ABERRANT MITOCHONDRIAL DNA, ASSOCIATED FUSION TRANSCRIPTS AND HYBRIDIZATION PROBES THEREFOR

Information

  • Patent Application
  • 20170152567
  • Publication Number
    20170152567
  • Date Filed
    February 20, 2015
    11 years ago
  • Date Published
    June 01, 2017
    9 years ago
Abstract
The present invention provides novel mitochondrial fusion transcripts and the parent mutated mtDNA molecules that are useful for predicting, diagnosing and/or monitoring cancer. Hybridization probes complementary thereto for use in the methods of the invention are also provided.
Description
FIELD OF THE INVENTION

The present invention relates to the field of mitochondrial genomics. In one aspect, the invention relates to the identification and use of mitochondrial genome fusion transcripts and probes that hybridize thereto.


BACKGROUND OF THE INVENTION

Mitochondrial Genome


The mitochondrial genome is a compact yet critical sequence of nucleic acids. Mitochondrial DNA, or “mtDNA”, comprises a small genome of 16,569 nucleic acid base pairs (bp) (Anderson et al., 1981; Andrews et al., 1999) in contrast to the immense nuclear genome of 3.3 billion bp (haploid). Its genetic complement is substantially smaller than that of its nuclear cell mate (0.0005%). However, individual cells carry anywhere from 103 to 104 mitochondria depending on specific cellular functions (Singh and Modica-Napolitano 2002). Communication or chemical signalling routinely occurs between the nuclear and mitochondrial genomes (Sherratt et al., 1997). Moreover, specific nuclear components are responsible for the maintenance and integrity of mitochondrial sequences (Croteau et al., 1999). All mtDNA genomes in a given individual are identical due to the clonal expansion of mitochondria within the ovum, once fertilization has occurred. However mutagenic events can induce sequence diversity reflected as somatic mutations. These mutations may accumulate in different tissues throughout the body in a condition known as heteroplasmy.


Mitochondrial Proteome


About 3,000 nuclear genes are required to construct, operate and maintain mitochondria, with only thirty-seven of these coded by the mitochondrial genome, indicating heavy mitochondrial dependence on nuclear loci. The mitochondrial genome codes for a complement of 24 genes, including 2 rRNAs and 22 tRNAs that ensure correct translation of the remaining 13 genes which are vital to electron transport (see FIG. 1). The mitochondrial genome is dependent on seventy nuclear encoded proteins to accomplish the oxidation and reduction reactions necessary for this vital function, in addition to the thirteen polypeptides supplied by the mitochondrial genome. Both nuclear and mitochondrial proteins form complexes spanning the inner mitochondrial membrane and collectively generate 80-90% of the chemical fuel adenosine triphosphate, or ATP, required for cellular metabolism. In addition to energy production, mitochondria play a central role in other metabolic pathways as well. A critical function of the mitochondria is mediation of cell death, or apoptosis (see Green and Kroemer, 2005). Essentially, there are signal pathways which permeabilize the outer mitochondrial membrane, or in addition, the inner mitochondrial membrane as well. When particular mitochondrial proteins are released into the cytosol, non-reversible cell death is set in motion. This process highlights the multi-functional role that some mitochondrial proteins have. These multi-tasking proteins suggest that there are other mitochondrial proteins as well which may have alternate functions.


Mitochondrial Fusion Transcriptome


The mitochondrial genome is unusual in that it is a circular, intron-less DNA molecule. The genome is interspersed with repeat motifs which flank specific lengths of sequences. Sequences between these repeats are prone to deletion under circumstances which are not well understood. Given the number of repeats in the mitochondrial genome, there are many possible deletions. The best known example is the 4977 “common deletion.” This deletion has been associated with several purported conditions and diseases and is thought to increase in frequency with aging (Dai et al., 2004; Ro et al., 2003; Barron et al., 2001; Lewis et al., 2000; Muller-Hocker, 1998; Porteous et al., 1998) (FIG. 4). The current thinking in the field of mitochondrial genomics is that mitochondrial deletions are merely deleterious by-products of damage to the mitochondrial genome by such agents as reactive oxygen species and UVR. (Krishnan et al 2008, Nature Genetics). Further, though it is recognized that high levels of mtDNA deletions can have severe consequences on the cell's ability to produce energy in the form of ATP as a result of missing gene sequences necessary for cellular respiration, it is not anticipated that these deleted mitochondrial molecules may be a component of downstream pathways, have an intended functional role, and possibly may be more aptly viewed as alternate natural forms of the recognized genes of the mitochondria as has been anticipated by the Applicant.


The sequence dynamics of mtDNA are important diagnostic tools. Mutations in mtDNA are often preliminary indicators of developing disease. For example, it has been demonstrated that point mutations in the mitochondrial genome are characteristic of tumour foci in the prostate. This trend also extends to normal appearing tissue both adjacent to and distant from tumour tissue (Parr et al. 2006). This suggests that mitochondrial mutations occur early in the malignant transformation pathway.


For example, the frequency of a 3.4 kb mitochondrial deletion has excellent utility in discriminating between benign and malignant prostate tissues (Maki et al. 2008).


Mitochondrial fusion transcripts have been reported previously in the literature, first in soybeans (Morgens et al. 1984) and then later in two patients with Kearns-Sayre Syndrome, a rare neuromuscular disorder (Nakase et al 1990). Importantly, these transcripts were not found to have (or investigated regarding) association with any human cancers.


SUMMARY OF THE INVENTION

An object of the present invention to provide aberrant mitochondrial DNA, associated fusion transcripts and hybridization probes therefor.


In accordance with an aspect of the invention, there is provided an isolated mitochondrial fusion transcript associated with cancer.


In accordance with an aspect of the invention, there is provided a mitochondrial fusion protein corresponding to the above fusion transcript, having a sequence as set forth in any one of SEQ ID NOs: 34 to 49 and 52.


In accordance with another aspect of the invention, there is provided an isolated mtDNA encoding a fusion transcript of the invention.


In accordance with another aspect of the invention, there is provided a hybridization probe having a nucleic acid sequence complementary to at least a portion of a mitochondrial fusion transcript or an mtDNA of the invention.


In accordance with another aspect of the invention, there is provided a method of detecting a cancer in a mammal, the method comprising assaying a tissue sample from the mammal for the presence of at least one mitochondrial fusion transcript associated with cancer by hybridizing the sample with at least one hybridization probe having a nucleic acid sequence complementary to at least a portion of a mitochondrial fusion transcript according to the invention.


In accordance with another aspect of the invention, there is provided a method of detecting a cancer in a mammal, the method comprising assaying a tissue sample from the mammal for the presence of at least one aberrant mtDNA associated with cancer by hybridizing the sample with at least one hybridization probe having a nucleic acid sequence complementary to at least a portion of an mtDNA according to the invention.


In accordance with another aspect of the invention, there is provided a kit for conducting an assay for detecting the presence of a cancer in a mammal, said kit comprising at least one hybridization probe complementary to at least a portion of a fusion transcript or an mtDNA of the invention.


In accordance with another aspect of the invention, there is provided a screening tool comprised of a microarray having 10's, 100's, or 1000's of mitochondrial fusion transcripts for identification of those associated with cancer.


In accordance with another aspect of the invention, there is provided a screening tool comprised of a microarray having 10's, 100's, or 1000's of mitochondrial DNAs corresponding to mitochondrial fusion transcripts for identification of those associated with cancer.


In accordance with another aspect of the invention, there is provided a screening tool comprised of a multiplexed branched DNA assay having 10's, 100's, or 1000's of mitochondrial fusion transcripts for identification of those associated with cancer.


In accordance with another aspect of the invention, there is provided a screening tool comprised of a multiplexed branched DNA assay having 10's, 100's, or 1000's of mitochondrial DNAs corresponding to mitochondrial fusion transcripts for identification of those associated with cancer.





BRIEF DESCRIPTION OF THE DRAWINGS

The embodiments of the invention will now be described by way of example only with reference to the appended drawings wherein:



FIG. 1 is an illustration showing mitochondrial coding genes.



FIG. 2 shows polyadenalated fusion transcripts in prostate samples invoked by the loss of the 3.4 kb deletion.



FIG. 3 shows polyadenalated fusion transcripts in prostate samples invoked by the loss of the 4977 kb common deletion.



FIG. 4 shows polyadenalated fusion transcripts in breast samples invoked by the loss of the 3.4 kb segment from the mtgenome.



FIGS. 5A and 5B shows an example of a mitochondrial DNA region beforesplicing of genes.



FIG. 5B shows an example of a mitochondrial DNA region after splicing of genes.



FIG. 6A illustrates the results for transcript 2 of the invention in the identification of colorectal cancer tumours.



FIG. 6B illustrates the results for transcript 3 of the invention in the identification of colorectal cancer tumours.



FIG. 6C illustrates the results for transcript 8 of the invention in the identification of colorectal cancer tumours.



FIG. 6D illustrates the results for transcript 9 of the invention in the identification of colorectal cancer tumours.



FIG. 6E illustrates the results for transcript 10 of the invention in the identification of colorectal cancer tumours.



FIG. 6F illustrates the results for transcript 11 of the invention in the identification of colorectal cancer tumours.



FIG. 6G illustrates the results for transcript 12 of the invention in the identification of colorectal cancer tumours.



FIG. 7A illustrates the results for transcript 6 of the invention in the identification of lung cancer tumours.



FIG. 7B illustrates the results for transcript 8 of the invention in the identification of lung cancer tumours.



FIG. 7C illustrates the results for transcript 10 of the invention in the identification of lung cancer tumours.



FIG. 7D illustrates the result for transcript 20 of the invention in the identification of lung cancer tumours.



FIG. 8A illustrates the results for transcript 6 of the invention in the identification of melanomas.



FIG. 8B illustrates the results for transcript 10 of the invention in the identification of melanomas.



FIG. 8C illustrate the results for transcript 11 of the invention in the identification of melanomas.



FIG. 8D illustrates the results for transcript 14 of the invention in the identification of melanomas.



FIG. 8E illustrates the results for transcript 15 of the invention in the identification of melanomas.



FIG. 8F illustrates the results for transcript 16 of the invention in the identification of melanomas.



FIG. 8G illustrates the results for transcript 20 of the invention in the identification of melanomas.



FIG. 9A illustrate the results for transcript 1 of the invention in the identification of ovarian cancer.



FIG. 9B illustrates the results for transcript 2 of the invention in the identification of ovarian cancer.



FIG. 9C illustrates the results for transcript 3 of the invention in the identification of ovarian cancer.



FIG. 9D illustrates the results for transcript 6 of the invention in the identification of ovarian cancer.



FIG. 9E illustrates the results for transcript 11 of the invention in the identification of ovarian cancer.



FIG. 9F illustrates the results for transcript 12 of the invention in the identification of ovarian cancer.



FIG. 9G illustrates the results for transcript 15 of the invention in the identification of ovarian cancer.



FIG. 9H illustrates the results for transcript 20 of the invention in the identification of ovarian cancer.



FIGS. 10A and 10B illustrate the results for transcript 2 of the invention in the identification of testicular cancer.



FIGS. 11A and 11B illustrate the results for transcript 3 of the invention in the identification of testicular cancer.



FIG. 12 illustrates the results for transcript 4 of the invention in the identification of testicular cancer.



FIGS. 13A and 13B illustrate the results for transcript 11 of the invention in the identification of testicular cancer.



FIGS. 14A and 14B illustrate the results for transcript 12 of the invention in the identification of testicular cancer.



FIGS. 15A and 15B illustrate the results for transcript 13 of the invention in the identification of testicular cancer.



FIG. 16 illustrates the results for transcript 15 of the invention in the identification of testicular cancer.



FIGS. 17A and 17B illustrate the results for transcript 16 of the invention in the identification of testicular cancer.



FIGS. 18A and 18B illustrate the results for transcript 20 of the invention in the identification of testicular cancer.



FIG. 19 illustrates the SDS PAGE gel of cytosolic and mitochondrial fractions of RWPE1 and WPE1-NA22 cell lines conducted during the fusion protein discovery phase.



FIG. 20A illustrates the identified protein of fusion transcript P0026 based on the peptides ILYMTDEVNDPSLTIK and STPYECGFDPMSP.



FIG. 20B illustrates the wild-type CO2 protein identified in mitochondrial NA22 cell line gel slice 5 of FIG. 19 after searching the Human (SwissProt) database.



FIG. 21A illustrates the identified protein of fusion transcript P0062 based on the peptides KGPNVVGPYGLLQPFADAMK, YDQLMHLLWK and LITTQQWLIK.



FIG. 21B illustrates the identified peptides of ND1 identified in gel slice 5 of FIG. 19 after searching the Human (SwissProt) database.



FIG. 22 illustrates the identified protein of fusion transcript P0064 based on the peptides KGPNVVGPYGLLQPFADAMK and WAIIEEFTK.



