically acceptable dosage forms by conventional methods known to those of skill in the art.


Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient (effective amount). The selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.


In one aspect the invention provides a kit intended for the treatment of a disease, comprising in the same or in separate containers (a) an anti-TYRP1/anti-CD3 bispecific antibody as described herein, and (b) a TYRP1-specific antibody as described herein, and optionally further comprising (c) a package insert comprising printed instructions directing the use of the combined treatment as a method for treating the disease. Moreover, the kit may comprise (a) a first container with a composition contained therein, wherein the composition comprises an anti-TYRP1/anti-CD3 bispecific antibody as described herein; (b) a second container with a composition contained therein, wherein the composition comprises TYRP1-specific antibody as described herein; and optionally (c) a third container with a composition contained therein, wherein the composition comprises a further cytotoxic or otherwise therapeutic agent. The kit in this embodiment of the invention may further comprise a package insert indicating that the compositions can be used to treat a particular condition. Alternatively, or additionally, the kit may further comprise a third (or fourth) container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.


In one aspect the invention provides a kit intended for the treatment of a disease, comprising (a) a container comprising an anti-TYRP1/anti-CD3 bispecific antibody as described herein, and (b) a package insert comprising instructions directing the use of the anti-TYRP1/anti-CD3 bispecific antibody in a combination therapy with a TYRP1-specific antibody as described herein as a method for treating the disease.


In another aspect the invention provides a kit intended for the treatment of a disease, comprising (a) a container comprising a TYRP1-specific antibody as described herein, and (b) a package insert comprising instructions directing the use of the TYRP1-specific antibody in a combination therapy with an anti-TYRP1/anti-CD3 antibody as described herein as a method for treating the disease.


In a further aspect the invention provides a medicament intended for the treatment of a disease, comprising an anti-TYRP1/anti-CD3 antibody as described herein, wherein said medicament is for use in a combination therapy with a TYRP1-specific antibody as described herein and optionally comprises a package insert comprising printed instructions directing the use of the combined treatment as a method for treating the disease.


In still a further aspect the invention provides a medicament intended for the treatment of a disease, comprising a TYRP1-specific antibody as described herein, wherein said medicament is for use in a combination therapy with an anti-TYRP1/anti-CD3 antibody as described herein and optionally comprises a package insert comprising printed instructions directing the use of the combined treatment as a method for treating the disease


The term “a method of treating” or its equivalent, when applied to, for example, cancer refers to a procedure or course of action that is designed to reduce or eliminate the number of cancer cells in a patient, or to alleviate the symptoms of a cancer. “A method of treating” cancer or another proliferative disorder does not necessarily mean that the cancer cells or other disorder will, in fact, be eliminated, that the number of cells or disorder will, in fact, be reduced, or that the symptoms of a cancer or other disorder will, in fact, be alleviated. Often, a method of treating cancer will be performed even with a low likelihood of success, but which, given the medical history and estimated survival expectancy of a patient, is nevertheless deemed to induce an overall beneficial course of action.


The terms “administered in combination with” or “co-administration”, “co-administering”, “combination therapy” or “combination treatment” refer to the administration of the anti-TYRP1/anti-CD3 bispecific antibody and the TYRP1-specific antibody as described herein e.g. as separate formulations/applications (or as one single formulation/application). The co-administration can be simultaneous or sequential in either order, wherein preferably there is a time period while both (or all) active agents simultaneously exert their biological activities. Said active agents are co-administered either simultaneously or sequentially (e.g. intravenous (i.v.)) through a continuous infusion. When both therapeutic agents are co-administered sequentially the dose is administered either on the same day in two separate administrations, or one of the agents is administered on day 1 and the second is co-administered on day 2 to day 7, preferably on day 2 to 4. Thus in one embodiment the term “sequentially” means within 7 days after the dose of the first component, preferably within 4 days after the dose of the first component; and the term “simultaneously” means at the same time. The term “co-administration” with respect to the maintenance doses of anti-TYRP1/anti-CD3 antibody and/or TYRP1-specific antibody means that the maintenance doses can be either co-administered simultaneously, if the treatment cycle is appropriate for both drugs, e.g. every week. Or the maintenance doses are co-administered sequentially, for example, doses anti-TYRP1/anti-CD3 antibody and TYRP1-specific antibody are given on alternate weeks.


It is self-evident that the antibodies are administered to the patient in a “therapeutically effective amount” (or simply “effective amount”) which is the amount of the respective compound or combination that will elicit the biological or medical response of a tissue, system, animal or human that is being sought by the researcher, veterinarian, medical doctor or other clinician.


