Patent Grant
11643675
The instant application contains a Sequence Listing which has been submitted via EFS-Web. The content of the text file named “37847-517001US_ST25.txt”, which was created on Oct. 20, 2017 and is 791 KB in size, is hereby incorporated by reference in its entirety.
The invention provides compositions and methods for producing purified oligosaccharides, in particular certain fucosylated oligosaccharides that are typically found in human milk.
Human milk contains a diverse and abundant set of neutral and acidic oligosaccharides. More than 130 different complex oligosaccharides have been identified in human milk, and their structural diversity and abundance is unique to humans. Although these molecules may not be utilized directly by infants for nutrition, they nevertheless serve critical roles in the establishment of a healthy gut microbiome, in the prevention of disease, and in immune function. Prior to the invention described herein, the ability to produce human milk oligosaccharides (HMOS) inexpensively was problematic. For example, their production through chemical synthesis was limited by stereo-specificity issues, precursor availability, product impurities, and high overall cost. As such, there is a pressing need for new strategies to inexpensively manufacture large quantities of HMOS.
The invention features an efficient and economical method for producing fucosylated oligosaccharides. Such production of a fucosylated oligosaccharide is accomplished using an isolated nucleic acid comprising a sequence encoding a lactose-utilizing α (1,2) fucosyltransferase gene product (e.g., polypeptide or protein), which is operably linked to one or more heterologous control sequences that direct the production of the recombinant fucosyltransferase gene product in a host production bacterium such as Escherichia coli (E. coli).
The present disclosure provides novel α (1,2) fucosyltransferases (also referred to herein as α(1,2) FTs) that utilize lactose and catalyzes the transfer of an L-fucose sugar from a GDP-fucose donor substrate to an acceptor substrate in an alpha-1,2-linkage. In a preferred embodiment, the acceptor substrate is an oligosaccharide. The α(1,2) fucosyltransferases identified and described herein are useful for expressing in host bacterium for the production of human milk oligosaccharides (HMOS), such as fucosylated oligosaccharides. Exemplary fucosylated oligosaccharides produced by the methods described herein include 2′-fucosyllactose (2′FL), lactodifucotetraose (LDFT), lacto-N-fucopentaose I (LNF I), or lacto-N-difucohexaose I (LDFH I). The “α(1,2) fucosyltransferases” disclosed herein encompasses the amino acid sequences of the α(1,2) fucosyltransferases and the nucleic acid sequences that encode the α(1,2) fucosyltransferases, as well as variants and fragments thereof that exhibit α(1,2) fucosyltransferase activity. Also within the invention is a nucleic acid construct comprising an isolated nucleic acid encoding a lactose-accepting α (1,2) fucosyltransferase enzyme, said nucleic acid being optionally operably linked to one or more heterologous control sequences that direct the production of the enzyme in a host bacteria production strain.
The amino acid sequence of the lactose-accepting α(1,2) fucosyltransferases described herein is at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identity to Helicobacter pylori 26695 alpha-(1,2) fucosyltransferase (futC or SEQ ID NO: 1). Preferably, the lactose-accepting α(1,2) fucosyltransferases described herein is at least 22% identical to H. pylori FutC, or SEQ ID NO: 1.
In another aspect, the amino acid sequence of the lactose-accepting α(1,2) fucosyltransferases described herein is at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identity to Bacteroides vulgatus alpha-(1,2) fucosyltransferase (FutN or SEQ ID NO: 3). Preferably, the lactose-accepting α(1,2) fucosyltransferases described herein is at least 25% identical to B. vlugatos FutN, or SEQ ID NO: 3.
Alternatively, the exogenous α (1,2) fucosyltransferase preferably comprises at least at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identity to any one of the novel α (1,2) fucosyltransferases disclosed herein, for example, to the amino acid sequences in Table 1.
Exemplary α(1,2) fucosyltransferases include, but are not limited to, Prevotella melaninogenica FutO, Clostridium bolteae FutP, Clostridium bolteae+13 FutP, Lachnospiraceae sp. FutQ, Methanosphaerula palustris FutR, Tannerella sp. FutS, Bacteroides caccae FutU, Butyrivibrio FutV, Prevotella sp. FutW, Parabacteroides johnsonii FutX, Akkermansia muciniphilia FutY, Salmonella enterica FutZ, Bacteroides sp. FutZA. For example, the α(1,2) fucosyltransferases comprise the amino acid sequences comprising any one of the following: Prevotella melaninogenica FutO (SEQ ID NO: 10), Clostridium bolteae FutP (SEQ ID NO: 11), Clostridium bolteae+13 FutP (SEQ ID NO: 292), Lachnospiraceae sp. FutQ (SEQ ID NO: 12), Methanosphaerula palustris FutR (SEQ ID NO: 13), Tannerella sp. FutS (SEQ ID NO: 14), Bacteroides caccae FutU (SEQ ID NO: 15), Butyrivibrio FutV (SEQ ID NO: 16), Prevotella sp. FutW (SEQ ID NO: 17), Parabacteroides johnsonii FutX (SEQ ID NO: 18), Akkermansia muciniphilia FutY (SEQ ID NO: 19), Salmonella enterica FutZ (SEQ ID NO: 20), and Bacteroides sp. FutZA (SEQ ID NO: 21), or a functional variant or fragment thereof. Other exemplary α(1,2) fucosyltransferases include any of the enzymes listed in Table 1, or functional variants or fragments thereof.
The present invention features a method for producing a fucosylated oligosaccharide in a bacterium by providing bacterium that express at least one exogenous lactose-utilizing α(1,2) fucosyltransferase. The amino acid sequence of the exogenous lactose-utilizing α(1,2) fucosyltransferase is preferably at least 22% identical to H. pylori FutC or at least 25% identical to B. vulgatus FutN. In one aspect, the bacterium also expresses one or more exogenous lactose-utilizing α(1,3) fucosyltransferase enzymes and/or one or more exogenous lactose-utilizing α(1,4) fucosyltransferase enzymes. The combination of fucosyltransferases expressed in the production bacterium is dependent upon the desired fucosylated oligosaccharide product. The method disclosed herein further includes retrieving the fucosylated oligosaccharide from said bacterium or from a culture supernatant of said bacterium.
Examples of suitable α(1,3) fucosyltransferase enzymes include, but are not limited to Helicobacter pylori 26695 futA gene (GenBank Accession Number HV532291 (GI:365791177), incorporated herein by reference), H. hepaticus Hh0072, H. pylori 11639 FucT, and H. pylori UA948 FucTa (e.g., GenBank Accession Number AF194963 (GI:28436396), incorporated herein by reference) (Rasko, D. A., Wang, G., Palcic, M. M. & Taylor, D. E. J Biol Chem 275, 4988-4994 (2000)). Examples of suitable α(1,4) fucosyltransferase enzymes include, but are not limited to H. pylori UA948 FucTa (which has has relaxed acceptor specificity and is able to generate both α(1,3)- and α(1,4)-fucosyl linkages). An example of an enzyme possessing only α(1,4) fucosyltransferase activity is given by the FucT III enzyme from Helicobacter pylori strain DMS6709 (e.g., GenBank Accession Number AY450598.1 (GI:40646733), incorporated herein by reference) (S. Rabbani, V. Miksa, B. Wipf, B. Ernst, Glycobiology 15, 1076-83 (2005).)
The invention also features a nucleic acid construct or a vector comprising a nucleic acid enconding at least one α (1,2) fucosyltransferase or variant, or fragment thereof, as described herein. The vector can further include one or more regulatory elements, e.g., a heterologous promoter. By “heterologous” is meant that the control sequence and protein-encoding sequence originate from different bacterial strains. The regulatory elements can be operably linked to a gene encoding a protein, a gene construct encoding a fusion protein gene, or a series of genes linked in an operon in order to express the fusion protein. In yet another aspect, the invention comprises an isolated recombinant cell, e.g., a bacterial cell containing an aforementioned nucleic acid molecule or vector. The nucleic acid is optionally integrated into the genome of the host bacterium. In some embodiments, the nucleic acid construct also further comprises one or more α(1,3) fucosyltransferases and/or α(1,4) fucosyltransferases. Alternatively, the α (1,2) fucosyltransferase also exhibits α(1,3) fucosyltransferase and/or α(1,4) fucosyltransferase activity.