FIG. 23A illustrates the identified protein of fusion transcript P0176 based on the peptides KGPNVVGPYGLLQPFADAMK, VFSWLATLHGSNMK and VLMVEEPSMNLEWLYGCPPPYHTFEEPVYMK.



FIG. 23A illustrates the wild-type CO1 protein identified in mitochondrial NA22 cell line gel slice 4 of FIG. 19 after searching the Human (SwissProt) database.



FIG. 24A illustrates the results of quantitative measurements of fusion transcript P0026.



FIG. 24B illustrates the results of quantitative measurements of fusion transcript P0062.



FIG. 24C illustrates the results of quantitative measurements of fusion transcript P0064.



FIG. 24D illustrates the results of quantitative measurements of fusion transcript P0176.





DETAILED DESCRIPTION OF THE INVENTION

The present invention provides novel mitochondrial fusion transcripts and the parent mutated mtDNA molecules that are useful for predicting, diagnosing and/or monitoring cancer. The invention further provides hybridization probes for the detection of fusion transcripts and associated mtDNA molecules and the use of such probes.


DEFINITIONS

Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.


As used herein, “aberration” or “mutation” encompasses any modification in the wild type mitochondrial DNA sequence that results in a fusion transcript and includes, without limitation, insertions, translocations, deletions, duplications, recombinations, rearrangements or combinations thereof.


As defined herein, “biological sample” refers to a tissue or bodily fluid containing cells from which a molecule of interest can be obtained. For example, the biological sample can be derived from tissue such as prostate, breast, colorectal, lung and skin, or from blood, saliva, cerebral spinal fluid, sputa, urine, mucous, synovial fluid, peritoneal fluid, amniotic fluid and the like. The biological sample may be a surgical specimen or a biopsy specimen. The biological sample can be used either directly as obtained from the source or following a pre-treatment to modify the character of the sample. Thus, the biological sample can be pre-treated prior to use by, for example, preparing plasma or serum from blood, disrupting cells, preparing liquids from solid materials, diluting viscous fluids, filtering liquids, distilling liquids, concentrating liquids, inactivating interfering components, adding reagents, and the like.


A “continuous” transcript is a fusion transcript that keeps the reading frame from the beginning to the end of both spliced genes. An “end” transcript is a fusion transcript that results in a premature termination codon before the original termination codon of a second spliced gene.


As used herein, “mitochondrial DNA” or “mtDNA” is DNA present in mitochondria.


As used herein, the expression “mitochondrial fusion transcript” or “fusion transcript” refers to an RNA transcription product produced as a result of the transcription of a mutated mitochondrial DNA sequence wherein such mutations may comprise mitochondrial deletions and other large-scale mitochondrial DNA rearrangements.


Computer Analysis and Sequence Targetting


As discussed above, mitochondrial fusion transcripts have been reported in soybeans (Morgens et al. 1984) and in humans suffering from a rare neuromuscular disorder (Nakase et al 1990). Fusion transcripts associated with human cancer have not, however, been described.


Using the knowledge gained from mapping the large-scale deletions of the human mitochondrial genome associated with cancer, the observation of high frequencies of these deletions, and the evidence in another organism and another disease type of trancriptionally active mutated mtDNA molecules, Applicant hypothesized that such deletions may have importance beyond the DNA molecule and the damage and repair processes as it relates to cancer. To test this hypothesis computer analysis of the mitochondrial genome was conducted, specific for repeat elements, which suggested many potential deletion sites. Following this initial step identifying unique repeats in the mitochondrial sequence having non-adjacent or non-tandem locations, a filter was then applied to identify those repeats that upon initiating a deletion event in the DNA molecule would then likely reclose or religate to produce a fused DNA sequence having an open reading frame (ORF). A subset of 18 molecules were then selected for targetting to investigate whether: 1) they existed in the natural biological state of humans and 2) they had relevance to malignancy. Results from these investigations are described hereinafter.


Genomic Mutations


Mitochondrial DNA (mtDNA) dynamics are an important diagnostic tool. Mutations in mtDNA are often preliminary indicators of developing disease and behave as biomarkers indicative of risk factors associated with disease onset. According to the present invention, large-scale rearrangement mutations in the mitochondrial genome result in the generation of fusion transcripts associated with cancer. Thus, the use of mtDNA encoding such transcripts and probes directed thereto for the detection, diagnosis and monitoring of cancer is provided.


One of skill in the art will appreciate that the mtDNA molecules for use in the methods of the present invention may be derived through the isolation of naturally-occurring mutants or may be based on the complementary sequence of any of the fusion transcripts described herein. Exemplary mtDNA sequences and fusion transcripts are disclosed in Applicant's U.S. priority application No. 61/040,616, herein incorporated in its entirety by reference.


Detection of Mutant Genomic Sequences


Mutant mtDNA sequences according to the present invention may comprise any modification that results in the generation of a fusion transcript. Non-limiting examples of such modifications include insertions, translocations, deletions, duplications, recombinations, rearrangements or combinations thereof. While the modification or change can vary greatly in size from only a few bases to several kilobases, preferably the modification results in a substantive deletion or other large-scale genomic aberration.


Extraction of DNA to detect the presence of such mutations may take place using art-recognized methods, followed by amplification of all or a region of the mitochondrial genome, and may include sequencing of the mitochondrial genome, as described in Current Protocols in Molecular Biology. Alternatively, crude tissue homogenates may be used as well as techniques not requiring amplification of specific fragments of interest.


The step of detecting the mutations can be selected from any technique as is known to those skilled in the art. For example, analyzing mtDNA can comprise selection of targets by branching DNA, sequencing the mtDNA, amplifying mtDNA by PCR, Southern, Northern, Western South-Western blot hybridizations, denaturing HPLC, hybridization to microarrays, biochips or gene chips, molecular marker analysis, biosensors, melting temperature profiling or a combination of any of the above.


Any suitable means to sequence mitochondrial DNA may be used. Preferably, mtDNA is amplified by PCR prior to sequencing. The method of PCR is well known in the art and may be performed as described in Mullis and Faloona, 1987, Methods Enzymol., 155: 335. PCR products can be sequenced directly or cloned into a vector which is then placed into a bacterial host. Examples of DNA sequencing methods are found in Brumley, R. L. Jr. and Smith, L. M., 1991, Rapid DNA sequencing by horizontal ultrathin gel electrophoresis, Nucleic Acids Res. 19:4121-4126 and Luckey, J. A., et al, 1993, High speed DNA sequencing by capillary gel electrophoresis, Methods Enzymol. 218: 154-172. The combined use of PCR and sequencing of mtDNA is described in Hopgood, R., et al, 1992, Strategies for automated sequencing of human mtDNA directly from PCR products, Biotechniques 13:82-92 and Tanaka, M. et al, 1996, Automated sequencing of mtDNA, Methods Enzymol. 264: 407-421.


Methods of selecting appropriate sequences for preparing various primers are also known in the art. For example, the primer can be prepared using conventional solid-phase synthesis using commercially available equipment, such as that available from Applied Biosystems USA Inc. (Foster City, Calif.), DuPont, (VVilmington, Del.), or Milligen (Bedford, Mass.).


According to an aspect of the invention, to determine candidate genomic sequences, a junction point of a sequence deletion is first identified. Sequence deletions are primarily identified by direct and indirect repetitive elements which flank the sequence to be deleted at the 5′ and 3′ end. The removal of a section of the nucleotides from the genome followed by the ligation of the genome results in the creation of a novel junction point.


Upon identification of the junction point, the nucleotides of the genes flanking the junction point are determined in order to identify a spliced gene. Typically the spliced gene comprises the initiation codon from the first gene and the termination codon of the second gene, and may be expressed as a continuous transcript, i.e. one that keeps the reading frame from the beginning to the end of both spliced genes. It is also possible that alternate initiation or termination codons contained within the gene sequences may be used as is evidenced by SEQ ID No:2 and SEQ ID No: 17 disclosed herein. Some known mitochondrial deletions discovered to have an open reading frame (ORF) when the rearranged sequences are rejoined at the splice site are provided in Table 1.


Exemplary mtDNA molecules for use in the methods of the present invention, which have been verified to exist in the lab, are provided below. These mtDNAs are based on modifications of the known mitochondrial genome (SEQ ID NO: 1) and have been assigned a fusion or “FUS” designation, wherein A:B represents the junction point between the last mitochondrial nucleotide of the first spliced gene and the first mitochondrial nucleotide of the second spliced gene. The identification of the spliced genes is provided in parentheses followed by the corresponding sequence identifier. Where provided below, (AltMet) and (OrigMet) refer to alternate and original translation start sites, respectively.

    • FUS 8469:13447 (AltMet) (ATP synthase FO subunit 8 to NADH dehydrogenase subunit) (SEQ ID No: 2)
    • FUS 10744:14124 (NADH dehydrogenase subunit 4L (ND4L) to NADH dehydrogenase subunit 5 (ND5)) (SEQ ID No: 3)
    • FUS 7974:15496 (Cytochrome c oxidase subunit II (COII) to Cytochrome b (Cytb)) (SEQ ID No: 4)
    • FUS 7992:15730 (Cytochrome c oxidase subunit II (COII) to Cytochrome b (Cytb)) (SEQ ID No: 5)
    • FUS 8210:15339 (Cytochrome c oxidase subunit II (COII) to Cytochrome b (Cytb)) (SEQ ID No: 6)
    • FUS 8828:14896 (ATP synthase FO subunit 6 (ATPase6) to Cytochrome b (Cytb)) (SEQ ID No: 7)
    • FUS 10665:14856 (NADH dehydrogenase subunit 4L (ND4L) to Cytochrome b (Cytb)) (SEQ ID No: 8)
    • FUS 6075:13799 (Cytochrome c oxidase subunit I (COI) to NADH de hydrogenase subunit 5 (ND5)) (SEQ ID No: 9)
    • FUS 6325:13989 (Cytochrome c oxidase subunit I (COI) to NADH dehydrogenase subunit 5 ND5)) (SEQ ID No: 10)
    • FUS 7438:13476 (Cytochrome c oxidase subunit I (COII) to NADH dehydrogenase subunit 5 ND5)) (SEQ ID No: 11)
    • FUS 7775:13532 (Cytochrome c oxidase subunit II (COI) to NADH dehydrogenase subunit 5 ND5)) (SEQ ID No: 12)
    • FUS 8213:13991 (Cytochrome c oxidase subunit II (COII) to NADH dehydrogenase subunit 5 ND5)) (SEQ ID No: 13)
    • FUS 9191:12909 (ATP synthase FO subunit 6 (ATPase6) to NADH dehydrogenase subunit 5 ND5)) (SEQ ID No: 14)
    • FUS 9574:12972 (Cytochrome c oxidase subunit III (COIII) to NADH dehydrogenase subunit 5 (ND5)) (SEQ ID No: 15)
    • FUS 10367:12829 (NADH dehydrogenase subunit 3 (ND3) to NADH dehydrogenase subunit 5 (ND5)) (SEQ ID No: 16)
    • FUS 8469:13447 (OrigMet) (ATP synthase FO subunit 8 to NADH dehydrogenase subunit) (SEQ ID No: 17)
    • FUS 9144:13816 ((ATP synthase FO subunit 6 (ATPase6) to NADH dehydrogenase subunit 5 (ND5)) (SEQ ID No: 51)


The present invention also provides the use of variants or fragments of these sequences for predicting, diagnosing and/or monitoring cancer.


“Variant”, as used herein, refers to a nucleic acid differing from a mtDNA sequence of the present invention, but retaining essential properties thereof. Generally, variants are overall closely similar, and, in many regions, identical to a select mtDNA sequence. Specifically, the variants of the present invention comprise at least one of the nucleotides of the junction point of the spliced genes, and may further comprise one or more nucleotides adjacent thereto. In one embodiment of the invention, the variant sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to any one of the mtDNA sequences of the invention, or the complementary strand thereto.


In the present invention, “fragment” refers to a short nucleic acid sequence which is a portion of that contained in the disclosed genomic sequences, or the complementary strand thereto. This portion includes at least one of the nucleotides comprising the junction point of the spliced genes, and may further comprise one or more nucleotides adjacent thereto. The fragments of the invention are preferably at least about 15 nt, and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably, at least about 40 nt, at least about 50 nt, at least about 75 nt, or at least about 150 nt in length. A fragment “at least 20 nt in length,” for example, is intended to include 20 or more contiguous bases of any one of the mtDNA sequences listed above. In this context “about” includes the particularly recited value, a value larger or smaller by several (5, 4, 3, 2, or 1) nucleotides, at either terminus or at both termini. These fragments have uses that include, but are not limited to, as diagnostic probes and primers as discussed herein. Of course, larger fragments (e.g., 50, 150, 500, 600, 2000 nucleotides) are also contemplated.