The amount of co-administration and the timing of co-administration will depend on the type (species, gender, age, weight, etc.) and condition of the patient being treated and the severity of the disease or condition being treated. Said anti-TYRP1/anti-CD3 antibody and/or TYRP1-specific antibody are suitably co-administered to the patient at one time or over a series of treatments e.g. on the same day or on the day after or at weekly intervals.


In addition to the anti-TYRP1/anti-CD3 antibody in combination with the TYRP1-specific antibody also a chemotherapeutic agent can be administered.


In one embodiment such additional chemotherapeutic agents, which may be administered with the anti-TYRP1/anti-CD3 antibody as described herein and the TYRP1-specific antibody as described herein, include, but are not limited to, anti-neoplastic agents including alkylating agents including: nitrogen mustards, such as mechlorethamine, cyclophosphamide, ifosfamide, melphalan and chlorambucil; nitrosoureas, such as carmustine (BCNU), lomustine (CCNU), and semustine (methyl-CCNU); Temodal™ (temozolamide), ethylenimines/methylmelamine such as thriethylenemelamine (TEM), triethylene, thiophosphoramide (thiotepa), hexamethylmelamine (HMM, altretamine); alkyl sulfonates such as busulfan; triazines such as dacarbazine (DTIC); antimetabolites including folic acid analogs such as methotrexate and trimetrexate, pyrimidine analogs such as 5-fluorouracil (5FU), fluorodeoxyuridine, gemcitabine, cytosine arabinoside (AraC, cytarabine), 5-azacytidine, 2,2′-difluorodeoxycytidine, purine analogs such as 6-mercaptopurine, 6-thioguamne, azathioprine, T-deoxycoformycin (pentostatin), erythrohydroxynonyladenine (EHNA), fludarabine phosphate, and 2-chlorodeoxyadenosine (cladribine, 2-CdA); natural products including antimitotic drugs such as paclitaxel, vinca alkaloids including vinblastine (VLB), vincristine, and vinorelbine, taxotere, estramustine, and estramustine phosphate; pipodophylotoxins such as etoposide and teniposide; antibiotics such as actinomycin D, daunomycin (rubidomycin), doxorubicin, mitoxantrone, idarubicin, bleomycins, plicamycin (mithramycin), mitomycin C, and actinomycin; enzymes such as L-asparaginase; biological response modifiers such as interferon-alpha, IL-2, G-CSF and GM-CSF; miscellaneous agents including platinum coordination complexes such as oxaliplatin, cisplatin and carboplatin, anthracenediones such as mitoxantrone, substituted urea such as hydroxyurea, methylhydrazine derivatives including N-methylhydrazine (MIH) and procarbazine, adrenocortical suppressants such as mitotane (o, p-DDD) and aminoglutethimide; hormones and antagonists including adrenocorticosteroid antagonists such as prednisone and equivalents, dexamethasone and aminoglutethimide; Gemzar™ (gemcitabine), progestin such as hydroxyprogesterone caproate, medroxyprogesterone acetate and megestrol acetate; estrogen such as diethylstilbestrol and ethinyl estradiol equivalents; antiestrogen such as tamoxifen; androgens including testosterone propionate and fluoxymesterone/equivalents; antiandrogens such as flutamide, gonadotropin-releasing hormone analogs and leuprolide; and non-steroidal antiandrogens such as flutamide. Therapies targeting epigenetic mechanism including, but not limited to, histone deacetylase inhibitors, demethylating agents (e.g., Vidaza) and release of transcriptional repression (ATRA) therapies can also be combined with the antigen binding proteins. In one embodiment the chemotherapeutic agent is selected from the group consisting of taxanes (like e.g. paclitaxel (Taxol), docetaxel (Taxotere), modified paclitaxel (e.g., Abraxane and Opaxio), doxorubicin, sunitinib (Sutent), sorafenib (Nexavar), and other multikinase inhibitors, oxaliplatin, cisplatin and carboplatin, etoposide, gemcitabine, and vinblastine. In one embodiment the chemotherapeutic agent is selected from the group consisting of taxanes (like e.g. taxol (paclitaxel), docetaxel (Taxotere), modified paclitaxel (e.g. Abraxane and Opaxio). In one embodiment, the additional chemotherapeutic agent is selected from 5-fluorouracil (5-FU), leucovorin, irinotecan, or oxaliplatin. In one embodiment the chemotherapeutic agent is 5-fluorouracil, leucovorin and irinotecan (FOLFIRI). In one embodiment the chemotherapeutic agent is 5-fluorouracil, and oxaliplatin (FOLFOX).