The bacterium utilized in the production methods described herein is genetically engineered to increase the efficiency and yield of fucosylated oligosaccharide products. For example, the host production bacterium is characterized as having a reduced level of β-galactosidase activity, a defective colanic acid synthesis pathway, an inactivated ATP-dependent intracellular protease, an inactivated lacA, or a combination thereof. In one embodiment, the bacterium is characterized as having a reduced level of β-galactosidase activity, a defective colanic acid synthesis pathway, an inactivated ATP-dependent intracellular protease, and an inactivated lacA.
As used herein, an “inactivated” or “inactivation of a” gene, encoded gene product (i.e., polypeptide), or pathway refers to reducing or eliminating the expression (i.e., transcription or translation), protein level (i.e., translation, rate of degradation), or enzymatic activity of the gene, gene product, or pathway. In the instance where a pathway is inactivated, preferably one enzyme or polypeptide in the pathway exhibits reduced or negligible activity. For example, the enzyme in the pathway is altered, deleted or mutated such that the product of the pathway is produced at low levels compared to a wild-type bacterium or an intact pathway. Alternatively, the product of the pathway is not produced. Inactivation of a gene is achieved by deletion or mutation of the gene or regulatory elements of the gene such that the gene is no longer transcribed or translated. Inactivation of a polypeptide can be achieved by deletion or mutation of the gene that encodes the gene product or mutation of the polypeptide to disrupt its activity. Inactivating mutations include additions, deletions or substitutions of one or more nucleotides or amino acids of a nucleic acid or amino acid sequence that results in the reduction or elimination of the expression or activity of the gene or polypeptide. In other embodiments, inactivation of a polypeptide is achieved through the addition of exogenous sequences (i.e., tags) to the N or C-terminus of the polypeptide such that the activity of the polypeptide is reduced or eliminated (i.e., by steric hindrance).
A host bacterium suitable for the production systems described herein exhibits an enhanced or increased cytoplasmic or intracellular pool of lactose and/or GDP-fucose. For example, the bacterium is E. coli and endogenous E. coli metabolic pathways and genes are manipulated in ways that result in the generation of increased cytoplasmic concentrations of lactose and/or GDP-fucose, as compared to levels found in wild type E. coli. Preferably, the bacterium accumulates an increased intracellular lactose pool and an increased intracellular GDP-fucose pool. For example, the bacteria contain at least 10%, 20%, 50%, or 2×, 5×, 10× or more of the levels of intracellular lactose and/or intracellular GDP-fucose compared to a corresponding wild type bacteria that lacks the genetic modifications described herein.
Increased intracellular concentration of lactose in the host bacterium compared to wild-type bacterium is achieved by manipulation of genes and pathways involved in lactose import, export and catabolism. In particular, described herein are methods of increasing intracellular lactose levels in E. coli genetically engineered to produce a human milk oligosaccharide by simultaneous deletion of the endogenous β-galactosidase gene (lacZ) and the lactose operon repressor gene (lad). During construction of this deletion, the lacIq promoter is placed immediately upstream of (contiguous with) the lactose permease gene, lacY, i.e., the sequence of the lacIq promoter is directly upstream and adjacent to the start of the sequence encoding the lacY gene, such that the lacY gene is under transcriptional regulation by the lacIq promoter. The modified strain maintains its ability to transport lactose from the culture medium (via LacY), but is deleted for the wild-type chromosomal copy of the lacZ (encoding β-galactosidase) gene responsible for lactose catabolism. Thus, an intracellular lactose pool is created when the modified strain is cultured in the presence of exogenous lactose.
Another method for increasing the intracellular concentration of lactose in E. coli involves inactivation of the lacA gene. A inactivating mutation, null mutation, or deletion of lacA prevents the formation of intracellular acetyl-lactose, which not only removes this molecule as a contaminant from subsequent purifications, but also eliminates E. coli's ability to export excess lactose from its cytoplasm (Danchin A. Cells need safety valves. Bioessays 2009, July; 31(7):769-73.), thus greatly facilitating purposeful manipulations of the E. coli intracellular lactose pool.
The invention also provides methods for increasing intracellular levels of GDP-fucose in a bacterium by manipulating the organism's endogenous colanic acid biosynthesis pathway. This increase is achieved through a number of genetic modifications of endogenous E. coli genes involved either directly in colanic acid precursor biosynthesis, or in overall control of the colanic acid synthetic regulon. Particularly preferred is inactivation of the genes or encoded polypeptides that act in the colanic acid synthesis pathway after the production of GDP-fucose (the donor substrate) and before the generation of colanic acid. Exemplary colanic acid synthesis genes include, but are not limited to: a wcaJ gene, (e.g., GenBank Accession Number (amino acid) BAA15900 (GI:1736749), incorporated herein by reference), a wcaA gene (e.g., GenBank Accession Number (amino acid) BAA15912.1 (GI:1736762), incorporated herein by reference), a wcaC gene (e.g., GenBank Accession Number (amino acid) BAE76574.1 (GI:85675203), incorporated herein by reference), a wcaE gene (e.g., GenBank Accession Number (amino acid) BAE76572.1 (GI:85675201), incorporated herein by reference), a weal gene (e.g., GenBank Accession Number (amino acid) BAA15906.1 (GI:1736756), incorporated herein by reference), a wcaL gene (e.g., GenBank Accession Number (amino acid) BAA15898.1 (GI:1736747), incorporated herein by reference), a wcaB gene (e.g., GenBank Accession Number (amino acid) BAA15911.1 (GI:1736761), incorporated herein by reference), a wcaF gene (e.g., GenBank Accession Number (amino acid) BAA15910.1 (GI:1736760), incorporated herein by reference), a wzxE gene (e.g., GenBank Accession Number (amino acid) BAE77506.1 (GI:85676256), incorporated herein by reference), a wzxC gene, (e.g., GenBank Accession Number (amino acid) BAA15899 (GI:1736748), incorporated herein by reference), a wcaD gene, (e.g., GenBank Accession Number (amino acid) BAE76573 (GI:85675202), incorporated herein by reference), a wza gene (e.g., GenBank Accession Number (amino acid) BAE76576 (GI:85675205), incorporated herein by reference), a wzb gene (e.g., GenBank Accession Number (amino acid) BAE76575 (GI:85675204), incorporated herein by reference), and a wzc gene (e.g., GenBank Accession Number (amino acid) BAA15913 (GI:1736763), incorporated herein by reference).
Preferably, a host bacterium, such as E. coli, is genetically engineered to produce a human milk oligosaccharide by the inactivation of the wcaJ gene, which encoding the UDP-glucose lipid carrier transferase. The inactivation of the wcaJ gene can be by deletion of the gene, a null mutation, or inactivating mutation of the wcaJ gene, such that the activity of the encoded wcaJ is reduced or eliminated compared to wild-type E. coli. In a wcaJ null background, GDP-fucose accumulates in the E. coli cytoplasm.
Over-expression of a positive regulator protein, RcsA (e.g., GenBank Accession Number M58003 (GI:1103316), incorporated herein by reference), in the colanic acid synthesis pathway results in an increase in intracellular GDP-fucose levels. Over-expression of an additional positive regulator of colanic acid biosynthesis, namely RcsB (e.g., GenBank Accession Number E04821 (GI:2173017), incorporated herein by reference), is also utilized, either instead of or in addition to over-expression of RcsA, to increase intracellular GDP-fucose levels.
Alternatively, colanic acid biosynthesis is increased following the introduction of a mutation into the E. coli lon gene (e.g., GenBank Accession Number L20572 (GI:304907), incorporated herein by reference). Lon is an adenosine-5′-triphosphate (ATP)-dependant intracellular protease that is responsible for degrading RcsA, mentioned above as a positive transcriptional regulator of colanic acid biosynthesis in E. coli. In a lon null background, RcsA is stabilized, RcsA levels increase, the genes responsible for GDP-fucose synthesis in E. coli are up-regulated, and intracellular GDP-fucose concentrations are enhanced. Mutations in lon suitable for use with the methods presented herein include null mutations or insertions that disrupt the expression or function of ion.