Thus, in specific embodiments of the invention, the mtDNA sequences are selected from the group consisting of:


SEQ ID NO: 2 (FUS 8469:13447; AltMet)


SEQ ID NO: 3 (FUS 10744:14124)


SEQ ID NO: 4 (FUS 7974:15496)


SEQ ID NO: 5 (FUS 7992:15730)


SEQ ID NO: 6 (FUS 8210:15339)


SEQ ID NO: 7 (FUS 8828:14896)


SEQ ID NO: 8 (FUS 10665:14856)


SEQ ID NO: 9 (FUS 6075:13799)


SEQ ID NO: 10 (FUS 6325:13989)


SEQ ID NO: 11 (FUS 7438:13476)


SEQ ID NO: 12 (FUS 7775:13532)


SEQ ID NO: 13 (FUS 8213:13991)


SEQ ID NO: 14 (FUS 9191:12909)


SEQ ID NO: 15 (FUS 9574:12972)


SEQ ID NO: 16 (FUS 10367:12829)


SEQ ID NO: 17 (FUS 8469:13447; OrigMet)


SEQ ID NO: 51 (FUS 9144:13816), and


fragments or variants thereof.


Probes


Another aspect of the invention is to provide a hybridization probe capable of recognizing an aberrant mtDNA sequence of the invention. As used herein, the term “probe” refers to an oligonucleotide which forms a duplex structure with a sequence in the target nucleic acid, due to complementarity of at least one sequence in the probe with a sequence in the target region. The probe may be labeled, according to methods known in the art.


Once aberrant mtDNA associated with a particular disease is identified, hybridization of mtDNA to, for example, an array of oligonucleotides can be used to identify particular mutations, however, any known method of hybridization may be used.


As with the primers of the present invention, probes may be generated directly against exemplary mtDNA fusion molecules of the invention, or to a fragment or variant thereof. For instance, the sequences set forth in SEQ ID NOs: 2-17 and 51 and those disclosed in Table 1 can be used to design primers or probes that will detect a nucleic acid sequence comprising a fusion sequence of interest. As would be understood by those of skill in the art, primers or probes which hybridize to these nucleic acid molecules may do so under highly stringent hybridization conditions or lower stringency conditions, such conditions known to those skilled in the art and found, for example, in Current Protocols in Molecular Biology (John Wiley & Sons, New York (1989)), 6.3.1-6.3.6.


In specific embodiments of the invention, the probes of the invention contain a sequence complementary to at least a portion of the aberrant mtDNA comprising the junction point of the spliced genes. This portion includes at least one of the nucleotides involved in the junction point A:B, and may further comprise one or more nucleotides adjacent thereto. In this regard, the present invention encompasses any suitable targeting mechanism that will select an mtDNA molecule using the nucleotides involved and/or adjacent to the junction point A:B.


Various types of probes known in the art are contemplated by the present invention. For example, the probe may be a hybridization probe, the binding of which to a target nucleotide sequence can be detected using a general DNA binding dye such as ethidium bromide, SYBR® Green, SYBR® Gold and the like. Alternatively, the probe can incorporate one or more detectable labels. Detectable labels are molecules or moieties a property or characteristic of which can be detected directly or indirectly and are chosen such that the ability of the probe to hybridize with its target sequence is not affected. Methods of labelling nucleic acid sequences are well-known in the art (see, for example, Ausubel et al., (1997 & updates) Current Protocols in Molecular Biology, Wiley & Sons, New York).


Labels suitable for use with the probes of the present invention include those that can be directly detected, such as radioisotopes, fluorophores, chemiluminophores, enzymes, colloidal particles, fluorescent microparticles, and the like. One skilled in the art will understand that directly detectable labels may require additional components, such as substrates, triggering reagents, light, and the like to enable detection of the label. The present invention also contemplates the use of labels that are detected indirectly.


The probes of the invention are preferably at least about 15 nt, and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably, at least about 40 nt, at least about 50 nt, at least about 75 nt, or at least about 150 nt in length. A probe of “at least 20 nt in length,” for example, is intended to include 20 or more contiguous bases that are complementary to an mtDNA sequence of the invention. Of course, larger probes (e.g., 50, 150, 500, 600, 2000 nucleotides) may be preferable.


The probes of the invention will also hybridize to nucleic acid molecules in biological samples, thereby enabling the methods of the invention. Accordingly, in one aspect of the invention, there is provided a hybridization probe for use in the detection of cancer, wherein the probe is complementary to at least a portion of an aberrant mtDNA molecule. In another aspect the present invention provides probes and a use of (or a method of using) such probes for the detection of colorectal cancer, lung cancer, breast cancer, ovarian cancer, testicular, cancer, prostate cancer and/or melanoma skin cancer.


Assays


Measuring the level of aberrant mtDNA in a biological sample can determine the presence of one or more cancers in a subject. The present invention, therefore, encompasses methods for predicting, diagnosing or monitoring cancer, comprising obtaining one or more biological samples, extracting mtDNA from the samples, and assaying the samples for aberrant mtDNA by: quantifying the amount of one or more aberrant mtDNA sequences in the sample and comparing the quantity detected with a reference value. As would be understood by those of skill in the art, the reference value is based on whether the method seeks to predict, diagnose or monitor cancer. Accordingly, the reference value may relate to mtDNA data collected from one or more known non-cancerous biological samples, from one or more known cancerous biological samples, and/or from one or more biological samples taken over time.


In one aspect, the invention provides a method of detecting cancer in a mammal, the method comprising assaying a tissue sample from the mammal for the presence of an aberrant mitochondrial DNA described above. The present invention also provides for methods comprising assaying a tissue sample from the mammal by hybridizing the sample with at least one hybridization probe. The probe may be generated against a mutant mitochondrial DNA sequence of the invention as described herein.


In another aspect, the invention provides a method as above, wherein the assay comprises:


a) conducting a hybridization reaction using at least one of the probes to allow the at least one probe to hybridize to a complementary aberrant mitochondrial DNA sequence;


b) quantifying the amount of the at least one aberrant mitochondrial DNA sequence in the sample by quantifying the amount of the mitochondrial DNA hybridized to the at least one probe; and,


c) comparing the amount of the mitochondrial DNA in the sample to at least one known reference value.


Also included in the present invention are methods for predicting, diagnosing or monitoring cancer comprising diagnostic imaging assays as described below. The diagnostic assays of the invention can be readily adapted for high-throughput. High-throughput assays provide the advantage of processing many samples simultaneously and significantly decrease the time required to screen a large number of samples. The present invention, therefore, contemplates the use of the nucleotides of the present invention in high-throughput screening or assays to detect and/or quantitate target nucleotide sequences in a plurality of test samples.


Fusion Transcripts


The present invention further provides the identification of fusion transcripts and associated hybridization probes useful in methods for predicting, diagnosing and/or monitoring cancer. One of skill in the art will appreciate that such molecules may be derived through the isolation of naturally-occurring transcripts or, alternatively, by the recombinant expression of mtDNAs isolated according to the methods of the invention. As discussed, such mtDNAs typically comprise a spliced gene having the initiation codon from the first gene and the termination codon of the second gene. Accordingly, fusion transcripts derived therefrom comprise a junction point associated with the spliced genes.


Detection of Fusion Transcripts


Naturally occurring fusion transcripts can be extracted from a biological sample and identified according to any suitable method known in the art, or may be conducted according to the methods described in the examples. In one embodiment of the invention, stable polyadenylated fusion transcripts are identified using Oligo(dT) primers that target transcripts with poly-A tails, followed by RT-PCR using primer pairs designed against the target transcript.


The following exemplary fusion transcripts were detected using such methods and found useful in predicting, diagnosing and/or monitoring cancer as indicated in the examples. Likewise, fusion transcripts derived from the ORF sequences identified in Table 1 may be useful in predicting, diagnosing and/or monitoring cancer according to the assays and methods of the present invention.


SEQ ID NO: 18 (Transcripts 1; 8469:13447; AltMet)


SEQ ID NO: 19 (Transcript 2; 10744:14124)


SEQ ID NO: 20 (Transcript 3; 7974:15496)


SEQ ID NO: 21 (Transcript 4; 7992:15730)


SEQ ID NO: 22 (Transcript 5; 8210:15339)


SEQ ID NO: 23 (Transcript 6; 8828:14896)


SEQ ID NO: 24 (Transcript 7; 10665:14856)


SEQ ID NO: 25 (Transcript 8; 6075:13799)


SEQ ID NO: 26 (Transcript 9; 6325:13989)


SEQ ID NO: 27 (Transcript 10; 7438:13476)


SEQ ID NO: 28 (Transcript 11; 7775:13532)


SEQ ID NO: 29 (Transcript 12; 8213:13991)


SEQ ID NO: 30 (Transcript 14; 9191:12909)


SEQ ID NO: 31 (Transcript 15; 9574:12972)


SEQ ID NO: 32 (Transcript 16; 10367:12829)


SEQ ID NO: 33 (Transcript 20; 8469:13447; OrigMet)


SEQ ID NO: 50 (Transcript 13; 9144:13816)


Further, fusion transcripts of like character to those described herein are contemplated for use in the field of clinical oncology.


Fusion transcripts can also be produced by recombinant techniques known in the art. Typically this involves transformation (including transfection, transduction, or infection) of a suitable host cell with an expression vector comprising an mtDNA sequence of interest.


Variants or fragments of the fusion transcripts identified herein are also provided. Such sequences may adhere to the size limitations and percent identities described above with respect to genomic variants and fragments, or as determined suitable by a skilled technician.


In addition, putative protein sequences corresponding to transcripts 1-16 and 20 are listed below. These sequences, which encode hypothetical fusion proteins, are provided as a further embodiment of the present invention.


SEQ ID NO: 34 (Transcripts 1)


SEQ ID NO: 35 (Transcript 2)


SEQ ID NO: 36 (Transcript 3)


SEQ ID NO: 37 (Transcript 4)


SEQ ID NO: 38 (Transcript 5)


SEQ ID NO: 39 (Transcript 6)


SEQ ID NO: 40 (Transcript 7)


SEQ ID NO: 41 (Transcript 8)


SEQ ID NO: 42 (Transcript 9)


SEQ ID NO: 43 (Transcript 10)


SEQ ID NO: 44 (Transcript 11)


SEQ ID NO: 45 (Transcript 12)


SEQ ID NO: 46 (Transcript 14)


SEQ ID NO: 47 (Transcript 15)


SEQ ID NO: 48 (Transcript 16)


SEQ ID NO: 49 (Transcripts 20)


SEQ ID NO: 52 (Transcript 13)


Probes


Once a fusion transcript has been characterized, primers or probes can be developed to target the transcript in a biological sample. Such primers and probes may be prepared using any known method (as described above) or as set out in the examples provided below. A probe may, for example, be generated for the fusion transcript, and detection technologies, such as QuantiGene 2.0™ by Panomics™, used to detect the presence of the transcript in a sample. Primers and probes may be generated directly against exemplary fusion transcripts of the invention, or to a fragment or variant thereof. For instance, the sequences set forth in SEQ ID NOs: 18-33 and 50 as well as those disclosed in Table 1 can be used to design probes that will detect a nucleic acid sequence comprising a fusion sequence of interest.


As would be understood by those skilled in the art, probes designed to hybridize to the fusion transcripts of the invention contain a sequence complementary to at least a portion of the transcript expressing the junction point of the spliced genes. This portion includes at least one of the nucleotides complementary to the expressed junction point, and may further comprise one or more complementary nucleotides adjacent thereto. In this regard, the present invention encompasses any suitable targeting mechanism that will select a fusion transcript that uses the nucleotides involved and adjacent to the junction point of the spliced genes.


Various types of probes and methods of labelling known in the art are contemplated for the preparation of transcript probes. Such types and methods have been described above with respect to the detection of genomic sequences. The transcript probes of the invention are preferably at least about 15 nt, and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably, at least about 40 nt, at least about 50 nt, at least about 75 nt, or at least about 150 nt in length. A probe of “at least 20 nt in length,” for example, is intended to include 20 or more contiguous bases that are complementary to an mtDNA sequence of the invention. Of course, larger probes (e.g., 50, 150, 500, 600, 2000 nucleotides) may be preferable.


In one aspect, the invention provides a hybridization probe for use in the detection of cancer, wherein the probe is complementary to at least a portion of a mitochondrial fusion transcript provided above.


In another aspect, the present invention provides probes and a use of (or a method of using) such probes for the detection of colorectal cancer, lung cancer, breast cancer, ovarian cancer, testicular cancer, prostate cancer or melanoma skin cancer.