Specific examples of combination therapies with additional chemotherapeutic agents include, for instance, therapies taxanes (e.g., docetaxel or paclitaxel) or a modified paclitaxel (e.g., Abraxane or Opaxio), doxorubicin), capecitabine and/or bevacizumab (Avastin) for the treatment of breast cancer; therapies with carboplatin, oxaliplatin, cisplatin, paclitaxel, doxorubicin (or modified doxorubicin (Caelyx or Doxil)), or topotecan (Hycamtin) for ovarian cancer, the therapies with a multi-kinase inhibitor, MKI, (Sutent, Nexavar, or 706) and/or doxorubicin for treatment of kidney cancer; therapies with oxaliplatin, cisplatin and/or radiation for the treatment of squamous cell carcinoma; therapies with taxol and/or carboplatin for the treatment of lung cancer.


Therefore, in one embodiment the additional chemotherapeutic agent is selected from the group of taxanes (docetaxel or paclitaxel or a modified paclitaxel (Abraxane or Opaxio), doxorubicin, capecitabine and/or bevacizumab for the treatment of breast cancer.


In one embodiment the anti-TYRP1/anti-CD3 antibody and TYRP1-specific antibody combination therapy is one in which no chemotherapeutic agents are administered.


The invention comprises also a method for the treatment of a patient suffering from such disease as described herein.


The invention further provides a method for the manufacture of a pharmaceutical composition comprising an effective amount of an anti-TYRP1/anti-CD3 antibody according to the invention as described herein and a TYRP1-specific antibody according to the invention as described herein together with a pharmaceutically acceptable carrier and the use of the anti-TYRP1/anti-CD3 antibody and TYRP1-specific antibody according to the invention as described herein for such a method.


The invention further provides the use of an anti-TYRP1/anti-CD3 antibody according to the invention as described herein and a TYRP1-specific antibody according to the invention as described herein in an effective amount for the manufacture of a pharmaceutical agent, preferably together with a pharmaceutically acceptable carrier, for the treatment of a patient suffering from cancer.


Cell Therapy

In some embodiments, the immunotherapy is an activation immunotherapy. In some embodiments, immunotherapy is provided as a cancer treatment. In some embodiments, immunotherapy comprises adoptive cell transfer.


In some embodiments, adoptive cell transfer comprises administration of a chimeric antigen receptor-expressing T-cell (CAR T-cell). A skilled artisan would appreciate that CARs are a type of antigen-targeted receptor composed of intracellular T-cell signaling domains fused to extracellular tumor-binding moieties, most commonly single-chain variable fragments (scFvs) from monoclonal antibodies.


CARs directly recognize cell surface antigens, independent of MHC-mediated presentation, permitting the use of a single receptor construct specific for any given antigen in all patients. Initial CARs fused antigen-recognition domains to the CD3 activation chain of the T-cell receptor (TCR) complex. While these first-generation CARs induced T-cell effector function in vitro, they were largely limited by poor antitumor efficacy in vivo. Subsequent CAR iterations have included secondary costimulatory signals in tandem with CD3, including intracellular domains from CD28 or a variety of TNF receptor family molecules such as 4-1BB (CD137) and OX40 (CD134). Further, third generation receptors include two costimulatory signals in addition to CD3, most commonly from CD28 and 4-1BB. Second and third generation CARs dramatically improve antitumor efficacy, in some cases inducing complete remissions in patients with advanced cancer. In one embodiment, a CAR T-cell is an immunoresponsive cell modified to express CARs, which is activated when CARs bind to its antigen.


In one embodiment, a CAR T-cell is an immunoresponsive cell comprising an antigen receptor, which is activated when its receptor binds to its antigen. In one embodiment, the CAR T-cells used in the compositions and methods as disclosed herein are first generation CAR T-cells. In another embodiment, the CAR T-cells used in the compositions and methods as disclosed herein are second generation CAR T-cells. In another embodiment, the CAR T-cells used in the compositions and methods as disclosed herein are third generation CAR T-cells. In another embodiment, the CAR T-cells used in the compositions and methods as disclosed herein are fourth generation CAR T-cells.


In some embodiments, adoptive cell transfer comprises administering T-cell receptor (TCR) modified T-cells. A skilled artisan would appreciate that TCR modified T-cells are manufactured by isolating T-cells from tumor tissue and isolating their TCRa and TCRβ chains. These TCRa and TCRβ are later cloned and transfected into T cells isolated from peripheral blood, which then express TCRa and TCRβ from T-cells recognizing the tumor.


In some embodiments, adoptive cell transfer comprises administering tumor infiltrating lymphocytes (TIL). In some embodiments, adoptive cell transfer comprises administering chimeric antigen receptor (CAR)-modified NK cells. A skilled artisan would appreciate that CAR-modified NK cells comprise NK cells isolated from the patient or commercially available NK engineered to express a CAR that recognizes a tumor-specific protein.