A functional lactose permease gene is also present in the bacterium. The lactose permease gene is an endogenous lactose permease gene or an exogenous lactose permease gene. For example, the lactose permease gene comprises an E. coli lacY gene (e.g., GenBank Accession Number V00295 (GI:41897), incorporated herein by reference). Many bacteria possess the inherent ability to transport lactose from the growth medium into the cell, by utilizing a transport protein that is either a homolog of the E. coli lactose permease (e.g., as found in Bacillus licheniformis), or a transporter that is a member of the ubiquitous PTS sugar transport family (e.g., as found in Lactobacillus casei and Lactobacillus rhamnosus). For bacteria lacking an inherent ability to transport extracellular lactose into the cell cytoplasm, this ability is conferred by an exogenous lactose transporter gene (e.g., E. coli lacY) provided on recombinant DNA constructs, and supplied either on a plasmid expression vector or as exogenous genes integrated into the host chromosome.
As described herein, in some embodiments, the host bacterium preferably has a reduced level of β-galactosidase activity. In the embodiment in which the bacterium is characterized by the deletion of the endogenous β-galactosidase gene, an exogenous β-galactosidase gene is introduced to the bacterium. For example, a plasmid expressing an exogenous β-galactosidase gene is introduced to the bacterium, or recombined or integrated into the host genome. For example, the exogenous β-galactosidase gene is inserted into a gene that is inactivated in the host bacterium, such as the lon gene.
The exogenous b-galactosidase gene is a functional b-galactosidase gene characterized by a reduced or low level of b-galactosidase activity compared to β-galactosidase activity in wild-type bacteria lacking any genetic manipulation. Exemplary β-galactosidase genes include E. coli lacZ and β-galactosidase genes from any of a number of other organisms (e.g., the lac4 gene of Kluyveromyces lactis (e.g., GenBank Accession Number M84410 (GI:173304), incorporated herein by reference) that catalyzes the hydrolysis of b-galactosides into monosaccharides. The level of β-galactosidase activity in wild-type E. coli bacteria is, for example, 6,000 units. Thus, the reduced β-galactosidase activity level encompassed by engineered host bacterium of the present invention includes less than 6,000 units, less than 5,000 units, less than 4,000 units, less than 3,000 units, less than 2,000 units, less than 1,000 units, less than 900 units, less than 800 units, less than 700 units, less than 600 units, less than 500 units, less than 400 units, less than 300 units, less than 200 units, less than 100 units, or less than 50 units. Low, functional levels of β-galactosidase include β-galactosidase activity levels of between 0.05 and 1,000 units, e.g., between 0.05 and 750 units, between 0.05 and 500 units, between 0.05 and 400 units, between 0.05 and 300 units, between 0.05 and 200 units, between 0.05 and 100 units, between 0.05 and 50 units, between 0.05 and 10 units, between 0.05 and 5 units, between 0.05 and 4 units, between 0.05 and 3 units, or between 0.05 and 2 units of β-galactosidase activity. For unit definition and assays for determining β-galactosidase activity, see Miller J H, Laboratory CSH. Experiments in molecular genetics. Cold Spring Harbor Laboratory Cold Spring Harbor, N.Y.; 1972; (incorporated herein by reference). This low level of cytoplasmic β-galactosidase activity is not high enough to significantly diminish the intracellular lactose pool. The low level of β-galactosidase activity is very useful for the facile removal of undesired residual lactose at the end of fermentations.
Optionally, the bacterium has an inactivated thyA gene. Preferably, a mutation in a thyA gene in the host bacterium allows for the maintenance of plasmids that carry thyA as a selectable marker gene. Exemplary alternative selectable markers include antibiotic resistance genes such as BLA (beta-lactamase), or proBA genes (to complement a proAB host strain proline auxotropy) or purA (to complement a purA host strain adenine auxotrophy).
In one aspect, the E. coli bacterium comprises the genotype ΔampC::PtrpBcI, Δ(lacI-lacZ)::FRT, PlacIqlacY+, ΔwcaJ::FRT, thyA::Tn10, Δlon:(npt3, lacZ+), ΔlacA, and also comprises any one of the exogenous α(1,2) fucosyltransferases described herein.
The bacterium comprising these characteristics is cultured in the presence of lactose. In some cases, the method further comprises culturing the bacterium in the presence of tryptophan and in the absence of thymidine. The fucosylated oligosaccharide is retrieved from the bacterium (i.e., a cell lysate) or from a culture supernatant of the bacterium.
The invention provides a purified fucosylated oligosaccharide produced by the methods described herein. The fucosylated oligosaccharide is purified for use in therapeutic or nutritional products, or the bacterium is used directly in such products. The fucosylated oligosaccharide produced by the engineered bacterium is 2′-fucosyllactose (2′-FL) or lactodifucotetraose (LDFT). The new alpha 1,2-fucosyltransferases are also useful to synthesize HMOS of larger molecular weight bearing alpha 1,2 fucose moieties, e.g., lacto-N-fucopentaose (LNF I) and lacto-N-difucohexaose (LDFH I). For example, to produce LDFT, the host bacterium is engineered to express an exogenous α (1,2) fucosyltransferase that also possesses α (1,3) fucosyltransferase activity, or an exogenous α (1,2) fucosyltransferase and an exogenous α (1,3) fucosyltransferase. For the production of LNF I and LDFH I, the host bacterium is engineered to express an exogenous α (1,2) fucosyltransferase that also possesses α (1,3) fucosyltransferase activity and/or α (1,4) fucosyltransferase activity, or an exogenous α (1,2) fucosyltransferase, an exogenous α (1,3) fucosyltransferas, and an exogenous α (1,4) fucosyltransferase.
A purified fucosylated oligosaccharide produced by the methods described above is also within the invention. The purified oligosaccharide (2′-FL) obtained at the end of the process is a white/slightly off-white, crystalline, sweet powder. For example, an engineered bacterium, bacterial culture supernatant, or bacterial cell lysate according to the invention comprises 2′-FL, LDFT, LNF I or LDFH I produced by the methods described herein, and does not substantially comprise a other fucosylated oligosaccharides prior to purification of the fucosylated oligosaccharide products from the cell, culture supernatant, or lysate. As a general matter, the fucosylated oligosaccharide produced by the methods contains a negligible amount of 3-FL in a 2′-FL-containing cell, cell lysate or culture, or supernatant, e.g., less than 1% of the level of 2′-FL or 0.5% of the level of 2′-FL. Moreover, the fucosylated oligosaccharide produced by the methods described herein also have a minimal amount of contaminating lactose, which can often be co-purified with the fucosylated oligosaccharide product, such as 2′FL. This reduction in contaminating lactose results from the reduced level of β-galactosidase activity present in the engineered host bacterium.
A purified oligosaccharide, e.g., 2′-FL, LDFT, LNF I, or LDFH I, is one that is at least 90%, 95%, 98%, 99%, or 100% (w/w) of the desired oligosaccharide by weight. Purity is assessed by any known method, e.g., thin layer chromatography or other chromatographic techniques known in the art. The invention includes a method of purifying a fucosylated oligosaccharide produced by the genetically engineered bacterium described above, which method comprises separating the desired fucosylated oligosaccharide (e.g., 2′-FL) from contaminants in a bacterial cell lysate or bacterial cell culture supernatant of the bacterium.
The oligosaccharides are purified and used in a number of products for consumption by humans as well as animals, such as companion animals (dogs, cats) as well as livestock (bovine, equine, ovine, caprine, or porcine animals, as well as poultry). For example, a pharmaceutical composition comprises purified 2′-FL and a pharmaceutically-acceptable excipient that is suitable for oral administration. Large quantities of 2′-FL are produced in bacterial hosts, e.g., an E. coli bacterium comprising an exogenous α (1,2) fucosyltransferase gene.
A method of producing a pharmaceutical composition comprising a purified human milk oligosaccharide (HMOS) is carried out by culturing the bacterium described above, purifying the HMOS produced by the bacterium, and combining the HMOS with an excipient or carrier to yield a dietary supplement for oral administration. These compositions are useful in methods of preventing or treating enteric and/or respiratory diseases in infants and adults. Accordingly, the compositions are administered to a subject suffering from or at risk of developing such a disease.