Assays


Measuring the level of mitochondrial fusion transcripts in a biological sample can determine the presence of one or more cancers in a subject. The present invention, therefore, provides methods for predicting, diagnosing or monitoring cancer, comprising obtaining one or more biological samples, extracting mitochondrial RNA from the samples, and assaying the samples for fusion transcripts by: quantifying the amount of one or more fusion transcripts in the sample and comparing the quantity detected with a reference value. As would be understood by those of skill in the art, the reference value is based on whether the method seeks to predict, diagnose or monitor cancer. Accordingly, the reference value may relate to transcript data collected from one or more known non-cancerous biological samples, from one or more known cancerous biological samples, and/or from one or more biological samples taken over time.


In one aspect, the invention provides a method of detecting a cancer in a mammal, the method comprising assaying a tissue sample from said mammal for the presence of at least one fusion transcript of the invention by hybridizing said sample with at least one hybridization probe having a nucleic acid sequence complementary to at least a portion of the mitochondrial fusion transcript.


In another aspect, the invention provides a method as above, wherein the assay comprises:


a) conducting a hybridization reaction using at least one of the above-noted probes to allow the at least one probe to hybridize to a complementary mitochondrial fusion transcript;


b) quantifying the amount of the at least one mitochondrial fusion transcript in the sample by quantifying the amount of the transcript hybridized to the at least one probe; and,


c) comparing the amount of the mitochondrial fusion transcript in the sample to at least one known reference value.


As discussed above, the diagnostic assays of the invention may also comprise diagnostic methods and screening tools as described herein and can be readily adapted for high-throughput. The present invention, therefore, contemplates the use of the fusion transcripts and associated probes of the present invention in high-throughput screening or assays to detect and/or quantitate target nucleotide sequences in a plurality of test samples.


Diagnostic Methods and Screening Tools


Methods and screening tools for diagnosing specific diseases or identifying specific mitochondrial mutations are also herein contemplated. Any known method of hybridization may be used to carry out such methods including, without limitation, probe/primer based technologies such as branched DNA and qPCR, both single-plex and multi-plex. Array technology, which has oligonucleotide probes matching the wild type or mutated region, and a control probe, may also be used. Commercially available arrays such as microarrays or gene chips are suitable. These arrays contain thousands of matched and control pairs of probes on a slide or microchip, and are capable of sequencing the entire genome very quickly. Review articles describing the use of microarrays in genome and DNA sequence analysis are available on-line.


Screening tools designed to identify targets which are relevant to a given biological condition may include specific arrangements of nucleic acids associated with a particular disease or disorder. Thus, in accordance with one embodiment of the invention, there is provided a screening tool comprised of a microarray having 10's, 100's, or 1000's of mitochondrial fusion transcripts for identification of those associated with one or more cancers. In accordance with another embodiment, there is provided a screening tool comprised of a microarray having 10's, 100's, or 1000's of mitochondrial DNAs corresponding to mitochondrial fusion transcripts for identification of those associated with one or more cancers. In a further embodiment, there is provided a screening tool comprised of a multiplexed branched DNA assay having 10's, 100's, or 1000's of mitochondrial fusion transcripts for identification of those associated with one or more cancers. In yet another embodiment of the invention, there is provided a screening tool comprised of a multiplexed branched DNA assay having 10's, 100's, or 1000's of mitochondrial DNAs corresponding to mitochondrial fusion transcripts for identification of those associated with one or more cancers.


Approaches useful in the field of clinical oncology are also herein contemplated and may include such diagnostic imaging techniques as Positron Emission Tomography (PET), contrast Magnetic Resonance Imaging (MRI) or the like. These diagnostic methods are well known to those of skill in the art and are useful in the diagnosis and prognosis of cancer.


Diagnostic Monitoring


The methods of the present invention may further comprise the step of recommending a monitoring regime or course of therapy based on the outcome of one or more assays. This allows clinicians to practice personalized medicine; e.g. cancer therapy, by monitoring the progression of the patient's cancer (such as by recognizing when an initial or subsequent mutation occurs) or treatment (such as by recognizing when a mutation is stabilized).


With knowledge of the boundaries of the sequence variation in hand, the information can be used to diagnose a pre-cancerous condition or existing cancer condition. Further, by quantitating the amount of aberrant mtDNA in successive samples over time, the progression of a cancer condition can be monitored. For example, data provided by assaying the patient's tissues at one point in time to detect a first set of mutations from wild-type could be compared against data provided from a subsequent assay, to determine if changes in the aberration have occurred.


Where a mutation is found in an individual who has not yet developed symptoms of cancer, the mutation may be indicative of a genetic susceptibility to develop a cancer condition. A determination of susceptibility to disease or diagnosis of its presence can further be evaluated on a qualitative basis based on information concerning the prevalence, if any, of the cancer condition in the patient's family history and the presence of other risk factors, such as exposure to environmental factors and whether the patient's cells also carry a mutation of another sort.


Biological Sample


The present invention provides for diagnostic tests which involve obtaining or collecting one or more biological samples. In the context of the present invention, “biological sample” refers to a tissue or bodily fluid containing cells from which mtDNA and mtRNA can be obtained. For example, the biological sample can be derived from tissue including, but not limited to, skin, lung, breast, prostate, nervous, muscle, heart, stomach, colon, rectal tissue and the like; or from blood, saliva, cerebral spinal fluid, sputa, urine, mucous, synovial fluid, peritoneal fluid, amniotic fluid and the like. The biological sample may be obtained from a cancerous or non-cancerous tissue and may be, but is not limited to, a surgical specimen or a biopsy specimen.


The biological sample can be used either directly as obtained from the source or following a pre-treatment to modify the character of the sample. Thus, the biological sample can be pre-treated prior to use by, for example, preparing plasma or serum from blood, disrupting cells, preparing liquids from solid materials, diluting viscous fluids, filtering liquids, distilling liquids, concentrating liquids, inactivating interfering components, adding reagents, and the like.


One skilled in the art will understand that more than one sample type may be assayed at a single time (i.e. for the detection of more than one cancer). Furthermore, where a course of collections are required, for example, for the monitoring of cancer over time, a given sample may be diagnosed alone or together with other samples taken throughout a test period. In this regard, biological samples may be taken once only, or at regular intervals such as biweekly, monthly, semi-annually or annually.


Kits


The present invention provides diagnostic/screening kits for detecting cancer in a clinical environment. Such kits may include one or more sampling means, in combination with one or more probes according to the present invention.


The kits can optionally include reagents required to conduct a diagnostic assay, such as buffers, salts, detection reagents, and the like. Other components, such as buffers and solutions for the isolation and/or treatment of a biological sample, may also be included in the kit. One or more of the components of the kit may be lyophilised and the kit may further comprise reagents suitable for the reconstitution of the lyophilised components.


Where appropriate, the kit may also contain reaction vessels, mixing vessels and other components that facilitate the preparation of the test sample. The kit may also optionally include instructions for use, which may be provided in paper form or in computer-readable form, such as a disc, CD, DVD or the like.


In one embodiment of the invention there is provided a kit for diagnosing cancer comprising sampling means and a hybridization probe of the invention.


Various aspects of the invention will be described by illustration using the following examples. The examples provided herein serve only to illustrate certain specific embodiments of the invention and are not intended to limit the scope of the invention in any way.


Examples
Example 1: Detection of Mitochondrial Fusion Transcripts

The mitochondrial 4977 “common deletion” and a 3.4 kb deletion previously identified by the present Applicant in PCT application no. PCT/CA2007/001711 (the entire contents of which are incorporated by reference) result in unique open reading frames having active transcripts as identified by oligo-dT selection in prostate tissue (FIGS. 2 and 3). Examination of breast tissue samples also reveals the presence of a stable polyadenylated fusion transcript resulting from the 3.4 kb deletion (FIG. 4).


Reverse Transcriptase-PCR Protocol for Deletion Transcript Detection


RNA Isolation cDNA Synthesis


Total RNA was isolated from snap frozen prostate and breast tissue samples (both malignant and normal samples adjacent to tumours) using the Aurum™ Total RNA Fatty and Fibrous Tissue kit (Bio-Rad, Hercules, Calif.) following the manufacturer's instructions. Since in this experiment, genomic DNA contamination was to be avoided, a DNase I treatment step was included, using methods as commonly known in the art. RNA quantity and quality were determined with an ND-1000 spectrophotometer (NanoDrop® technologies). From a starting material of about 100 g, total RNA concentrations varied from 100-1000 ng/ul with a 260/280 ratio between 1.89-2.10. RNA concentrations were adjusted to 100 ng/ul and 2 ul of each template were used for first strand DNA synthesis with SuperScript™ First-Strand Synthesis System for RT-PCR (Invitrogen) following the manufacturer's instructions. In order to identify stable polyadenylated fusion transcripts, Oligo(dT) primers that target transcripts with poly-A tails were used.


PCR


Real time PCR was performed using 5 ul of each cDNA template with the iQ™ SYBR® Green Supermix (Bio-Rad, Hercules, Calif.) on DNA Engine Opticon® 2 Continuous Fluorescence Detection System (Bio-Rad, Hercules, Calif.). The primer pairs targeting the 4977 bp deletion are; 8416F 5′-CCTTACACTATTCCTCATCAC-3′ (SEQ ID NO: 53), 13637R 5′-TGACCTGTTAGGGTGAGAAG-3′ (SEQ ID NO: 54), and those for the 3.4 kb deletion are; ND4LF 5′-TCGCTCACACCTCATATCCTC-3′ (SEQ ID NO: 55), ND5R 5′-TGTGATTAGGAGTAGGGTTAGG-3′ (SEQ ID NO: 56). The reaction cocktail included: 2×SYBR® Green Supermix (100 mM KCL, 40 mM Tris-HCl, pH 8.4, 0.4 mM of each dNTP [dATP, dCTP, dGTP, and dTTP], iTaq™ DNA polymerase, 50 units/ml, 6 mM MgCl2, SYBR® Green 1, 20 nM flourescein, and stabilizers), 250 nM each of primers, and ddH2O. PCR cycling parameters were as follows; (1) 95° C. for 2 min, (2) 95° C. for 30 sec, (3) 55° C. (for the 4977 bp deletion) and 63° C. (for the 3.4 kb deletion) for 30 sec, (4) 72° C. for 45 sec, (5) plate read, followed by 39 cycles of steps 3 to 5, and final incubation at 4° C. Apart from cycling threshold and melting curve analysis, samples were run on agarose gels for specific visualization of amplification products (see FIGS. 2 to 4).



FIG. 2 is an agarose gel showing polyadenalated fusion transcripts in prostate samples invoked by the loss of 3.4 kb from the mitochondrial genome. Legend for FIG. 2: B-blank, Lanes 1-6 transcripts detected in cDNA; lanes 7-12 no reverse transcriptase (RT) controls for samples in lanes 1-6.



FIG. 3 shows polyadenalated fusion transcripts in prostate samples invoked by the loss of the 4977 kb common deletion. Legend for FIG. 3: B-blank, Lanes 1-6 transcripts detected in cDNA; lanes 7-12 no RT controls for samples in lanes 1-6.



FIG. 4 shows polyadenalated fusion transcripts in breast samples invoked by the loss of 3.4 kb from the mtgenome. Legend for FIG. 4: Lanes 2-8 transcripts from breast cDNAs; lane 9 negative (water) control; lanes 10 and 11, negative, no RT, controls for samples in lanes 2 and 3.


These results demonstrate the existence of stable mitochondrial fusion transcripts.


Example 2: Identification and Targeting of Fusion Products

Various hybridization probes were designed to detect, and further demonstrate the presence of novel transcripts resulting from mutated mitochondrial genomes, such as the 3.4 kb deletion. For this purpose, a single-plex branched DNA platform for quantitative gene expression analysis (QuantiGene 2.0™, Panomics™) was utilized. The specific deletions and sequences listed in this example are based on their relative positions with the entire mtDNA genome, which is recited in SEQ ID NO: 1. The nucleic acid sequences of the four transcript to which the probes were designed in this example are identified herein as follows: Transcript 1 (SEQ ID NO: 18), Transcript 2 (SEQ ID NO: 19), Transcript 3 (SEQ ID NO: 20) and Transcript 4 (SEQ ID NO: 21).


An example of a continuous transcript from the 3.4 kb mitochondrial genome deletion occurs with the genes ND4L (NADH dehydrogenase subunit 4L) and ND5 (NADH dehydrogenase subunit 5). A probe having a complementary sequence to SEQ ID NO: 19, was used to detect transcript 2. The repetitive elements occur at positions 10745-10754 in ND4L and 14124-14133 in ND5.


The 3.4 kb deletion results in the removal of the 3′ end of ND4L, the full ND4 gene, tRNA histidine, tRNA serine2, tRNA leucine2, and the majority of the 5′ end of ND5 (see FIG. 5A), resulting in a gene splice of ND4L and ND5 with a junction point of 10744(ND4L):14124(ND5) (FIG. 5B). SEQ ID NO: 3 is the complementary DNA sequence to the RNA transcript (SEQ ID NO: 19) detected in the manner described above.