In some embodiments, adoptive cell transfer comprises administering dendritic cells.


In some embodiments, immunotherapy comprises administering of a cancer vaccine. A skilled artisan would appreciate that a cancer vaccine exposes the immune system to a cancer-specific antigen and an adjuvant. In some embodiments, the cancer vaccine is selected from a group comprising: sipuleucel-T, GVAX, ADXS11-001, ADXS31-001, ADXS31-164, ALVAC-CEA vaccine, AC Vaccine, talimogene laherparepvec, BiovaxID, Prostvac, CDX110, CDX1307, CDX1401, CimaVax-EGF, CV9104, DNDN, NeuVax, Ae-37, GRNVAC, tarmogens, GI-4000, GI-6207, GI-6301, ImPACT Therapy, IMA901, hepcortespenlisimut-L, Stimuvax, DCVax-L, DCVax-Direct, DCVax Prostate, CBLI, Cvac, RGSH4K, SCIB1, NCT01758328, and PVX-410.


The following examples, sequence listing and figures are provided to aid the understanding of the present invention, the true scope of which is set forth in the appended claims. It is understood that modifications can be made in the procedures set forth without departing from the spirit of the invention.


FURTHER EMBODIMENTS

A further embodiment of the invention is a novel TYRP1-specific antibody comprising a heavy chain variable domain VH of SEQ ID NO: 1 and a light chain variable domain VL of SEQ ID NO: 2.


In one embodiment, said TYRP1-specific antibody is of human IgG1 subclass.


In another embodiment, the TYRP1-specific antibody comprises a polypeptide sequence of SEQ ID NO: 13 and SEQ ID NO: 14 or a polypeptide sequence of SEQ ID NO: 15 and SEQ ID NO: 16.


EXAMPLES

The following are examples of methods and compositions of the invention. It is understood that various other aspects may be practiced, given the general description provided above.


Example 1—Production and Purification of muTYRP1 IgG

Since human IgG1 molecules cause an immunogenic response in mice, glycoengineered muIgG2a were used as surrogate molecules for animal experiments.


The heavy and light chain of the antibody were cloned on one plasmid under control of a human CMV promoter—Intron A—5′UTR cassette. Downstream of the genes a BGH polyadenylation signal is located. The rat GnTIII gene was amplified by polymerase chain reaction (PCR) from a rat kidney cDNA library (BD Biosciences). The gene coding for ManII was amplified from human DNA using gene specific primers. Both genes were combined with a chimeric MPSV promoter and subcloned into an expression vector. The vector was derived from pUC18 (Thermo Fisher Scientific) by inserting either the puromycin resistance gene or hygromycin resistance gene and the scaffold-attachment region (SAR) for enhanced expression.


CHO-K1SV cells were transfected with plasmids coding for the heavy and light chain of anti-TYRP1 muIgG2a as well as for the N-acetylglucosaminyltransferase-III (GntIII) and mannosidase-II (ManII) enzymes. A stable clone was selected and subjected to fed batch cultivation for up to 14 days in serum free medium to generate antibodies with a modified glycosylation structure. Cell supernatants were harvested by centrifugation and subsequent filtration (0.2 μm filter), and antibodies were purified from the harvested supernatant by standard methods as indicated below.


Proteins were purified from filtered cell culture supernatants referring to standard protocols. In brief, Fc containing proteins were purified from cell culture supernatants by Protein A-affinity chromatography (equilibration buffer: 20 mM sodium citrate, 20 mM sodium phosphate, pH 7.5; elution buffer: 20 mM sodium citrate, 100 mM sodium chloride, 100 mM glycine, 0.01% Tween20, pH 3.0). Elution was achieved at pH 3.0 followed by immediate pH neutralization of the sample. The protein was concentrated by centrifugation (Millipore Amicon® ULTRA-15 (Art.Nr.: UFC903096), and aggregated protein was separated from monomeric protein by size exclusion chromatography in 20 mM histidine, 140 mM sodium chloride, 0.01% Tween20, pH 6.0.