The invention also provides methods of identifying an α (1,2) fucosyltransferase gene capable of synthesizing fucosylated oligosaccharides in a host bacterium, i.e., 2′-fucosyllactose (2′-FL) in E. coli. The method of identifying novel lactose-utilizing, α(1,2)fucosyltransferase enzyme comprises the following steps:
1) performing a computational search of sequence databases to define a broad group of simple sequence homologs of any known, lactose-utilizing α(1,2)fucosyltransferase;
2) using the list from step (1), deriving a search profile containing common sequence and/or structural motifs shared by the members of the list;
3) searching sequence databases, using a derived search profile based on the common sequence or structural motif from step (2) as query, and identifying a candidate sequences, wherein a sequence homology to a reference lactose-utilizing α(1,2)fucosyltransferase is a predetermined percentage threshold;
4) compiling a list of candidate organisms, said organisms being characterized as expressing α(1,2)fucosyl-glycans in a naturally-occurring state;
5) selecting candidate sequences that are derived from candidate organisms to generate a list of candidate lactose-utilizing enzymes;
6) expressing the candidate lactose-utilizing enzyme in a host organism; and
7) testing for lactose-utilizing α(1,2)fucosyltransferase activity, wherein detection of the desired fucosylated oligosaccharide product in said organism indicates that the candidate sequence comprises a novel lactose-utilizing α(1,2)fucosyltransferase. In another embodiment, the search profile is generated from a multiple sequence alignment of the amino acid sequences of more than one enzyme with known α(1,2)fucosyltransferase activity. The database search can then be designed to refine and iteratively search for novel α(1,2)fucosyltransferases with significant sequence similarity to the multiple sequence alignment query.
The invention provides a method of treating, preventing, or reducing the risk of infection in a subject comprising administering to said subject a composition comprising a purified recombinant human milk oligosaccharide, wherein the HMOS binds to a pathogen and wherein the subject is infected with or at risk of infection with the pathogen. In one aspect, the infection is caused by a Norwalk-like virus or Campylobacter jejuni. The subject is preferably a mammal in need of such treatment. The mammal is, e.g., any mammal, e.g., a human, a primate, a mouse, a rat, a dog, a cat, a cow, a horse, or a pig. In a preferred embodiment, the mammal is a human. For example, the compositions are formulated into animal feed (e.g., pellets, kibble, mash) or animal food supplements for companion animals, e.g., dogs or cats, as well as livestock or animals grown for food consumption, e.g., cattle, sheep, pigs, chickens, and goats. Preferably, the purified HMOS is formulated into a powder (e.g., infant formula powder or adult nutritional supplement powder, each of which is mixed with a liquid such as water or juice prior to consumption) or in the form of tablets, capsules or pastes or is incorporated as a component in dairy products such as milk, cream, cheese, yogurt or kefir, or as a component in any beverage, or combined in a preparation containing live microbial cultures intended to serve as probiotics, or in prebiotic preparations to enhance the growth of beneficial microorganisms either in vitro or in vivo.
Polynucleotides, polypeptides, and oligosaccharides of the invention are purified and/or isolated. Purified defines a degree of sterility that is safe for administration to a human subject, e.g., lacking infectious or toxic agents. Specifically, as used herein, an “isolated” or “purified” nucleic acid molecule, polynucleotide, polypeptide, protein or oligosaccharide, is substantially free of other cellular material, or culture medium when produced by recombinant techniques, or chemical precursors or other chemicals when chemically synthesized. For example, purified HMOS compositions are at least 60% by weight (dry weight) the compound of interest. Preferably, the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight the compound of interest. Purity is measured by any appropriate standard method, for example, by column chromatography, thin layer chromatography, or high-performance liquid chromatography (HPLC) analysis. For example, a “purified protein” refers to a protein that has been separated from other proteins, lipids, and nucleic acids with which it is naturally associated. Preferably, the protein constitutes at least 10, 20, 50, 70, 80, 90, 95, 99-100% by dry weight of the purified preparation.
Similarly, by “substantially pure” is meant an oligosaccharide that has been separated from the components that naturally accompany it. Typically, the oligosaccharide is substantially pure when it is at least 60%, 70%, 80%, 90%, 95%, or even 99%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated.
By “isolated nucleic acid” is meant a nucleic acid that is free of the genes which, in the naturally-occurring genome of the organism from which the DNA of the invention is derived, flank the gene. The term covers, for example: (a) a DNA which is part of a naturally occurring genomic DNA molecule, but is not flanked by both of the nucleic acid sequences that flank that part of the molecule in the genome of the organism in which it naturally occurs; (b) a nucleic acid incorporated into a vector or into the genomic DNA of a prokaryote or eukaryote in a manner, such that the resulting molecule is not identical to any naturally occurring vector or genomic DNA; (c) a separate molecule such as a cDNA, a genomic fragment, a fragment produced by polymerase chain reaction (PCR), or a restriction fragment; and (d) a recombinant nucleotide sequence that is part of a hybrid gene, i.e., a gene encoding a fusion protein. Isolated nucleic acid molecules according to the present invention further include molecules produced synthetically, as well as any nucleic acids that have been altered chemically and/or that have modified backbones.
A “heterologous promoter” is a promoter which is different from the promoter to which a gene or nucleic acid sequence is operably linked in nature.
The term “overexpress” or “overexpression” refers to a situation in which more factor is expressed by a genetically-altered cell than would be, under the same conditions, by a wild type cell. Similarly, if an unaltered cell does not express a factor that it is genetically altered to produce, the term “express” (as distinguished from “overexpress”) is used indicating the wild type cell did not express the factor at all prior to genetic manipulation.
The terms “treating” and “treatment” as used herein refer to the administration of an agent or formulation to a clinically symptomatic individual afflicted with an adverse condition, disorder, or disease, so as to effect a reduction in severity and/or frequency of symptoms, eliminate the symptoms and/or their underlying cause, and/or facilitate improvement or remediation of damage. The terms “preventing” and “prevention” refer to the administration of an agent or composition to a clinically asymptomatic individual who is susceptible to a particular adverse condition, disorder, or disease, and thus relates to the prevention of the occurrence of symptoms and/or their underlying cause.
By the terms “effective amount” and “therapeutically effective amount” of a formulation or formulation component is meant a nontoxic but sufficient amount of the formulation or component to provide the desired effect.
The transitional term “comprising,” which is synonymous with “including,” “containing,” or “characterized by,” is inclusive or open-ended and does not exclude additional, unrecited elements or method steps. By contrast, the transitional phrase “consisting of” excludes any element, step, or ingredient not specified in the claim. The transitional phrase “consisting essentially of” limits the scope of a claim to the specified materials or steps “and those that do not materially affect the basic and novel characteristic(s)” of the claimed invention.
The host organism used to express the lactose-accepting fucosyltransferase gene is typically the enterobacterium Escherichia coli K12 (E. coli). E. coli K-12 is not considered a human or animal pathogen nor is it toxicogenic. E. coli K-12 is a standard production strain of bacteria and is noted for its safety due to its poor ability to colonize the colon and establish infections (see, e.g., epa.gov/oppt/biotech/pubs/fra/fra004.htm). However, a variety of bacterial species may be used in the oligosaccharide biosynthesis methods, e.g., Erwinia herbicola (Pantoea agglomerans), Citrobacter freundii, Pantoea citrea, Pectobacterium carotovorum, or Xanthomonas campestris. Bacteria of the genus Bacillus may also be used, including Bacillus subtilis, Bacillus licheniformis, Bacillus coagulans, Bacillus thermophilus, Bacillus laterosporus, Bacillus megaterium, Bacillus mycoides, Bacillus pumilus, Bacillus lentus, Bacillus cereus, and Bacillus circulans. Similarly, bacteria of the genera Lactobacillus and Lactococcus may be modified using the methods of this invention, including but not limited to Lactobacillus acidophilus, Lactobacillus salivarius, Lactobacillus plantarum, Lactobacillus helveticus, Lactobacillus delbrueckii, Lactobacillus rhamnosus, Lactobacillus bulgaricus, Lactobacillus crispatus, Lactobacillus gasseri, Lactobacillus casei, Lactobacillus reuteri, Lactobacillus jensenii, and Lactococcus lactis. Streptococcus thermophiles and Proprionibacterium freudenreichii are also suitable bacterial species for the invention described herein. Also included as part of this invention are strains, modified as described here, from the genera Enterococcus (e.g., Enterococcus faecium and Enterococcus thermophiles), Bifidobacterium (e.g., Bifidobacterium longum, Bifidobacterium infantis, and Bifidobacterium bifidum), Sporolactobacillus spp., Micromomospora spp., Micrococcus spp., Rhodococcus spp., and Pseudomonas (e.g., Pseudomonas fluorescens and Pseudomonas aeruginosa). Bacteria comprising the characteristics described herein are cultured in the presence of lactose, and a fucosylated oligosaccharide is retrieved, either from the bacterium itself or from a culture supernatant of the bacterium. The fucosylated oligosaccharide is purified for use in therapeutic or nutritional products, or the bacteria are used directly in such products. A suitable production host bacterial strain is one that is not the same bacterial strain as the source bacterial strain from which the fucosyltransferase-encoding nucleic acid sequence was identified.