Similarly, transcript 1 is a fusion transcript between ATPase 8 and ND5 associated with positions 8469:13447 (SEQ ID NO: 18). Transcripts 3 and 4 (SEQ ID NO: 20 and SEQ ID NO: 21, respectively) are fusion transcripts between C011 and Cytb associated with nucleotide positions 7974:15496 and 7992:15730 respectively. Table 3 provides a summary of the relationships between the various sequences used in this example. Table 3 includes the detected fusion transcript and the DNA sequence complementary to the fusion transcript detected.


Example 3: Application to Prostate Cancer

Using the four fusion transcripts, i.e. transcripts 1 to 4, discussed above, two prostate tissue samples from one patient were analyzed to assess the quantitative difference of the novel predicted fusion transcripts. The results of the experiment are provided in Table 2 below, wherein “Homog 1” refers to the homogenate of frozen prostate tumour tissue from a patient and “Homog 2” refers to the homogenate of frozen normal prostate tissue adjacent to the tumour of the patient. These samples were processed according to the manufacturer's protocol (QuantiGene® Sample Processing Kit for Fresh or Frozen Animal Tissues; and QuantiGene® 2.0 Reagent System User Manual) starting with 25.8 mg of Homog 1 and 28.9 mg of Homog 2 (the assay setup is shown in Tables 5a and 5b).


Clearly demonstrated is an increased presence of mitochondrial fusion transcripts in prostate cancer tissue compared to normal adjacent prostate tissue. The fusion transcript is present in the normal tissue, although at much lower levels. The relative luminescence units (RLU) generated by hybridization of a probe to a target transcript are directly proportional to the abundance of each transcript. Table 2 also indicates the coefficients of variation, CV, expressed as a percentage, of the readings taken for the samples. The CV comprises the Standard deviation divided by the average of the values. The significance of such stably transcribed mitochondrial gene products in cancer tissue has implications in disease evolution and progression.


Example 4: Application to Breast Cancer

Using the same protocol from Example 3 but focusing only on Transcript 2, the novel fusion transcript associated with the 3.4 kb mtgenome deletion, analyses were conducted on two samples of breast tumour tissue and two samples of tumour-free tissues adjacent to those tumours, as well as three samples of prostate tumour tissue, one sample comprising adjacent tumour-free tissue. Results for this example are provided in Table 4. The prostate tumour tissue sample having a corresponding normal tissue section demonstrated a similar pattern to the prostate sample analyzed in Example 3 in that the tumour tissue had approximately 2 times the amount of the fusion transcript than did the normal adjacent tissue. The breast tumour samples demonstrated a marked increase in the fusion transcript levels when compared to the adjacent non-tumour tissues. A 1:100 dilution of the homogenate was used for this analysis as it performed most reproducibly in the experiment cited in Example 3.


Thus, the above discussed results illustrate the application of the transcripts of the invention in the detection of tumours of both prostate and breast tissue.


Example 5: Application to Colorectal Cancer

This study sought to determine the effectiveness of several transcripts of the invention in detecting colorectal cancer. A total of 19 samples were prepared comprising nine control (benign) tissue samples (samples 1 to 9) and ten tumour (malignant) tissue samples (samples 10 to 19). The samples were homogenized according to the manufacturer's recommendations (Quantigene® Sample Processing Kit for Fresh or Frozen Animal Tissues; and Quantigene 2.0 Reagent System User Manual). Seven target transcripts and one housekeeper transcript were prepared in the manner as outlined above in previous examples. The characteristics of the transcripts are summarized as follows:









TABLE 7







Characteristics of Breast Cancer Transcripts









Transcript ID
Junction Site
Gene Junction





 2
10744:14124 
ND4L:ND5


 3
7974:15496
COII:Cytb


10
7438:13476
COI:ND5


11
7775:13532
COII:ND5


12
8213:13991
COII:ND5


Peptidylpropyl isomerase B (PPIB)
N/A
N/A


(“housekeeper”)









It is noted that transcripts 2 and 3 are the same as those discussed above with respect to Examples 3 and 4.


Homogenates were prepared using approximately 25 mg of tissue from OCT blocks and diluted 1:1 for transcripts 2 and 4, and 1:8 for transcripts 10 and 11. The quantity of the transcripts was measured in Relative Luminenscence Units RLU on a Glomax™ Multi Detection System (Promega). All samples were assayed in triplicate for each transcript. Background measurements (no template) were done in triplicate as well. The analysis accounted for background by subtracting the lower limit from the RLU values for the samples. Input RNA was accounted for by using the formula log2 a RLU−log2 h RLU where a is the target fusion transcript and h is the housekeeper transcript.


The analysis of the data comprised the following steps:


a) Establish CV's (coefficients of variation) for triplicate assays; acceptable if 15%.


b) Establish average RLU value for triplicate assays of target fusion transcript (a) and housekeeper transcript (h).


c) Establish lower limit from triplicate value of background RLU (I).


d) Subtract lower limit (I) from (a).


e) Calculate log2 a RLU−log2 h RLU.


Summary of Results:


The results of the above analysis are illustrated in FIGS. 6A to 6G, which comprise plots of the log2 a RLU−log2 h RLU against sample number. Also illustrated are the respective ROC (Receiver Operating Characteristic) curves determined from the results for each transcript.


Transcript 2:


There exists a statistically significant difference between the means (p<0.10) of the normal and malignant groups (p>0.09), using a cutoff value of 3.6129 as demonstrated by the ROC curve results in a sensitivity of 60% and specificity of 89% and the area under the curve is 0.73 indicating fair test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 3:


There exists a statistically significant difference between the means (p<0.05) of the normal and malignant groups (p=0.03), using a cutoff value of 4.0813 as demonstrated by the ROC curve results in a sensitivity of 60% and specificity of 78% and the area under the curve is 0.79 indicating fair to good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 8:


There exists a statistically significant difference between the means (p<0.1) of the normal and malignant groups (p=0.06). Using a cutoff value of −6.0975 as demonstrated by the ROC curve results in a sensitivity of 60% and specificity of 89% and the area under the curve is 0.76 indicating fair test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 9:


There exists a statistically significant difference between the means (p<0.1) of the normal and malignant groups (p=0.06). Using a cutoff value of −7.5555 as demonstrated by the ROC curve results in a sensitivity of 60% and specificity of 89% and the area under the curve is 0.76 indicating fair to good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 10:


There is a statistically significant difference between the means (p≦1.01) of the normal and malignant groups (p=0.01). Using a cutoff value of −3.8272 as demonstrated by the ROC curve results in a sensitivity of 90% and specificity of 67% and the area under the curve is 0.84, indicating good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 11:


There exists a statistically significant difference between the means (p<0.1) of the normal and malignant groups (p=0.06), using a cutoff value of 3.1753 as demonstrated by the ROC curve results in a sensitivity of 70% and specificity of 78% and the area under the curve is 0.76 indicating fair to good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 12:


There exists a statistically significant difference between the means (p<0.1) of the normal and malignant groups (p=0.06), using a cut-off value of 3.2626 as demonstrated by the ROC curve results in a sensitivity of 70% and specificity of 78% and the area under the curve is 0.76 indicating fair to good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Conclusions:


The above results illustrate the utility of transcripts 2, 3, 8, 9, 10, 11, and 12 in the detection of colorectal cancer and in distinguishing malignant from normal colorectal tissue. As indicated above, transcripts 2 and 3 were also found to have utility in the detection of prostate cancer. Transcript 2 was also found to have utility in the detection of breast cancer. Transcript 11 was also found to have utility in the detection of melanoma skin cancer. Transcript 10 was also found to have utility in the detection of lung cancer and melanoma. Transcript 8 was also found to have utility in the detection of lung cancer. Any of the 7 transcripts listed may be used individually or in combination as a tool for the detection of characterization of colorectal cancer in a clinical setting.


Example 6: Application to Lung Cancer

This study sought to determine the effectiveness of several transcripts of the invention in the detection of lung cancer. As in Example 5, nine control (benign) tissue samples (samples 1 to 9) and ten tumour (malignant) tissue samples (samples 10 to 19) were homogenized according to the manufacturer's recommendations (Quantigene® Sample Processing Kit for Fresh or Frozen Animal Tissues; and Quantigene 2.0 Reagent System User Manual). Homogenates were diluted 1:8 and the quantity of 4 target transcripts and 1 housekeeper transcript was measured in Relative Luminenscence Units RLU on a Glomax™ Multi Detection System (Promega). All samples were assayed in triplicate for each transcript. Background measurements (no template) were done in triplicate as well.


The following transcripts were prepared for this example:









TABLE 8







Characteristics of Lung Cancer Transcripts









Transcript ID
Junction Site
Gene Junction





 6
8828:14896
ATPase6:Cytb


 8
6075:13799
COI:ND5


10
7438:13476
COI:ND5


20
8469:13447
ATPase8:ND5


Peptidylpropyl isomerase B (PPIB)
N/A
N/A


(“housekeeper”)









The tissue samples used in this example had the following characteristics:









TABLE 9







Characteristics of Lung Cancer Samples









Sample
Malignant
Comments (source of tissue)












1
NO
interstitial lung disease


2
NO
emphysema


3
NO
aneurysm


4
NO
bronchopneumonia, COPD


5
NO
malignant neoplasm in liver, origin unknown,




calcified granulomas in lung


6
NO
12 hours post mortem, mild emphysema


7
NO
12 hours post mortem, large B cell lymphoma,




pulmonary edema, pneumonia


8
NO
pneumonia, edema, alveolar damage


9
NO
congestion and edema


10
YES
adenocarcinoma, non-small cell


11
YES
small cell


12
YES
squamous cell carcinoma, NSC, emphysema


13
YES
adenocarcinoma, lung cancer, nsc, metastatic


14
YES
squamous cell carcinoma, non-small cell


15
YES
mixed squamous and adenocarcinoma


16
YES
non-small cell carcinoma, squamous


17
YES
small cell carcinoma


18
YES
adenocarcinoma, lung cancer, nsc


19
YES
adenocarcinoma, lung cancer, nsc, metastatic









The analysis of data was performed according to the method described in Example 5. The results are illustrated in FIGS. 7A, 7B, 7C and 7D.


Summary of Results:


Transcript 6:


There exists a statistically significant difference between the means (p<0.1) of the normal (benign) and malignant groups (p=0.06), using a cutoff value of −6.5691 as demonstrated by the ROC curve results in a sensitivity of 80% and specificity of 71% and the area under the curve is 0.77, indicating fair test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 8:


The difference between the means of the normal and malignant groups is statistically significant, p<0.05 (p=0.02). Using a cutoff value of −9.6166 as demonstrated by the ROC curve results in a sensitivity of 90% and specificity of 86% and the area under the curve is 0.86 indicating good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 10:


The difference between the means of the normal and malignant groups is statistically significant, p≦1.01 (p=0.01). Using a cutoff value of −10.6717 as demonstrated by the ROC curve results in a sensitivity of 90% and specificity of 86% and the area under the curve is 0.89 indicating good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 20:


The difference between the means of the normal and malignant groups is statistically significant, p≦1.1 (p=0.1). Using a cutoff value of 2.5071 as demonstrated by the ROC curve results in a sensitivity of 70% and specificity of 71% and the area under the curve is 0.74 indicating fair test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Conclusions:


The results from example 6 illustrate the utility of transcripts 6, 8, 10, and 20 of the invention in the detection of lung cancer tumours and the distinction between malignant and normal lung tissues. Any of these three transcripts may be used for the detection or characterization of lung cancer in a clinical setting.


Example 7: Application to Melanoma

This study sought to determine the effectiveness of several transcripts of the invention in the detection of melanomas. In this study a total of 14 samples were used, comprising five control (benign) tissue samples and nine malignant tissue samples. All samples were formalin fixed, paraffin embedded (FFPE). The FFPE tissue samples were sectioned into tubes and homogenized according to the manufacturer's recommendations (Quantigene® 2.0 Sample Processing Kit for FFPE Samples; and Quantigene 2.0 Reagent System User Manual) such that each sample approximated 20 microns prior to homogenization. Homogenates were diluted 1:4 and the quantity of 7 target transcripts and 1 housekeeper transcript was measured in Relative Luminenscence Units RLU on a Glomax™ Multi Detection System (Promega). All samples were assayed in triplicate for each transcript. Background measurements (no template) were done in triplicate as well.