The concentrations of purified proteins were determined by measuring the absorption at 280 nm using the mass extinction coefficient calculated on the basis of the amino acid sequence according to Pace, et al., Protein Science, 1995, 4, 2411-1423. Purity and molecular weight of the proteins were analyzed by CE-SDS in the presence and absence of a reducing agent using a LabChipGXII or LabChip GX Touch (Perkin Elmer) (Perkin Elmer). Determination of the aggregate content was performed by HPLC chromatography at 25° C. using analytical size-exclusion column (TSKgel G3000 SW XL or UP-SW3000) equilibrated in running buffer (200 mM KH2PO4, 250 mM KCl pH 6.2, 0.02% NaN3). For a-fucosylation level determination the N-linked oligosaccharides were cleaved of the purified IgGs by incubation with 0.005 U of PNGase F (QAbio, USA) and EndoH (QAbio, USA) in 20 mM Tris pH 8.0 at 37° C. for 16 h. This resulted in free oligosaccharides that were analyzed by MALDI TOF mass spectrometry (Autoflex, Bruker Daltonics GmbH) in positive ion mode according to Papac et al (1996) Anal. Chem., 68:3215-3223.









TABLE 1







Monomer product peak, high molecular weight (HMW) and low molecular weight


(LMW) side products determined by analytical size exclusion chromatography











Construct
TAPIR ID
Monomer peak (%)
HMW peak (%)
LMW peak (%)





TYRP1 TA99 muIgG2a
P1AA9559-007
99
1
0


glycoengineered
















TABLE 2







Main product peak determined by non-reduced CE-SDS











Construct
TAPIR ID
Main peak (%)







TYRP1 TA99 muIgG2a
P1AA9559-007
95



glycoengineered

















TABLE 3







Carbohydrate a-fucosylation level


determined by MALDI-TOF MS analysis









Construct
TAPIR ID
a-fuc (%)












TYRP1 TA99 muIgG2a glycoengineered
P1AA9559-007
52









The glycoengineered TYRP1 murine IgG2a was purified by Protein A and size exclusion chromatography. The quality analysis of the purified material revealed a monomer content of 99% by analytical size exclusion chromatography analysis (Table 1), a main product peak of 95% by non-reduced capillary electrophoresis (Table 2) and an a-fucosylation level of 52% by MALDI-TOF MS analysis (Table 3). Thus, the glycoengineered TYRP1 murine IgG2a could be produced in good quality with an a-fucoslyation level sufficient to ensure increased ADCC.


Example 2—In Vivo Efficacy of Anti-TYRP1/Anti-CD3 Bispecific Antibody, in a Syngeneic Model of Mouse Tumor Cell Line, Alone and in Combination with TYRP1-IgG Antibody

The anti-TYRP1/anti-CD3 bispecific antibody (TYRP1-TCB) was tested in combination with TYRP1-IgG antibody for its anti-tumoral efficacy in the B16-muFAP-Fluc metastatic melanoma Syngeneic Model. The murine surrogates muTYRP1-TCB (SEQ ID NOs: 9, 10, 11 and 12) and muTYRP1-IgG (SEQ ID NO: 15 and 16) were tested in Black 6 albino mice intravenously injected with the mouse melanoma B16-muFAP-Fluc double transfectant cell line.


B16 cells (mouse melanoma cells) were originally obtained from ATCC (Manassas, VA, USA) and after expansion deposited in the Roche-Glycart internal cell bank. The B16-muFAP-Fluc cell line was produced in house by calcium transfection and sub-cloning techniques. B16-muFAP-Fluc was cultured in RPMI medium containing 10% FCS (Sigma), 200 μg/ml Zeocin, 0.75 μg/ml Puromycin and 1% of Glutamax. The cells were cultured at 37° C. in a water-saturated atmosphere at 5% CO2. Passage 13 was used for transplantation. Cell viability was 94.3%. Per animal 2×105 cells were injected intravenously (i.v.) using a 0.3 ml tuberculin syringe (BD Biosciences, Germany). Two hundred microliters cell suspension (2×105 B16-muFAP-Fluc cells in RPMI medium) was injected in the tail vein.


Female Black 6 albino mice aged 8-10 weeks at the start of the experiment (Charles Rivers, Lyon, France) were maintained under specific-pathogen-free condition with daily cycles of 12 h light/12 h darkness according to committed guidelines (GV-Solas; Felasa; TierschG). The experimental study protocol was reviewed and approved by local government (ZH225/2017). After arrival, animals were maintained for one week to get accustomed to the new environment and for observation. Continuous health monitoring was carried out on a regular basis.


Mice were injected intravenously on study day 0 with 2×105 B16-muFAP-Fluc cells, randomized and weighed. Eighteen days after the tumor cell injection mice were injected i.v. once weekly for 4 weeks with muTYRP1-TCB or muTYRP1-IgG single agents and compared to the combination of muTYRP1-TCB+muTYRP1-IgG.