Other features and advantages of the invention will be apparent from the following description of the preferred embodiments thereof, and from the claims. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All published foreign patents and patent applications cited herein are incorporated herein by reference. Genbank and NCBI submissions indicated by accession number cited herein are incorporated herein by reference. All other published references, documents, manuscripts and scientific literature cited herein are incorporated herein by reference. In the case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
While some studies suggest that human milk glycans could be used as antimicrobial anti-adhesion agents, the difficulty and expense of producing adequate quantities of these agents of a quality suitable for human consumption has limited their full-scale testing and perceived utility. What has been needed is a suitable method for producing the appropriate glycans in sufficient quantities at reasonable cost. Prior to the invention described herein, there were attempts to use several distinct synthetic approaches for glycan synthesis. Some chemical approaches can synthesize oligosaccharides (Flowers, H. M. Methods Enzymol 50, 93-121 (1978); Seeberger, P. H. Chem Commun (Camb) 1115-1121 (2003)), but reactants for these methods are expensive and potentially toxic (Koeller, K. M. & Wong, C. H. Chem Rev 100, 4465-4494 (2000)). Enzymes expressed from engineered organisms (Albermann, C., Piepersberg, W. & Wehmeier, U. F. Carbohydr Res 334, 97-103 (2001); Bettler, E., Samain, E., Chazalet, V., Bosso, C., et al. Glycoconj J 16, 205-212 (1999); Johnson, K. F. Glycoconj J 16, 141-146 (1999); Palcic, M. M. Curr Opin Biotechnol 10, 616-624 (1999); Wymer, N. & Toone, E. J. Curr Opin Chem Biol 4, 110-119 (2000)) provide a precise and efficient synthesis (Palcic, M. M. Curr Opin Biotechnol 10, 616-624 (1999)); Crout, D. H. & Vic, G. Curr Opin Chem Biol 2, 98-111 (1998)), but the high cost of the reactants, especially the sugar nucleotides, limits their utility for low-cost, large-scale production. Microbes have been genetically engineered to express the glycosyltransferases needed to synthesize oligosaccharides from the bacteria's innate pool of nucleotide sugars (Endo, T., Koizumi, S., Tabata, K., Kakita, S. & Ozaki, A. Carbohydr Res 330, 439-443 (2001); Endo, T., Koizumi, S., Tabata, K. & Ozaki, A. Appl Microbiol Biotechnol 53, 257-261 (2000); Endo, T. & Koizumi, S. Curr Opin Struct Biol 10, 536-541 (2000); Endo, T., Koizumi, S., Tabata, K., Kakita, S. & Ozaki, A. Carbohydr Res 316, 179-183 (1999); Koizumi, S., Endo, T., Tabata, K. & Ozaki, A. Nat Biotechnol 16, 847-850 (1998)). However, prior to the invention described herein, there was a growing need to identify and characterize additional glycosyltransferases that are useful for the synthesis of HMOS in metabolically engineered bacterial hosts.
Human Milk Glycans
Human milk contains a diverse and abundant set of neutral and acidic oligosaccharides (Kunz, C., Rudloff, S., Baier, W., Klein, N., and Strobel, S. (2000). Annu Rev Nutr 20, 699-722; Bode, L. (2006). J Nutr 136, 2127-130). More than 130 different complex oligosaccharides have been identified in human milk, and their structural diversity and abundance is unique to humans. Although these molecules may not be utilized directly by infants for nutrition, they nevertheless serve critical roles in the establishment of a healthy gut microbiome (Marcobal, A., Barboza, M., Froehlich, J. W., Block, D. E., et al. J Agric Food Chem 58, 5334-5340 (2010)), in the prevention of disease (Newburg, D. S., Ruiz-Palacios, G. M. & Morrow, A. L. Annu Rev Nutr 25, 37-58 (2005)), and in immune function (Newburg, D. S. & Walker, W. A. Pediatr Res 61, 2-8 (2007)). Despite millions of years of exposure to human milk oligosaccharides (HMOS), pathogens have yet to develop ways to circumvent the ability of HMOS to prevent adhesion to target cells and to inhibit infection. The ability to utilize HMOS as pathogen adherence inhibitors promises to address the current crisis of burgeoning antibiotic resistance. Human milk oligosaccharides produced by biosynthesis represent the lead compounds of a novel class of therapeutics against some of the most intractable scourges of society.
One alternative strategy for efficient, industrial-scale synthesis of HMOS is the metabolic engineering of bacteria. This approach involves the construction of microbial strains overexpressing heterologous glycosyltransferases, membrane transporters for the import of precursor sugars into the bacterial cytosol, and possessing enhanced pools of regenerating nucleotide sugars for use as biosynthetic precursors (Dumon, C., Samain, E., and Priem, B. (2004). Biotechnol Prog 20, 412-19; Ruffing, A., and Chen, R. R. (2006). Microb Cell Fact 5, 25). A key aspect of this approach is the heterologous glycosyltransferase selected for overexpression in the microbial host. The choice of glycosyltransferase can significantly affect the final yield of the desired synthesized oligosaccharide, given that enzymes can vary greatly in terms of kinetics, substrate specificity, affinity for donor and acceptor molecules, stability and solubility. A few glycosyltransferases derived from different bacterial species have been identified and characterized in terms of their ability to catalyze the biosynthesis of HMOS in E. coli host strains (Dumon, C., Bosso, C., Utille, J. P., Heyraud, A., and Samain, E. (2006). Chembiochem 7, 359-365; Dumon, C., Samain, E., and Priem, B. (2004). Biotechnol Prog 20, 412-19; Li, M., Liu, X. W., Shao, J., Shen, J., Jia, Q., Yi, W., Song, J. K., Woodward, R., Chow, C. S., and Wang, P. G. (2008). Biochemistry 47, 378-387). The identification of additional glycosyltransferases with faster kinetics, greater affinity for nucleotide sugar donors and/or acceptor molecules, or greater stability within the bacterial host significantly improves the yields of therapeutically useful HMOS. Prior to the invention described herein, chemical syntheses of HMOS were possible, but were limited by stereo-specificity issues, precursor availability, product impurities, and high overall cost (Flowers, H. M. Methods Enzymol 50, 93-121 (1978); Seeberger, P. H. Chem Commun (Camb) 1115-1121 (2003); Koeller, K. M. & Wong, C. H. Chem Rev 100, 4465-4494 (2000)). The invention overcomes the shortcomings of these previous attempts by providing new strategies to inexpensively manufacture large quantities of human milk oligosaccharides (HMOS) for use as dietary supplements. Advantages include efficient expression of the enzyme, improved stability and/or solubility of the fucosylated oligosaccharide product (2′-FL, LDFT, LNF I, and LDFH I) and reduced toxicity to the host organism. The present invention features novel α(1,2) FTs suitable for expression in production strains for increased efficacy and yield of fucosylated HMOS compared to α(1,2) FTs currently utilized in the field.