The 14 tissue samples used in this example had the following characteristics:









TABLE 10







Characteristics of Melanoma Cancer Samples









Sample
Malignant
Comments (source of tissue)












1
NO
breast reduction tissue (skin)


2
NO
breast reduction tissue (skin)


3
NO
breast reduction tissue (skin)


4
NO
breast reduction tissue (skin)


5
NO
breast reduction tissue (skin)


6
YES
lentigo maligna, (melanoma in situ) invasive




melanoma not present


7
YES
invasive malignant melanoma


8
YES
nodular melanoma, pT3b, associated features of




lentigo maligna


9
YES
residual superficial spreading invasive malignant




melanoma, Clark's level II


10
YES
superficial spreading malignant melanoma,




Clark's Level II


11
YES
nodular malignant melanoma, Clark's level IV


12
YES
superficial spreading malignant melanoma in situ,




no evidence of invasion


13
YES
superficial spreading malignant melanoma, Clark's




level II, focally present vertical phase


14
YES
superficial spreading malignant melanoma in situ,




Clark's level I









The following transcripts were prepared for this example:









TABLE 11







Characteristics of Melanoma Cancer Transcripts









Transcript ID
Junction Site
Gene Junction





 6
8828:4896 
ATPase6:Cytb


10
7438:13476
COI:ND5


11
7775:13532
COII:ND5


14
9191:12909
ATPase6:ND5


15
9574:12972
COIII:ND5


16
10367:12829 
ND3:ND5


20
8469:13447
ATPase8:ND5


Peptidylpropyl isomerase B (PPIB)
N/A
N/A


(“housekeeper”)









As indicated, transcripts 10 and 11 were also used in Example 5. The analysis of data was performed according to the method described in Example 5. The results are illustrated in FIGS. 8A-8G.


Summary of Results:


Transcript 6:


There exists a statistically significant difference between the means (p≦1.01) of the normal and malignant groups (p=0.01). Further, using a cutoff value of −5.9531 as demonstrated by the ROC curve results in a sensitivity of 89% and specificity of 80% and the area under the curve is 0.96, indicating very good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 10:


There exists a statistically significant difference between the means (p≦0.05) of the normal and malignant groups (p=0.05), using a cutoff value of −4.7572 as demonstrated by the ROC curve results in a sensitivity of 89% and specificity of 40% and the area under the curve is 0.82, indicating good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 11:


There exists a statistically significant difference between the means (p<0.05) of the normal and malignant groups (p=0.02). Further, using a cutoff value of 1.6762 as demonstrated by the ROC curve results in a sensitivity of 78% and specificity of 100% and the area under the curve is 0.89, indicating good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 14:


There exists a statistically significant difference between the means (p≦0.05) of the normal and malignant groups (p=0.05). Further, using a cutoff value of −4.9118 as demonstrated by the ROC curve results in a sensitivity of 89% and specificity of 60% and the area under the curve is 0.82, indicating good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 15:


There exists a statistically significant difference between the means (p<0.1) of the normal and malignant groups (p=0.07), using a cutoff value of −7.3107 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 67% and the area under the curve is 0.80, indicating good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 16:


There exists a statistically significant difference between the means (p<0.05) of the normal and malignant groups (p=0.03). Further, using a cutoff value of −10.5963 as demonstrated by the ROC curve results in a sensitivity of 89% and specificity of 80% and the area under the curve is 0.878, indicating good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 20:


There exists a statistically significant difference between the means (p<0.05) of the normal and malignant groups (p=0.04). Further, using a cutoff value of −8.3543 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 80% and the area under the curve is 0.89, indicating good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Conclusions:


The results from example 7 illustrate the utility of transcripts 6, 10, 11, 14, 15, 16 and 20 of the invention in the detection of malignant melanomas. As indicated above, transcripts 10 and 11 were also found have utility in detecting colorectal cancer while transcript 6 has utility in the detection of lung cancer. A transcript summary by disease is provided at Table 6.


Example 8: Application to Ovarian Cancer

This study sought to determine the effectiveness of several transcripts of the invention in detecting ovarian cancer. A total of 20 samples were prepared comprising ten control (benign) tissue samples (samples 1 to 10) and ten tumour (malignant) tissue samples (samples 11 to 20). The samples were homogenized according to the manufacturer's recommendations (Quantigene® Sample Processing Kit for Fresh or Frozen Animal Tissues; and Quantigene 2.0 Reagent System User Manual). Eight target transcripts and one housekeeper transcript were prepared in the manner as outlined above in previous examples.


The 20 tissue samples used in this example had the following characteristics:









TABLE 12







Characteristics of Ovarian Cancer Samples









Sample
Diagnosis
Comments












1
Normal
follicular cyst


2
Normal
fibroma


3
Normal
No pathological change in ovaries


4
Normal
follicular cysts


5
Normal
cellular fibroma


6
Normal
benign follicular and simple cysts


7
Normal
leiomyomata, corpora albicantia


8
Normal
copora albicantia and an epithelial inclusions cysts


9
Normal
corpora albicantia


10
Normal
corpora albicantia, surface inclusion cysts,




follicullar cysts


11
Malignant
high grade poorly differentiated papillary serous




carcinoma involving omentum


12
Malignant
endometrioid adenocarcinoma, well to moderately




differentiated with focal




serous differentiation


13
Malignant
papillary serous carcinoma


14
Malignant
mixed epithelial carcinoma predominantly papillary




serous carcinoma


15
Malignant
High grade: serous carcinoma, papillary and solid




growth patterns


16
Malignant
High Grade (3/3) Papillary serous carcinoma


17
Malignant
papillary serous carcinoma, high nuclear grade


18
Malignant
Papillary serous cystadenocarcinomas Grade:III


19
Malignant
poorly differentiated papillary serous carcinoma


20
Malignant
Well-differentiated adnocarcinoma, Endometrioid




type, Grade 1









The characteristics of the transcripts are summarized as follows:









TABLE 13







Characteristics of Ovarian Cancer Transcripts









Transcript ID
Junction Site
Gene Junction












1
8469:13447
ATPase8:ND5


2
10744:14124 
ND4L:ND5


3
7974:15496
COII:Cytb


6
8828:14896
ATPase6:Cytb


11
7775:13532
COII:ND5


12
8213:13991
COII:ND5


15
9574:12972
COIII:ND5


20
8469:13447
ATPase8:ND5


Ribosomal Protein Large PO (LRP)
N/A
N/A


Housekeeper









It is noted that transcripts 1, 2, 3, 6, 11, 12, 15 and 20 are the same as those discussed above with respect to Examples 3-7.


Homogenates were prepared using approximately 25 mg of frozen tissue and diluted 1:4. The quantity of the transcripts was measured in Relative Luminenscence Units RLU on a Glomax™ Multi Detection System (Promega). All samples were assayed in triplicate for each transcript. Background measurements (no template) were done in triplicate as well. The analysis accounted for background by subtracting the lower limit from the RLU values for the samples. Input RNA was accounted for by using the formula log2 a RLU−log2 h RLU where a is the target fusion transcript and h is the housekeeper transcript.


The analysis of the data comprised the following steps:


a) Establish CV's (coefficients of variation) for triplicate assays; acceptable if 15%.


b) Establish average RLU value for triplicate assays of target fusion transcript (a) and housekeeper transcript (h).


c) Establish lower limit from triplicate value of background RLU (I).


d) Subtract lower limit (I) from (a).


e) Calculate log2 a RLU−log2 h RLU.


Summary of Results:


The results of the above analysis are illustrated in FIGS. 9A to 9H, which comprise plots of the log2 a RLU−log2 h RLU against sample number. Also illustrated are the respective ROC (Receiver Operating Characteristic) curves determined from the results for each transcript.


Transcript 1:


There exists a statistically significant difference between the means (p<0.05) of the normal and malignant groups (p=0.002). Using a cutoff value of −11.1503 as demonstrated by the ROC curve results in a sensitivity of 90% and specificity of 80% and the area under the curve is 0.91 indicating very good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 2:


There exists a statistically significant difference between the means (p<0.01) of the normal and malignant groups (p=0.001). Using a cutoff value of 0.6962 as demonstrated by the ROC curve results in a sensitivity of 90% and specificity of 100% and the area under the curve is 0.96 indicating very good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 3:


There exists a statistically significant difference between the means (p<0.01) of the normal and malignant groups (p=0.000). Using a cutoff value of 0.6754 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 100% and the area under the curve is 1.00 indicating excellent test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 6:


There exists a statistically significant difference between the means (p<0.01) of the normal and malignant groups (p=0.007). Using a cutoff value of −9.6479 as demonstrated by the ROC curve results in a sensitivity of 90% and specificity of 70% and the area under the curve is 0.86 indicating good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 11:


There is a statistically significant difference between the means (p<0.01) of the normal and malignant groups (p=0.000). Using a cutoff value of −1.3794 demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 90% and the area under the curve is 0.99, indicating excellent test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 12:


There exists a statistically significant difference between the means (p<0.01) of the normal and malignant groups (p=0.001). Using a cutoff value of −1.2379 as demonstrated by the ROC curve results in a sensitivity of 90% and specificity of 100% and the area under the curve is 0.96 indicating excellent test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 15:


There exists a statistically significant difference between the means (p<0.05) of the normal and malignant groups (p=0.023). Using a cut-off value of −8.6926 as demonstrated by the ROC curve results in a sensitivity of 70% and specificity of 80% and the area under the curve is 0.80 indicating good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 20:


There exists a statistically significant difference between the means (p<0.01) of the normal and malignant groups (p=0.000). Using a cut-off value of 0.6521 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 100% and the area under the curve is 0.76 indicating fair to good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Conclusions:


The above results illustrate the utility of transcripts 1, 2, 3, 6, 11, 12, 15, and 20 in the detection of ovarian cancer and in distinguishing malignant from normal ovarian tissue. Transcripts 1, 2 and 3 were also found to have utility in the detection of prostate cancer. Transcript 6 was also found to have utility in the detection of melanoma and lung cancer. Transcript 11 was also found to have utility in the detection of melanoma skin cancer, colorectal cancer and testicular cancer. Transcript 12 was also found to have utility in the detection of colorectal cancer and testicular cancer. Transcript 15 was also found to have utility in the detection of melanoma and testicular cancer. Transcript 20 was also found to have utility in the detection of colorectal cancer, melanoma, and testicular cancer. Any of the 8 transcripts listed may be used individually or in combination as a tool for the detection or characterization of ovarian cancer in a clinical setting.


Example 9: Application to Testicular Cancer

This study sought to determine the effectiveness of several transcripts of the invention in detecting testicular cancer. A total of 17 samples were prepared comprising eight control (benign) tissue samples (samples 1 to 8) and 9 tumour (malignant) tissue samples (samples 9 to 17), 5 of the malignant samples were non-seminomas (samples 9-13) and 4 were seminomas (samples 14-17). The samples were homogenized according to the manufacturer's recommendations (Quantigene® Sample Processing Kit for Fresh or Frozen Animal Tissues; and Quantigene 2.0 Reagent System User Manual). 10 target transcripts and one housekeeper transcript were prepared in the manner as outlined above in previous examples.


The 17 tissue samples used in this example had the following characteristics:









TABLE 14







Characteristics of Testicular Cancer Samples











Stratified



General
Malignant


Sample
Diagnosis
Diagnosis












1
Benign
Benign


2
Benign
Benign


3
Benign
Benign


4
Benign
Benign


5
Benign
Benign


6
Benign
Benign


7
Benign
Benign


8
Benign
Benign


9
Malignant
Non-




Seminoma


10
Malignant
Non-




Seminoma


11
Malignant
Non-




Seminoma


12
Malignant
Non-




Seminoma


13
Malignant
Non-




Seminoma


14
Malignant
Seminoma


15
Malignant
Seminoma


16
Malignant
Seminoma


17
Malignant
Seminoma









The characteristics of the transcripts are summarized as follows:









TABLE 15







Characteristics of Testicular Cancer Transcripts









Transcript ID
Junction Site
Gene Junction












2
10744:14124 
ND4L:ND5


3
7974:15496
COII:Cytb


4
7992:15730
COII:Cytb


11
7775:13532
COII:ND5


12
8213:13991
COII:ND5


13
9144:13816
ATPase6:ND5


15
9574:12972
COIII:ND5


16
10367:12829 
ND3:ND5


20
8469:13447
ATPase8:ND5


Peptidylpropyl isomerase B (PPIB)
N/A
N/A









It is noted that transcripts 2, 3, 4, 7, 11, 12, 15, 16 and 20 are the same as those discussed above with respect to Examples 3-8.


Homogenates were prepared using approximately 25 mg of frozen tissue and diluted 1:4. The quantity of the transcripts was measured in Relative Luminenscence Units RLU on a Glomax™ Multi Detection System (Promega). All samples were assayed in triplicate for each transcript. Background measurements (no template) were done in triplicate as well. The analysis accounted for background by subtracting the lower limit from the RLU values for the samples. Input RNA was accounted for by using the formula log2 a RLU−log2 h RLU where a is the target fusion transcript and h is the housekeeper transcript.