All mice were injected i.v. with 200 μl of the appropriate solution. The mice in the vehicle group were injected with Histidine Buffer and the treatment groups with the muTYRP1-TCB at 10 mg/kg and muTYRP1-IgG at 20 mg/kg. To obtain the proper amount of immune-conjugates per 200 μl, the stock solutions were diluted with Histidine Buffer when necessary.









TABLE 4







Compounds used in Example










Compound
Dose
Formulation buffer
Concentration (mg/mL)





muTYRP1-IgG
400 μg
20 mM Histidine, 140 mM NaCl; pH6.0
3.83


P1AA9559-007


(=stock solution)


muTYRP1-TCB
200 μg
20 mM Histidine, 140 mM NaCl, 0.01%
3.70


P1AD8683-030

Tween20; pH6.0
(=stock solution)










FIG. 1 shows that the combination of muTYRP1-TCB and muTYRP1-IgG mediates a significantly superior efficacy in terms of enhanced median and overall survival compared to all other treatment and vehicle groups.












SEQUENCES









Description
Sequence
SEQ ID NO





anti-TYRP1 VH
QVQLVQSGAEVKKPGASVKVSCKASGFNIKDYFLHWVRQAPGQGLEWMGW
 1


(TCB and IgG)
INPDNGNTVYAQKFQGRVTMTADTSTSTVYMELSSLRSEDTAVYYCTRRD




YTYEKAALDYWGQGTLVTVSS






anti-TYRP1 VL
DIQMTQSPSSLSASVGDRVTITCRASGNIYNYLAWYQQKPGKVPKLLIYD
 2


(TCB and IgG)
AKTLADGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQHFWSLPFTFGQ




GTKLEIK






anti-CD3 VH
EVQLLESGGGLVQPGGSLRLSCAASGFQFSSYAMNWVRQAPGKGLEWVSR
 3



IRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQMNSLRAEDTAVYYCVR




HTTFPSSYVSYYGYWGQGTLVTVSS






anti-CD3 VL
QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTTSNYANWVQEKPGQAFRGLI
 4



GGTNKRAPGTPARFSGSLLGGKAALTLSGAQPEDEAEYYCALWYSNLWVE




GGGTKLTVL






TYRP1 VH-
QVQLVQSGAEVKKPGASVKVSCKASGFNIKDYFLHWVRQAPGQGLEWMGW
 5


CH1(EE)-CD3
INPDNGNTVYAQKFQGRVTMTADTSTSTVYMELSSLRSEDTAVYYCTRRD



VL-CH1-Fc
YTYEKAALDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV



(knob, PGLALA)
EDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ



(P1AE1805)
TYICNVNHKPSNTKVDEKVEPKSCDGGGGSGGGGSQAVVTQEPSLTVSPG




GTVTLTCGSSTGAVTTSNYANWVQEKPGQAFRGLIGGTNKRAPGTPARFS




GSLLGGKAALTLSGAQPEDEAEYYCALWYSNLWVFGGGTKLTVLSSASTK




GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP




AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD




KTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP




EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC




KVSNKALGAPIEKTISKAKGQPREPQVYTLPPCRDELTKNQVSLWCLVKG




FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN




VFSCSVMHEALHNHYTQKSLSLSP






TYRP1 VH-
QVQLVQSGAEVKKPGASVKVSCKASGFNIKDYFLHWVRQAPGQGLEWMGW
 6


CH1(EE)-Fc
INPDNGNTVYAQKFQGRVTMTADTSTSTVYMELSSLRSEDTAVYYCTRRD



(hole, PGLALA)
YTYEKAALDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV




EDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ




TYICNVNHKPSNTKVDEKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPK




PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY




NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALGAPIEKTISKAKGQPREP




QVCTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPP




VLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP






TYRP1 VL-
DIQMTQSPSSLSASVGDRVTITCRASGNIYNYLAWYQQKPGKVPKLLIYD
 7


CL(RK)
AKTLADGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQHFWSLPFTFGQ




GTKLEIKRTVAAPSVFIFPPSDRKLKSGTASVVCLLNNFYPREAKVQWKV




DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG




LSSPVTKSFNRGEC






CD3 VH-CL
EVQLLESGGGLVQPGGSLRLSCAASGFQFSSYAMNWVRQAPGKGLEWVSR
 8



IRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQMNSLRAEDTAVYYCVR




HTTFPSSYVSYYGYWGQGTLVTVSSASVAAPSVFIFPPSDEQLKSGTASV




VCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS




KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC






murine
EVQLVESGGGLVQPGKSLKLSCEASGFTFSGYGMHWVRQAPGRGLESVAY
9


surrogate CD3
ITSSSINIKYADAVKGRFTVSRDNAKNLLFLQMNILKSEDTAMYYCARFD



VH-CL-
WDKNYWGQGTMVTVSSASDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYP



TYRP1 VH-CH1-
KDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNS



Fc (DAPG, DD)
YTCEATHKTSTSPIVKSFNRNECGGGGSGGGGSEVQLQQSGAELVRPGAL



(P1AD8683-030)
VKLSCKTSGFNIKDYFLHWVRQRPDQGLEWIGWINPDNGNTVYDPKFQGT




ASLTADTSSNTVYLQLSGLTSEDTAVYFCTRRDYTYEKAALDYWGQGASV




IVFSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGS




LSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDK




KIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVAISK




DDPEVQFSWFVDDVEVHTAQTKPREEQINSTFRSVSELPIMHQDWLNGKE




FKCRVNSAAFGAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCM




ITNFFPEDITVEWQWNGQPAENYDNTQPIMDTDGSYFVYSDLNVQKSNWE




AGNTFTCSVLHEGLHNHHTEKSLSHSPGK






murine
EVQLQQSGAELVRPGALVKLSCKTSGFNIKDYFLHWVRQRPDQGLEWIGW
10


surrogate
INPDNGNTVYDPKFQGTASLTADTSSNTVYLQLSGLTSEDTAVYFCTRRD



TYRP1 VH-CH1-
YTYEKAALDYWGQGASVIVESAAKTTPPSVYPLAPGSAAQTNSMVTLGCL



Fc(DAPG, KK)
VKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQ




TVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVL




TITLTPKVTCVVVAISKDDPEVQFSWFVDDVEVHTAQTKPREEQINSTFR




SVSELPIMHQDWLNGKEFKCRVNSAAFGAPIEKTISKTKGRPKAPQVYTI




PPPKKQMAKDKVSLTCMITNFFPEDITVEWQWNGQPAENYKNTQPIMKTD




GSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK






murine
AIQMSQSPASLSASVGETVTITCRASGNIYNYLAWYQQKQGKSPHLLVYD
11


surrogate
AKTLADGVPSRFSGSGSGTQYSLKISSLQTEDSGNYYCQHFWSLPFTFGS



TYRP1 VL-CL
GTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKI




DGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKT




STSPIVKSFNRNEC






murine
DIQMTQSPSSLPASLGDRVTINCQASQDISNYLNWYQQKPGKAPKLLIYY
12


surrogate CD3
TNKLADGVPSRFSGSGSGRDSSFTISSLESEDIGSYYCQQYYNYPWTFGP



VL-CH1
GTKLEIKSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTW




NSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASST




KVDKKIVPRDC






TYRP1 IgG HC
QVQLVQSGAEVKKPGASVKVSCKASGFNIKDYFLHWVRQAPGQGLEWMGW
13



INPDNGNTVYAQKFQGRVTMTADTSTSTVYMELSSLRSEDTAVYYCTRRD




YTYEKAALDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV




KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ




TYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK




PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY




NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP




QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP




VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG




K






TYRP1 IgG LC
DIQMTQSPSSLSASVGDRVTITCRASGNIYNYLAWYQQKPGKVPKLLIYD
14



AKTLADGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQHFWSLPFTFGQ




GTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV




DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG




LSSPVTKSFNRGEC






muTYRP1 IgG
EVQLQQSGAELVRPGALVKLSCKTSGFNIKDYFLHWVRQRPDQGLEWIGW
15


HC
INPDNGNTVYDPKFQGTASLTADTSSNTVYLQLSGLTSEDTAVYFCTRRD



(P1AA9559-007)
YTYEKAALDYWGQGASVIVESAAKTTAPSVYPLAPVCGDTTGSSVTLGCL




VKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQ




SITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPP




KIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHRED




YNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRA




PQVYVLPPPEEEMTKKQVTLTCMVTDEMPEDIYVEWTNNGKTELNYKNTE




PVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTP




GK






muTYRP1 IgG
AIQMSQSPASLSASVGETVTITCRASGNIYNYLAWYQQKQGKSPHLLVYD
16


LC
AKTLADGVPSRFSGSGSGTQYSLKISSLQTEDSGNYYCQHFWSLPFTFGS




GTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKI




DGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKT




STSPIVKSFNRNEC








Claims
  • 1. (canceled)
  • 2. (canceled)
  • 3. A method of treating a tyrosinase-related protein 1 (TYRP1)-expressing cancer in an individual comprising administering to said individual a therapeutically effective amount of an anti-TYRP1/anti-CD3 bispecific antibody in combination with a second TYRP1-specific antibody, wherein the anti-TYRP1/anti-CD3 bispecific antibody comprises a first antigen binding moiety which specifically binds to TYRP1 comprising a heavy chain variable domain VH of SEQ ID NO: 1 and a light chain variable domain VL of SEQ ID NO: 2, and a second antigen binding moiety which specifically binds to CD3 comprising a heavy chain variable domain VH of SEQ ID NO: 3 and a light chain variable domain VL of SEQ ID NO: 4, and wherein the second TYRP1-specific antibody comprises an antigen binding moiety which specifically binds to TYRP1.