As described in detail below, E. coli (or other bacteria) is engineered to produce selected fucosylated oligosaccharides (i.e., 2′-FL, LDFT, LDHF I, or LNF I) in commercially viable levels. For example, yields are >5 grams/liter in a bacterial fermentation process. In other embodiments, the yields are greater than 10 grams/liter, greater than 15 grams/liter, greater than 20 grams/liter, greater than 25 grams/liter, greater than 30 grams/liter, greater than 35 grams/liter, greater than 40 grams/liter, greater than 45 grams/liter, greater than 50 grams/liter, greater than 55 grams/liter, greater than 60 grams/liter, greater than 65 grams/liter, greater than 70 grams/liter, or greater than 75 grams/liter of fucosylated oligosaccharide products, such as 2′-FL, LDFT, LDHF I, and LNF I.
Role of Human Milk Glycans in Infectious Disease
Human milk glycans, which comprise both unbound oligosaccharides and their glycoconjugates, play a significant role in the protection and development of the infant gastrointestinal (GI) tract. Neutral fucosylated oligosaccharides, including 2′-fucosyllactose (2′-FL), protect infants against several important pathogens. Milk oligosaccharides found in various mammals differ greatly, and the composition in humans is unique (Hamosh M., 2001 Pediatr Clin North Am, 48:69-86; Newburg D. S., 2001 Adv Exp Med Biol, 501:3-10). Moreover, glycan levels in human milk change throughout lactation and also vary widely among individuals (Morrow A. L. et al., 2004 J Pediatr, 145:297-303; Chaturvedi P et al., 2001 Glycobiology, 11:365-372). Approximately 200 distinct human milk oligosaccharides have been identified and combinations of simple epitopes are responsible for this diversity (Newburg D. S., 1999 Curr Med Chem, 6:117-127; Ninonuevo M. et al., 2006 J Agric Food Chem, 54:7471-74801).
Human milk oligosaccharides are composed of 5 monosaccharides: D-glucose (Glc), D-galactose (Gal), N-acetylglucosamine (GlcNAc), L-fucose (Fuc), and sialic acid (N-acetyl neuraminic acid, NeuSAc, NANA). Human milk oligosaccharides are usually divided into two groups according to their chemical structures: neutral compounds containing Glc, Gal, GlcNAc, and Fuc, linked to a lactose (Galβ1-4G1c) core, and acidic compounds including the same sugars, and often the same core structures, plus NANA (Charlwood J. et al., 1999 Anal Biochem, 273:261-277; Martin-Sosa et al., 2003 J Dairy Sci, 86:52-59; Parkkinen J. and Finne J., 1987 Methods Enzymol, 138:289-300; Shen Z. et al., 2001 J Chromatogr A, 921:315-321).
Approximately 70-80% of oligosaccharides in human milk are fucosylated, and their synthetic pathways are believed to proceed as shown in
Human Milk Glycans Inhibit Binding of Enteropathogens to their Receptors
Human milk glycans have structural homology to cell receptors for enteropathogens and function as receptor decoys. For example, pathogenic strains of Campylobacter bind specifically to glycans containing H-2, i.e., 2′-fucosyl-N-acetyllactosamine or 2′-fucosyllactose (2′FL); Campylobacter binding and infectivity are inhibited by 2′-FL and other glycans containing this H-2 epitope. Similarly, some diarrheagenic E. coli pathogens are strongly inhibited in vivo by human milk oligosaccharides containing 2-linked fucose moieties. Several major strains of human caliciviruses, especially the noroviruses, also bind to 2-linked fucosylated glycans, and this binding is inhibited by human milk 2-linked fucosylated glycans. Consumption of human milk that has high levels of these 2-linked fucosyloligosaccharides was associated with lower risk of norovirus, Campylobacter, ST of E. coli-associated diarrhea, and moderate-to-severe diarrhea of all causes in a Mexican cohort of breastfeeding children (Newburg D. S. et al., 2004 Glycobiology, 14:253-263; Newburg D. S. et al., 1998 Lancet, 351:1160-1164). Several pathogens utilize sialylated glycans as their host receptors, such as influenza (Couceiro, J. N., Paulson, J. C. & Baum, L. G. Virus Res 29, 155-165 (1993)), parainfluenza (Amonsen, M., Smith, D. F., Cummings, R. D. & Air, G. M. J Virol 81, 8341-8345 (2007), and rotoviruses (Kuhlenschmidt, T. B., Hanafin, W. P., Gelberg, H. B. & Kuhlenschmidt, M. S. Adv Exp Med Biol 473, 309-317 (1999)). The sialyl-Lewis X epitope is used by Helicobacter pylori (Mandavi, J., Sondén, B., Hurtig, M., Olfat, F. O., et al. Science 297, 573-578 (2002)), Pseudomonas aeruginosa (Scharfman, A., Delmotte, P., Beau, J., Lamblin, G., et al. Glycoconj J 17, 735-740 (2000)), and some strains of noroviruses (Rydell, G. E., Nilsson, J., Rodriguez-Diaz, J., Ruvoen-Clouet, N., et al. Glycobiology 19, 309-320 (2009)).
Identification of Novel α(1,2) Fucosyltransferases
The present invention provides novel α(1,2) fucosyltransferase enzymes. The present invention also provides nucleic acid constructs (i.e., a plasmid or vector) carrying the nucleic acid sequence of a novel α(1,2) fucosyltransferases for the expression of the novel α(1,2) fucosyltransferases in host bacterium. The present invention also provides methods for producing fucosylated oligosaccharides by expressing the novel α(1,2) fucosyltransferases in suitable host production bacterium, as further described herein.
Not all α(1,2)fucosyltransferases can utilize lactose as an acceptor substrate. An acceptor substrate includes, for example, a carbohydrate, an oligosaccharide, a protein or glycoprotein, a lipid or glycolipid, e.g., N-acetylglucosamine, N-acetyllactosamine, galactose, fucose, sialic acid, glucose, lactose, or any combination thereof. A preferred alpha (1,2) fucosyltransferase of the present invention utilizes GDP-fucose as a donor, and lactose is the acceptor for that donor.
A method of identifying novel α(1,2)fucosyltransferase enzymes capable of utilizing lactose as an acceptor was previously carried out (as described in PCT/US2013/051777, hereby incorporated by reference in its entirety) using the following steps: 1) performing a computational search of sequence databases to define a broad group of simple sequence homologs of any known, lactose-utilizing α(1,2)fucosyltransferase; 2) using the list of homologs from step 1 to derive a search profile containing common sequence and/or structural motifs shared by the members of the broad group, e.g. by using computer programs such as MEME (Multiple Em for Motif Elicitation available at http://meme.sdsc.edu/meme/cgi-bin/meme.cgi) or PSI-BLAST (Position-Specific Iterated BLAST available at ncbi.nlm.nih.gov/blast with additional information at cnx.org/content/m11040/latest/); 3) searching sequence databases (e.g., using computer programs such as PSI-BLAST, or MAST (Motif Alignment Search Tool available at http://meme.sdsc.edu/meme/cgi-bin/mast.cgi); using this derived search profile as query, and identifying “candidate sequences” whose simple sequence homology to the original lactose-accepting α(1,2)fucosyltransferase is 40% or less; 4) scanning the scientific literature and developing a list of “candidate organisms” known to express α(1,2)fucosyl-glycans; 5) selecting only those “candidate sequences” that are derived from “candidate organisms” to generate a list of “candidate lactose-utilizing enzymes”; and 6) expressing each “candidate lactose-utilizing enzyme” and testing for lactose-utilizing α(1,2)fucosyltransferase activity.
The MEME suite of sequence analysis tools (meme.sdsc.edu/meme/cgi-bin/meme.cgi) can also be used as an alternative to PSI-BLAST. Sequence motifs are discovered using the program “MEME”. These motifs can then be used to search sequence databases using the program “MAST”. The BLAST and PSI-BLAST search algorithms are other well known alternatives.