The analysis of the data comprised the following steps:


a) Establish CV's (coefficients of variation) for triplicate assays; acceptable if 15%.


b) Establish average RLU value for triplicate assays of target fusion transcript (a) and housekeeper transcript (h).


c) Establish lower limit from triplicate value of background RLU (I).


d) Subtract lower limit (I) from (a).


e) Calculate log2 a RLU−log2 h RLU.


Summary of Results:


The results of the above analysis are illustrated in FIGS. 10 to 18, which comprise plots of the log2 a RLU−log2 h RLU against sample number. Also illustrated are the respective ROC (Receiver Operating Characteristic) curves determined from the results for each transcript.


While some transcripts distinguish between benign and malignant testicular tissue, others demonstrate distinction between the tumour subtypes of seminoma and non-seminoma and/or benign testicular tissue. It is therefore anticipated that combining transcripts from each class will facilitate not only detection of testicular cancer but also classification into subtype of seminoma or non-seminomas.


Transcript 2:


There exists a statistically significant difference between the means (p<0.05) of the normal group and the malignant seminomas (p=0.02). Using a cutoff value of 1.5621 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 100% and the area under the curve is 1.00 indicating excellent test accuracy. There also exists a statistically significant difference between the means (p<0.05) of the malignant seminomas and the malignant non-seminomas (p=0.024). Using a cutoff value of 2.1006 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 80% and the area under the curve is 0.90 indicating excellent test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 3:


There exists a statistically significant difference between the means (p<0.05) of the normal group and the malignant seminomas (p=0.018). Using a cutoff value of 0.969 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 87.5% and the area under the curve is 0.969 indicating excellent accuracy. There also exists a statistically significant difference between the means (p<0.05) of the malignant seminomas and the malignant non-seminomas (p=0.017). Using a cutoff value of 1.8181 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 80% and the area under the curve is 0.9 indicating excellent test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 4:


There exists a statistically significant difference between the means (p<0.05) of the normal and malignant groups (p=0.034). Using a cutoff value of −9.7628 as demonstrated by the ROC curve results in a sensitivity of 67% and specificity of 100% and the area under the curve is 0.833 indicating good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 11:


There exists a statistically significant difference between the means (p<0.05) of the normal group and the malignant seminomas (p=0.016). Using a cutoff value of 0.732 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 100% and the area under the curve is 1.00 indicating excellent test accuracy. There also exists a statistically significant difference between the means (p<0.05) of the malignant seminomas and the malignant non-seminomas (p=0.016). Using a cutoff value of 0.9884 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 80% and the area under the curve is 0.90 indicating excellent test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 12:


There exists a statistically significant difference between the means (p<0.1) of the normal group and the malignant seminomas (p=0.056). Using a cutoff value of 1.5361 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 87.5% and the area under the curve is 0.969 indicating excellent test accuracy. There also exists a statistically significant difference between the means (p<0.05) of the malignant seminomas and the malignant non-seminomas (p=0.044). Using a cutoff value of 1.6039 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 80% and the area under the curve is 0.9 indicating excellent test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 13:


There exists a statistically significant difference between the means (p<0.05) of the normal group and the malignant group (p=0.019). Using a cutoff value of −9.8751 as demonstrated by the ROC curve results in a sensitivity of 87.5% and specificity of 78% and the area under the curve is 0.875 indicating very good test accuracy. There also exists a statistically significant difference between the means (p<0.01) of the malignant non-seminomas and the benign group (p=0.000). Using a cutoff value of −13.9519 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 87.5% and the area under the curve is 0.975 indicating excellent test accuracy. There also exists a statistically significant difference between the means (p<0.01) of the malignant seminomas and the malignant non-seminomas (p=0.001). Using a cutoff value of −15.8501 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 100% and the area under the curve is 1.00 indicating excellent test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 15:


There exists a statistically significant difference between the means (p<0.1) of the normal and malignant groups (p=0.065). Using a cut-off value of −5.4916 as demonstrated by the ROC curve results in a sensitivity of 75% and specificity of 89% and the area under the curve is 0.833 indicating good test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 16:


There exists a statistically significant difference between the means (p<0.05) of the normal and malignant groups including both seminomas and non-seminomas (p=0.037). Using a cut-off value of −6.448 as demonstrated by the ROC curve results in a sensitivity of 89% and specificity of 75% and the area under the curve is 0.806 indicating good test accuracy. There also exists a statistically significant difference between the means (p<0.05) of the normal and malignant seminomas (p=0.037). Using a cut-off value of −7.4575 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 87.5% and the area under the curve is 0.938 indicating excellent test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Transcript 20:


There exists a statistically significant difference between the means (p<0.01) of the normal group and the malignant seminomas (p=0.006). Using a cutoff value of 1.8364 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 100% and the area under the curve is 1.00 indicating excellent test accuracy. There also exists a statistically significant difference between the means (p<0.01) of the malignant seminomas and the malignant non-seminomas (p=0.004). Using a cutoff value of 1.6065 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 100% and the area under the curve is 1.00 indicating excellent test accuracy. The threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.


Conclusions:


The above results illustrate the utility of transcripts 2, 3, 4, 11, 12, 13, 15, 16, and 20 in the detection of testicular cancer, and testicular cancer subtypes, and in distinguishing malignant from normal testicular tissue. Transcript 2 was also found to have utility in the detection of prostate, breast, colorectal and ovarian cancer. Transcript 3 was also found to have utility in the detection of prostate, breast, melanoma, colorectal, and ovarian cancers. Transcript 4 was also found to have utility in the detection of prostate and colorectal cancers. Transcript 11 was also found to have utility in the detection of colorectal, melanoma, and ovarian cancers. Transcript 12 was also found to have utility in the detection of colorectal and ovarian cancers. Transcript 15 was also found to have utility in the detection of melanoma and ovarian cancers. Transcript 16 was also found to have utility in the detection of melanoma skin cancer. Transcript 20 was also found to have utility in the detection of colorectal cancer, melanoma, and ovarian cancer. Any of the 9 transcripts listed may be used individually or in combination as a tool for the detection or characterization of testicular cancer in a clinical setting.


In one aspect, the invention provides a kit for conducting an assay for determining the presence of cancer in a tissue sample. The kit includes the required reagents for conducting the assay as described above. In particular, the kit includes one or more containers containing one or more hybridization probes corresponding to transcripts 1 to 17, and 20 described above. As will be understood, the reagents for conducting the assay may include any necessary buffers, salts, detection reagents etc. Further, the kit may include any necessary sample collection devices, containers etc. for obtaining the needed tissue samples, reagents or materials to prepare the tissue samples for example by homogenization or nucleic acid extraction, and for conducting the subject assay or assays. The kit may also include control tissues or samples to establish or validate acceptable values for diseased or non-diseased tissues.


Although the invention has been described with reference to certain specific embodiments, various modifications thereof will be apparent to those skilled in the art without departing from the spirit and scope of the invention as outlined in the claims appended hereto. All documents (articles, manuals, patent applications etc) referred to in the present application are incorporated herein in their entirety by reference.


BIBLIOGRAPHY

The following references, amongst others, were cited in the foregoing description. The entire contents of these references are incorporated herein by way of reference thereto.
















Author
Journal
Title
Volume
Date







Anderson et al
Nature
Sequence and Organization of the Human
290(5806): 457-65
1981




Mitochondrial Genome


Andrews et al
Nat Genet
Reanalysis and revision of the Cambridge
23(2): 147
1999




reference sequence for human




mitochondrial DNA.


Modica-
Expert Rev
Mitochondria as targets for detection and
4: 1-19
2002


Napolitano et al
Mol Med
treatment of cancer


Sherratt et al
Clin Sci (Lond)
Mitochondrial DNA defects: a widening
92(3): 225-35
1997




clinical spectrum of disorders.


Croteau et al
Mutat Res
Mitochondrial DNA repair pathways.
434(3): 137-48
1999


Green and
J Clin Invest
Pharmacological manipulation of cell death:
115(10): 2610-2617
2005


Kroemer

clinical applications in sight?


Dai et al
Acta
Correlation of cochlear blood supply with
24(2): 130-6
2004



Otolaryngol
mitochondrial DNA common deletion in




presbyacusis.


Ro et al
Muscle Nerve
Deleted 4977-bp mitochondrial DNA
28(6): 737-43
2003




mutation is associated with sporadic




amyotrophic lateral sclerosis: a hospital-




based case-control study.


Barron et al
Invest
Mitochondrial abnormalities in ageing
42(12): 3016-22
2001



Ophthalmol
macular photoreceptors.



Vis Sci


Lewis et al
J Pathol
Detection of damage to the mitochondrial
191(3): 274-81
2000




genome in the oncocytic cells of Warthin's




tumour.


Muller-Hocker
Mod Pathol
The common 4977 base pair deletion of
11(3): 295-301.
1998


et al

mitochondrial DNA preferentially




accumulates in the cardiac conduction




system of patients with Kearns-Sayre




syndrome.


Porteous et al
Eur J Biochem
Bioenergetic consequences of accumulating
257(1): 192-201
1998




the common 4977-bp mitochondrial DNA




deletion.


Parr et al
J Mol Diagn
Somatic mitochondrial DNA mutations in
8(3): 312-9.
2006




prostate cancer and normal appearing




adjacent glands in comparison to age-




matched prostate samples without




malignant histology.


Maki et al
Am J Clin
Mitochondrial genome deletion aids in the
129(1): 57-66
2008



Pathol
identification of false- and true-negative




prostate needle core biopsy specimens.


Nakase et al
Am J Hum
Transcription and translation of deleted
46(3): 418-27.
1990



Genet
mitochondrial genomes in Kearns-Sayre




syndrome: implications for pathogenesis.


Libura et al
Blood
Therapy-related acute myeloid leukemia-
105(5): 2124-31
2005




like MLL rearrangements are induced by




etoposide in primary human CD34+ cells




and remain stable after clonal expansion.


Meyer et al
Proc Natl
Diagnostic tool for the identification of MLL
102(2): 449-54
2005



Acad Sci USA
rearrangements including unknown partner




genes.


Eguchi et al
Genes
MLL chimeric protein activation renders
45(8): 754-60
2006



Chromosomes
cells vulnerable to chromosomal damage:



Cancer
an explanation for the very short latency of




infant leukemia.


Hayashi et al
Proc Natl
Introduction of disease-related
88: 10614-10618
1991



Acad Sci USA
mitochondrial DNA deletions into HeLa cells




lacking mitochondrial DNA results in




mitochondrial dysfunction
















TABLE 1







Known mitochondrial deletions having an ORF











Deletion
Deletion

Number of



Junction (nt:nt)
Size (bp)
Repeat Location (nt/nt)
Repeats
References














COXI-ND5






6075:13799
−7723
6076-6084/13799-13807
D, 9/9
Mita, S., Rizzuto, R., Moraes, C. T., Shanske, S., Arnaudo, E., Fabrizi, G. M.,






Koga, Y., DiMauro, S., Schon, E. A. (1990) “Recombination via






flanking direct repeats is a major cause of large-scale deletions of






human mitochondrial DNA” Nucleic Acids Research 18(3): 561-567


6238:14103
−7864
6235-6238/14099-14102
D, 4/4
Blok, R. B., Thorburn, D. R., Thompson, G. N., Dahl, H. H. (1995) “A






topoisomerase II cleavage site is associated with a novel mitochondrial






DNA deletion” Human Genetics 95 (1): 75-81


6325:13989
−7663
6326-6341/13889-14004
D, 16/17
Larsson, N. G., Holme, E., Kristiansson, B., Oldfors, A., Tulinius, M.