  • 4. The method according to claim 3, wherein the second antibody comprises a heavy chain variable domain VH of SEQ ID NO: 1 and a light chain variable domain VL of SEQ ID NO: 2.
  • 5. The method according to claim 3, wherein the anti-TYRP1/anti-CD3 bispecific antibody is of human IgG1 or human IgG4 subclass.
  • 6. The method of claim 5, wherein the TYRP1-specific antibody is of human IgG1 subclass.
  • 7. The method of claim 3, wherein the anti-TYRP1/anti-CD3 bispecific antibody has reduced or minimal effector function.
  • 8. The method of claim 7, wherein the minimal effector function results from an effectorless Fc mutation.
  • 9. The method of claim 8, wherein the effectorless Fc mutation is L234A/L235A or L234A/L235A/P329G or N297A or D265A/N297A.
  • 10. The method of claim 3, wherein the second TYRP1-specific antibody comprises an Fc domain with improved effector function.
  • 11. The use of claim 3, wherein the second TYRP1-specific antibody is afucosylated.
  • 12. The method of claim 3, wherein the anti-TYRP1/anti-CD3 bispecific antibody comprises i) a polypeptide sequence of SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8, ii) a polypeptide sequence of SEQ ID NO: 5 and SEQ ID NO: 6 and SEQ ID NO: 7 and SEQ ID NO: 8, or iii) a polypeptide sequence of SEQ ID NO: 9 and SEQ ID NO: 10 and SEQ ID NO: 11 and SEQ ID NO: 12.
  • 13. The method of claim 3, wherein the anti-TYRP1/anti-CD3 bispecific antibody comprises i) a polypeptide sequence of SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8, ii) a polypeptide sequence of SEQ ID NO: 5 and SEQ ID NO: 6 and SEQ ID NO: 7 and SEQ ID NO: 8, or iii) a polypeptide sequence of SEQ ID NO: 9 and SEQ ID NO: 10 and SEQ ID NO: 11 and SEQ ID NO: 12, and wherein the second TYRP1-specific antibody comprises i) a polypeptide sequence of SEQ ID NO: 13 or SEQ ID NO: 14, or ii) a polypeptide sequence of SEQ ID NO: 13 and SEQ ID NO: 14, or iii) a polypeptide sequence of SEQ ID NO: 15 and SEQ ID NO: 16.
  • 14. (canceled)
  • 15. The method of claim 3, wherein the cancer is breast cancer, lung cancer, colon cancer, ovarian cancer, melanoma, bladder cancer, renal cancer, kidney cancer, liver cancer, head and neck cancer, colorectal cancer, melanoma, pancreatic cancer, gastric carcinoma cancer, esophageal cancer, mesothelioma, prostate cancer, leukemia, a lymphoma, or a myeloma.
  • 16. The method of claim 3, wherein the individual is treated with or was pre-treated with immunotherapy.
  • 17. The method according to claim 16, wherein said immunotherapy comprises adoptive cell transfer, administration of monoclonal antibodies, administration of cytokines, administration of a cancer vaccine, T cell engaging therapies, or any combination thereof.
  • 18. The method according to claim 17, wherein the adoptive cell transfer comprises administering chimeric antigen receptor expressing T-cells (CAR T-cells), T-cell receptor (TCR) modified T-cells, tumor-infiltrating lymphocytes (TIL), chimeric antigen receptor (CAR)-modified natural killer cells, T cell receptor (TCR) transduced cells, or dendritic cells, or any combination thereof.
  • 19. The method of claim 10, wherein said improved effector function comprises improved antibody-dependent cellular cytotoxicity (ADCC) function.
Priority Claims (1)
Number Date Country Kind
21210631.4 Nov 2021 EP regional
CROSS-REFERENCE TO RELATED APPLICATIONS

This application is a continuation of Patent Cooperation Treaty Application PCT/EP 2022/083218, filed Nov. 25, 2022, which claims priority to European Application No. 21210631.4, filed Nov. 26, 2021, both of which are incorporated herein by reference in their entireties.

Continuations (1)
Number Date Country
Parent PCT/EP2022/083218 Nov 2022 WO
Child 18668810 US