To identify additional novel α(1,2)fucosyltransferases, a multiple sequence alignment query was generated using four previously identified lactose-utilizing α(1,2)fucosyltransferase protein sequences: H. pylori futC (SEQ ID NO: 1), H. mustelae FutL (SEQ ID NO: 2), Bacteroides vulgatus futN (SEQ ID NO: 3), and E. coli 0126 wbgL (SEQ ID NO: 4). These sequence alignment and percentage of sequence identity is shown in
This PSI-BLAST search resulted in an initial 2515 hits. There were 787 hits with greater than 22% sequence identity to FutC. 396 hits were of greater than 275 amino acids in length. Additional analysis of the hits was performed, including sorting by percentage identity to FutC, comparing the sequences by BLAST to existing α(1,2) fucosyltransferase inventory (of known α(1,2) fucosyltransferases), and manual annotation of hit sequences to identify those originating from bacteria that naturally exist in the gastrointestinal tract. An annotated list of the novel α(1,2) fucosyltransferases identified by this screen are listed in Table 1. Table 1 provides the bacterial species from which the candidate enzyme is found, the GenBank Accession Number, GI Identification Number, amino acid sequence, and % sequence identity to FutC.
Of the identified hits, 12 novel α(1,2) fucosyltransferases were further analyzed for their functional capacity: Prevotella melaninogenica FutO, Clostridium bolteae FutP, Clostridium bolteae+13 FutP, Lachnospiraceae sp. FutQ, Methanosphaerula palustries FutR, Tannerella sp. FutS, Bacteroides caccae FutU, Butyrivibrio FutV, Prevotellaa sp. FutW, Parabacteroides johnsonii FutX, Akkermansia muciniphilia FutY, Salmonella enterica FutZ, and Bacteroides sp. FutZA. For Clostridium bolteae FutP, the annotation named the wrong initiation methionine codon. Thus, the present invention includes FutP with an additional 13 amino acids at the N-terminus of the annotated FutP (derived in-frame from the natural upstream DNA sequence), which is designated herein as Clostridium bolteae+13 FutP. The sequence identity between the 12 novel α(1,2) fucosyltransferases identified and the 4 previously identified α(1,2) fucosyltransferases is shown in Table 2 below.
H. pylori futC
H. mustelae futL
Bacteroides vulgatus
E. coli 0126 wbgL
Prevotella
melaninogenica Fut0
Clostridium
bolteae + 13 FutP
Lachnospiraceae sp.
Methanosphaerula
palustris FutR
Tannerella sp. FutS
Bacteroides caccae
Butyrivibrio FutV
Prevotella sp. FutW
Parabacteroides
johnsonii FutX
Akkermansia
muciniphilia FutY
Salmonella enterica
Bacteroides sp.
Based on the amino acid sequences of the identified α(1,2) fucosyltransferases (i.e., in Table 1), syngenes can be readily designed and constructed by the skilled artisan using standard methods known in the art. For example, the syngenes include a ribosomal binding site, are codon-optimized for expression in a host bacterial production strain (i.e., E. coli), and have common 6-cutter restriction sites or sites recognized by endogenous restriction enzymes present in the host strain (i.e., EcoK restriction sites) removed to ease cloning and expression in the E. coli host strain. In a preferred embodiment, the syngenes are constructed with the following configuration: EcoRI site-T7g10 RBS-α(1,2) FT syngene-XhoI site. The nucleic acid sequences of sample syngenes for the 12 identified α(1,2) fucosyltransferases are shown in Table 3. (the initiating methionine ATG codon is bolded)
In any of the methods described herein, the α(1,2) fucosyltransferase genes or gene products may be variants or functional fragments thereof. A variant of any of genes or gene products disclosed herein may have 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to the nucleic acid or amino acid sequences described herein.
Variants as disclosed herein also include homolog, orthologs, or paralogs of the genes or gene products described herein that retain the same biological function as the genes or gene products specified herein. These variants can be used interchangeably with the genes recited in these methods. Such variants may demonstrate a percentage of homology or identity, for example, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity conserved domains important for biological function, preferably in a functional domain, e.g. catalytic domain.
The term “% identity,” in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection. For example, % identity is relative to the entire length of the coding regions of the sequences being compared, or the length of a particular fragment or functional domain thereof.
For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
Percent identity is determined using search algorithms such as BLAST and PSI-BLAST (Altschul et al., 1990, J Mol Biol 215:3, 403-410; Altschul et al., 1997, Nucleic Acids Res 25:17, 3389-402). For the PSI-BLAST search, the following exemplary parameters are employed: (1) Expect threshold was 10; (2) Gap cost was Existence:11 and Extension:1; (3) The Matrix employed was BLOSUM62; (4) The filter for low complexity regions was “on”.
Changes can be introduced by mutation into the nucleic acid sequence or amino acid sequence of any of the genes or gene products described herein, leading to changes in the amino acid sequence of the encoded protein or enzyme, without altering the functional ability of the protein or enzyme. For example, nucleotide substitutions leading to amino acid substitutions at “non-essential” amino acid residues can be made in the sequence of any of sequences expressly disclosed herein. A “non-essential” amino acid residue is a residue at a position in the sequence that can be altered from the wild-type sequence of the polypeptide without altering the biological activity, whereas an “essential” amino acid residue is a residue at a position that is required for biological activity. For example, amino acid residues that are conserved among members of a family of proteins are not likely to be amenable to mutation. Other amino acid residues, however, (e.g., those that are poorly conserved among members of the protein family) may not be as essential for activity and thus are more likely to be amenable to alteration. Thus, another aspect of the invention pertains to nucleic acid molecules encoding the proteins or enzymes disclosed herein that contain changes in amino acid residues relative to the amino acid sequences disclosed herein that are not essential for activity (i.e., fucosyltransferase activity).
An isolated nucleic acid molecule encoding a protein essentially retaining the functional capability compared to any of the genes described herein can be created by introducing one or more nucleotide substitutions, additions or deletions into the corresponding nucleotide sequence, such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein.
Mutations can be introduced into a nucleic acid sequence by standard techniques such that the encoded amino acid sequence is altered, such as site-directed mutagenesis and PCR-mediated mutagenesis. Preferably, conservative amino acid substitutions are made at one or more predicted non-essential amino acid residues. A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. Certain amino acids have side chains with more than one classifiable characteristic. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, tryptophan, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tyrosine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a predicted nonessential amino acid residue in a given polypeptide is replaced with another amino acid residue from the same side chain family. Alternatively, in another embodiment, mutations can be introduced randomly along all or part of a given coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for given polypeptide biological activity to identify mutants that retain activity. Conversely, the invention also provides for variants with mutations that enhance or increase the endogenous biological activity. Following mutagenesis of the nucleic acid sequence, the encoded protein can be expressed by any recombinant technology known in the art and the activity of the protein can be determined. An increase, decrease, or elimination of a given biological activity of the variants disclosed herein can be readily measured by the ordinary person skilled in the art, i.e., by measuring the capability for mediating oligosaccharide modification, synthesis, or degradation (via detection of the products).
The present invention also provides for functional fragments of the genes or gene products described herein. A fragment, in the case of these sequences and all others provided herein, is defined as a part of the whole that is less than the whole. Moreover, a fragment ranges in size from a single nucleotide or amino acid within a polynucleotide or polypeptide sequence to one fewer nucleotide or amino acid than the entire polynucleotide or polypeptide sequence. Finally, a fragment is defined as any portion of a complete polynucleotide or polypeptide sequence that is intermediate between the extremes defined above.
For example, fragments of any of the proteins or enzymes disclosed herein or encoded by any of the genes disclosed herein can be 10 to 20 amino acids, 10 to 30 amino acids, 10 to 40 amino acids, 10 to 50 amino acids, 10 to 60 amino acids, 10 to 70 amino acids, 10 to 80 amino acids, 10 to 90 amino acids, 10 to 100 amino acids, 50 to 100 amino acids, 75 to 125 amino acids, 100 to 150 amino acids, 150 to 200 amino acids, 200 to 250 amino acids, 250 to 300 amino acids, 300 to 350 amino acids, 350 to 400 amino acids, 400 to 450 amino acids, or 450 to 500 amino acids. The fragments encompassed in the present invention comprise fragments that retain functional fragments. As such, the fragments preferably retain the catalytic domains that are required or are important for functional activity. Fragments can be determined or generated by using the sequence information herein, and the fragments can be tested for functional activity using standard methods known in the art. For example, the encoded protein can be expressed by any recombinant technology known in the art and the activity of the protein can be determined. The biological function of said fragment can be measured by measuring ability to synthesize or modify a substrate oligosaccharide, or conversely, to catabolize an oligosaccharide substrate.