(1990) “Progressive increase of the mutated mitochondrial DNA






fraction in Kearns-Sayre syndrome” Pediatric Research 28 (2): 131-136






Larsson, N. G., Holme, E. (1992) “Multiple short direct repeats






associated with single mtDNA deletions” Biochimica et Biophysica






Acta 1139 (4): 311-314


6330:13994
−7663
6331-6341/13994-14004
D, 11/11
Mita, S., Rizzuto, R., Moraes, C. T., Shanske, S., Arnaudo, E., Fabrizi, G. M.,






Koga, Y., DiMauro, S., Schon, E. A. (1990) “Recombination via






flanking direct repeats is a major cause of large-scale deletions of






human mitochondrial DNA” Nucleic Acids Research 18(3): 561-567


COX II-ND5


7829:14135
−6305
7824-7829/14129-14134
D, 6/6
Bet, L., Moggio, M., Comi, G. P., Mariani, C., Prelle, A., Checcarelli, N.,






Bordoni, A., Bresolin, N., Scarpini, E., Scarlato, G. (1994) “Multiple






sclerosis and mitochondrial myopathy: an unusual combination of






diseases” Journal of Neurology 241 (8): 511-516


8213:13991
−5777
8214-8220/13991-13997
D, 7/7
Hinokio, Y., Suzuki, S., Komatu, K., Ohtomo, M., Onoda, M.,






Matsumoto, M., Hirai, S., Sato, Y., Akai, H., Abe, K., Toyota, T. (1995)






“A new mitochondrial DNA deletion associated with diabetic






amyotrophy, diabetic myoatrophy and diabetic fatty liver” Muscle and






Nerve 3 (9): S142-149


ATPase-ND5


8631:13513
−4881
8625-8631/13506-13512
D, 7/7
Zhang, C., Baumer, A., Mackay, I. R., Linnane, A. W., Nagley, P. (1995)






“Unusual pattern of mitochondrial DNA deletions in skeletal muscle of






an adult human with chronic fatigue syndrome” Human Molecular






Genetics 4 (4): 751-754


9144:13816
−4671
9137-9144/13808-13815
D, 8/8
Ota, Y., Tanaka, M., Sato, W., Ohno, K., Yamamoto, T., Maehara, M.,






Negoro, T., Watanabe, K., Awaya, S., Ozawa, T. (1991) “Detection of






platelet mitochondrial DNA deletions in Kearns-Sayre syndrome”






Investigative Ophthalmology and Visual Science 32 (10): 2667-2675


9191:12909
−3717
9189-9191/12906-12908
D, 3/3
Tanaka, M., Sato, W., Ohno, K., Yamamoto, T., Ozawa, T. (1989)






“Direct sequencing of mitochondrial DNA in myopathic patients”






Biochemical and Biophysical Research Communications 164 ( ): 156-163


COX III-ND5


10190:13753 
−3562
10191-10198/13753-13760 
D, 8/8
Rotig, A., Bourgeron, T., Chretien, D., Rustin, P., Munnich, A. (1995)






“Spectrum of mitochondrial DNA rearrangements in the Pearson






marrow-pancreas syndrome” Human Molecular Genetics 4 (8): 1327-1330






Rotig, A., Cormier, V., Koll, F., Mize, C. E., Saudubray, J.-M.,






Veerman, A., Pearson, H. A., Munnich, A. (1991) “Site-specific






deletions of the mitochondrial genome in Pearson marrow-pancreas






syndrome” Genomics 10 (2): 502-504


10367:12829 
−2461
10365-10367/12826-12828 
D, 3/3
Kapsa, R., Thompson, G. N., Thorburn, D. R., Dahl, H. H., Marzuki, S.,






Byrne, E., Blok, R. B. (1994) “A novel mtDNA deletion in an infant with






Pearson syndrome” Journal of Inherited Metabolic Disease 17 (5): 521-526


ND4L-ND5


10744:14124 
−3379
10745-10754/14124-14133 
D, 9/10
Cormier-Daire, V., Bonnefont, J. P., Rustin, P., Maurage, C., Ogler, H.,






Schmitz, J., Ricour, C. Saudubray, J. M., Munnich, A., Rotig, A. (1994)






“Mitochondrial DNA rearrangements with onset as chronic diarrhea






with villous atrophy” Journal of Pediatrics 124 (1): 63-70


ND4-ND5


11232:13980 
−2747
11234-11242/13981-13989 
D, 9/9
Rotig, A., Cormier, V., Koll, F., Mize, C. E., Saudubray, J.-M., Veerman, A.,






Pearson, H. A., Munnich, A. (1991) “Site-specific deletions of the






mitochondrial genome in Pearson marrow-pancreas syndrome”






Genomics 10 (2): 502-504 Rotig, A., Cormier, V., Blanche, S.,






Bonnefont, J. P., Ledeist, F., Romero, N., Schmitz, J., Rustin, P.,






Fischer, A., Saudubray, J. M. (1990) “Pearson's marrow-pancreas






syndrome. A multi-system mitochondrial disorder in infancy” Journal of






Clinical Investigation 86 ( ): 1601-1608 Cormier, V., Rotig, A., Quartino,






A. R., Forni, G. L., Cerone, R., Maier, M., Saudubray, J. M., Munnich, A.






(1990) “Widespread multitissue deletions of the mitochondrial genome






in Pearson marrow-pancreas syndrome” Journal of Pediatrics 117 (4):






599-602 Awata, T., Matsumoto, T., Iwamoto, Y., Matsuda, A.,






Kuzuya, T., Saito, T. (1993) “Japanese case of diabetes mellitus and






deafness with mutations in mitochondrial tRNALeu(UUR) gene [letter]”






Lancet 341 (8855): 1291-1292



















TABLE 3







Deletion/Transcript/DNA Complement












DNA sequence with





deletion




complementary to


Deletion
RNA transcript
RNA transcript
Transcript No.





ATP synthase F0 subunit 8 to
SEQ ID NO: 18
SEQ ID NO: 2
1


NADH dehydrogenase subunit


mitochondrial positions 8366-14148


(with reference to SEQ ID


NO: 1).


NADH dehydrogenase subunit
SEQ ID NO: 19
SEQ ID NO: 3
2


4L (ND4L) to NADH


dehydrogenase subunit 5 (ND5);


Mitochondrial positions 10470-14148


(with reference to SEQ ID


NO: 1)


Cytochrome c oxidase subunit II
SEQ ID NO: 20
SEQ ID NO: 4
3


(COII) to Cytochrome b (Cytb);


Mitochondrial positions 7586-15887


(with reference to SEQ ID


NO: 1)


Cytochrome c oxidase subunit II
SEQ ID NO: 21
SEQ ID NO: 5
4


(COII) to Cytochrome b (Cytb);


Mitochondrial positions 7586-15887


(with reference to SEQ ID


NO: 1)
















TABLE 4







Breast and Prostate Cancer Detection























Normal




Normal

Normal



Adjacent




adjacent

Adjacent to



to



Breast
Breast
Breast
Breast
Prostate
Prostate
Prostate
Prostate



Tumour 1
Tumour 1
Tumour 2
Tumour 2
Tumour 3
Tumour 4
Tumour 5
Tumour 5



1
2
3
4
5
6
7
8




















1:100
E
68920
2971
49108
1245
46723
56679
99836
35504


dilution


1:100
F
92409
3017
60637
1512
53940
56155
100582
44221


dilution


replicate



G
420
3
31
6
26
25
44
23



H
518
3
4
5
5
3
4
2



% CV
20.6
1.1
14.9
13.7
10.1
0.7
0.5
15.5





unit results in table are RLU (relative luminescence units)


background G1, H1


empty well G2-G8, H2-H8













TABLE 5a





Assay Conditions


















Template for the assay















RNA
Homogen 1
Homogen 2
RNA
Homogen 1
Homogen 2



Transcript 1
Transcript 1
Transcript 1
Transcript 2
Transcript 2
Transcript 2



1
2
3
4
5
6





A
RNA
Homog 1
Homog 2
RNA
Homog 1
Homog 2


B
Dil 1
Dil 1
Dil 1
Dil 1
Dil 1
Dil 1


C
RNA
Homog 1
Homog 2
RNA
Homog 1
Homog 2


D
Dil 2
Dil 2
Dil 2
Dil 2
Dil 2
Dil 2


E
RNA
Homog 1
Homog 2
RNA
Homog 1
Homog 2


F
Dil 3
Dil 3
Dil 3
Dil 3
Dil 3
Dil 3


G
RNA
Homog 1
Transcript 1
RNA
Homog 1
Transcript 1


H
Dil 4
Dil 4
Background
Dil 4
Dil 4
Background






RNA
Homogen 1
Homogen 2
RNA
Homogen 1
Homogen 2



Transcript 3
Transcript 3
Transcript 3
Transcript 4
Transcript 4
Transcript 4



7
8
9
10
11
12





A
RNA
Homog 1
Homog 2
RNA
Homog 1
Homog 2


B
Dil 1
Dil 1
Dil 1
Dil 1
Dil 1
Dil 1


C
RNA
Homog 1
Homog 2
RNA
Homog 1
Homog 2


D
Dil 2
Dil 2
Dil 2
Dil 2
Dil 2
Dil 2


E
RNA
Homog 1
Homog 2
RNA
Homog 1
Homog 2


F
Dil 3
Dil 3
Dil 3
Dil 3
Dil 3
Dil 3


G
RNA
Homog 1
Transcript 1
RNA
Homog 1
Transcript 1


H
Dil 4
Dil 4
Background
Dil 4
Dil 4
Background





Homogenate1 - Used 26 mg of tissue to homogenize in 700 ul H soln with Proteinase K (PK). Used Qiagen TissueRuptor. Used 40 ul homogenate supernatant, 20, 10 and 5 ul for dilution Homogenate1 = Tumour tissue from the tumorous Prostate


Homogenate2 - Used 29 mg of tissue to homogenize in 700 ul H soln with PK. Used Qiagen TissueRuptor. Used 40 ul homogenate supernatant, 20, 10 and 5 ul for dilution Homogenate2 = Normal tissue from the tumorous Prostate


RNA dilution was made as below. RNA was from Prostate Normal from Ambion.


Assay was done in duplicates.













TABLE 5b







RNA dilution










RNA Dilution
ng/ul














Dil 1
3000


1:3 dil
Dil 2
1000


Serial dil
Dil 3
333



Dil 4
111
















TABLE 6







Transcript Summary by Disease

















Colo-
Melanoma
Lung

Tes-



Prostate
Breast
rectal
Skin
Can-
Ovarian
ticular


Probe
Cancer
Cancer
Cancer
Cancer
cer
Cancer
Cancer

















1









2









3









4









5


6








7


8







9





10







11









12









13









14






15









16









17


20















Claims
  • 1. A method of detecting a cancer in a mammal, the method comprising assaying a tissue sample from the mammal for the presence of at least one mitochondrial fusion transcript associated with cancer by hybridizing the sample with at least one hybridization probe having a nucleic acid sequence complementary to at least a portion of a mitochondrial fusion transcript having a nucleic acid sequence as set forth in any one of SEQ ID NOs:18 to 33 or 50.
  • 2. The method of claim 1, wherein the cancer is prostate cancer, testicular cancer, ovarian cancer, breast cancer, colorectal cancer, lung cancer, melanoma skin cancer or combinations thereof.
  • 3. The method of claim 1, wherein the assay comprises: a) conducting a hybridization reaction using at least one of said probes to allow said at least one probe to hybridize to a complementary mitochondrial fusion transcript or mtDNA;b) quantifying the amount of the at least one mitochondrial fusion transcript or mtDNA in said sample by quantifying the amount of said transcript or mtDNA hybridized to said at least one probe; and,c) comparing the amount of the mitochondrial fusion transcript or mtDNA in the sample to at least one known reference value.
  • 4. The method of claim 1, wherein the assay is carried out using diagnostic imaging technology, branched DNA technology, or PCR.
  • 5. A hybridization probe having a nucleic acid sequence complementary to at least a portion of the mitochondrial fusion transcript having a nucleic acid sequence as set forth in any one of SEQ ID NOs:18 to 33 or 50.
  • 6. A method of detecting a cancer in a mammal, the method comprising assaying a tissue sample from the mammal for the presence of at least one aberrant mtDNA, the method comprising hybridizing the sample with at least one hybridization probe having a nucleic acid sequence complementary to at least a portion of the aberrant mtDNA, wherein: the aberrant mtDNA encodes a fusion transcript associated with cancer;the aberration is a deletion in the mtDNA sequence; andthe portion of the aberrant mtDNA to which the hybridization probe is complementary comprises a junction point in the rejoined mtDNA sequence.
  • 7. The method of claim 6, wherein the cancer is prostate cancer, testicular cancer, ovarian cancer, breast cancer, colorectal cancer, lung cancer, melanoma skin cancer or combinations thereof.
  • 8. The method of claim 6, further comprising comparing the amount of the mtDNA hybridized to the hybridization probe with a known reference value.
  • 9. The method of claim 6 wherein the aberrant mtDNA has a nucleic acid sequence as set forth in any one of SEQ ID NOs: 2-17 or 51.
  • 10. The method of claim 9, wherein the cancer is prostate cancer, testicular cancer, ovarian cancer, breast cancer, colorectal cancer, lung cancer, melanoma skin cancer or combinations thereof.
  • 11. The method of claim 9, further comprising comparing the amount of the mtDNA hybridized to the hybridization probe with a known reference value.
CROSS REFERENCE TO RELATED APPLICATIONS

This application is a Continuation of U.S. patent application Ser. No. 12/935,181, filed Sep. 28, 2010, which is a national entry of PCT Patent Application Number PCT/CA2009/000351, filed Mar. 27, 2009, which claims the benefit of priority under 35 U.S.C. §119(e) of U.S. Provisional Patent Application No. 61/040,616, filed Mar. 28, 2008. Each of the aforementioned applications is incorporated by reference herein as if set forth in its entirety.

Provisional Applications (1)
Number Date Country
61040616 Mar 2008 US
Continuations (1)
Number Date Country
Parent 12935181 Jan 2011 US
Child 14627755 US