Within the context of the invention, “functionally equivalent”, as used herein, refers to a gene or the resulting encoded protein variant or fragment thereof capable of exhibiting a substantially similar activity as the wild-type fucosyltransferase. Specifically, the fucosyltransferase activity refers to the ability to transfer a fucose sugar to an acceptor substrate via an alpha-(1,2)-linkage. As used herein, “substantially similar activity” refers to an activity level within 5%, 10%, 20%, 30%, 40%, or 50% of the wild-type fucosyltransferase.
To test for lactose-utilizing fucosyltransferase activity, the production of fucosylated oligosaccharides (i.e., 2′-FL) is evaluated in a host organism that expresses the candidate enzyme (or syngene) and which contains both cytoplasmic GDP-fucose and lactose pools. The production of fucosylated oligosaccharides indicates that the candidate enzyme-encoding sequence functions as a lactose-utilizing α(1,2)fucosyltransferase.
Engineering of E. coli to Produce Human Milk Oligosaccharide 2′-FL
Described herein is a gene screening approach, which was used to validate the novel α (1,2) fucosyltransferases (α (1,2) FTs) for the synthesis of fucosyl-linked oligosaccharides in metabolically engineered E. coli. Of particular interest are α (1,2) FTs that are capable of the synthesis of the HMOS 2′-fucosyllactose (2′-FL). 2′-FL is the most abundant fucosylated oligosaccharide present in human milk, and this oligosaccharide provides protection to newborn infants against infectious diarrhea caused by bacterial pathogens such as Campylobacter jejuni (Ruiz-Palacios, G. M., et al. (2003). J Biol Chem 278, 14112-120; Morrow, A. L. et al. (2004). J Pediatr 145, 297-303; Newburg, D. S. et al. (2004). Glycobiology 14, 253-263). Other α (1,2) FTs of interest are those capable of synthesis of HMOS lactodifucotetraose (LDFT), laco-N-fucopentaose I (LNFI), or lacto-N-difucohexaose I (LDFH I).
The synthetic pathway of fucosyl oligosaccharides of human milk is illustrated in
Candidate α(1,2) FTs (i.e., syngenes) were cloned by standard molecular biological techniques into an expression plasmid. This plasmid utilizes the strong leftwards promoter of bacteriophage λ (termed PL) to direct expression of the candidate genes (Sanger, F. et al. (1982). J Mol Biol 162, 729-773). The promoter is controllable, e.g., a trp-cI construct is stably integrated the into the E. coli host's genome (at the ampC locus), and control is implemented by adding tryptophan to the growth media. Gradual induction of protein expression is accomplished using a temperature sensitive cI repressor. Another similar control strategy (temperature independent expression system) has been described (Mieschendahl et al., 1986, Bio/Technology 4:802-808). The plasmid also carries the E. coli rcsA gene to up-regulate GDP-fucose synthesis, a critical precursor for the synthesis of fucosyl-linked oligosaccharides. In addition, the plasmid carries a β-lactamase (bla) gene for maintaining the plasmid in host strains by ampicillin selection (for convenience in the laboratory) and a native thyA (thymidylate synthase) gene as an alternative means of selection in thyA− hosts. Alternative selectable markers include the proBA genes to complement proline auxotrophy (Stein et al., (1984), J Bacteriol 158:2, 696-700 (1984) or purA to complement adenine auxotrophy (S. A. Wolfe, J. M. Smith, J Biol Chem 263, 19147-53 (1988)). To act as plasmid selectable markers each of these genes are first inactivated in the host cell chromosome, then wild type copies of the genes are provided on the plasmid. Alternatively a drug resistance gene may be used on the plasmid, e.g. beta-lactamase (this gene is already on the expression plasmid described above, thereby permitting selection with ampicillin). Ampicillin selection is well known in the art and described in standard manuals such as Maniatis et al., (1982) Molecular cloning, a laboratory manual. Cold Spring Harbor Laboratory, Cold Spring, N.Y.
The nucleic acid sequence of such an expression plasmid, pEC2-(T7)FutX-rcsA-thyA (pG401) is provided below. The underlined sequence represents the FutX syngene, which can be readily replaced with any of the novel α(1,2) FTs described herein using standard recombinant DNA techniques.
TTAATCGGTACTTTGATCCATTCTTTCGGGTACATGTCCGGGGTTTCTTTATGCTGGAACCAGCGACA
CGGCGCGATGACGATTTTCTCTTTACGTGGGTTCAGCCAAGCACCCCACCAGGAGAACGTAGAATTAC
AGATAATGTGGTGACGACAGTGGCTCATCAGCATCATATCCTGCCAGCTGTCTTCGCCCTTGTTCCAC
GTCACGTAGACCGCTTTCTTCAGCGGGATGTTTTCTTTAACCCAAGAGATATCATCAGAGAACACGTA
GTAGCTCGGGCCAGTAATACGGTTCTCCATTTCCGCGATCGCGTTCTTGTAATACGGCAGCTGGCACA
CGGAACCCGTGTTTGCCCAGTGACGCGGCAGCAGGTAGTCACCACGGCGGATGTGGATAGAAACAGCT
TGGTCGTCAACTTCGATCTGTTTCAGCAGTTCCAGGCTTTCCGGGTTAGCGATGTTCAGGTTAAAAGA
GAAGGCTTTACGAACGTCGTCTTTGATATCGAAGAAGAAGCGTTCAGACTGGTAGAAACCTTTAAAGT
ACAGCAGCGGCCAAAAATAACGTTTTTCGTATGGATACAGAGTAGACGGGTCCTGGCGACGTTCGTAG
ATTTTTTTGAAGAACAGGAACTCCAGGATTTTTTTCAGGGTACGGTTGATGCAAAATTCAGTCTGGCT
CAGGTCAAAGATACGGTTCATCTCATAACCGTTGTGAACTTTATAATGAACCATGTCAGACAGATCGA
TGTTCGTATCCGGGTAATGGTGTTTCATTTTCAGGTAGAACGCGTAGATAAACATCTGGTTACCCAGG
CCGCCGATCATCTTGATCAGACGCATATGTATATCTCCTTCTTGAATTCTAAAAATTGATTGAATGTA
The expression constructs were transformed into a host strain useful for the production of 2′-FL. Biosynthesis of 2′-FL requires the generation of an enhanced cellular pool of both lactose and GDP-fucose (
First, the ability of the E. coli host strain to accumulate intracellular lactose was engineered by simultaneous deletion of the endogenous β-galactosidase gene (lacZ) and the lactose operon repressor gene (lad). During construction of this deletion, the lacIq promoter was placed immediately upstream of the lactose permease gene, lacY. The modified strain maintains its ability to transport lactose from the culture medium (via LacY), but is deleted for the wild-type copy of the lacZ (β-galactosidase) gene responsible for lactose catabolism. Therefore, an intracellular lactose pool is created when the modified strain is cultured in the presence of exogenous lactose. A schematic of the PlacIq lacY+ chromosomal construct is shown in
Genomic DNA sequence of the PlacIq lacY+ chromosomal construct is set forth below (SEQ ID NO: 288):
Second, the ability of the host E. coli strain to synthesize colanic acid, an extracellular capsular polysaccharide, was eliminated by the deletion of the wcaJ gene, encoding the UDP-glucose lipid carrier transferase (Stevenson, G. et al. (1996). J Bacteriol 178, 4885-893). In a wcaJ null background GDP-fucose accumulates in the E. coli cytoplasm (Dumon, C. et al. (2001). Glycoconj J 18, 465-474). A schematic of the chromosomal deletion of wcaJ is shown in
The sequence of the chromosomal region of E. coli bearing the ΔwcaJ::FRT mutation is set forth below (SEQ ID NO: 289):
Third, the magnitude of the cytoplasmic GDP-fucose pool was enhanced by the introduction of a null mutation into the lon gene. Lon is an ATP-dependant intracellular protease that is responsible for degrading RcsA, which is a positive transcriptional regulator of colanic acid biosynthesis in E. coli (Gottesman, S. & Stout, V. Mol Microbiol 5, 1599-1606 (1991)). In a lon null background, RcsA is stabilized, RcsA levels increase, the genes responsible for GDP-fucose synthesis in E. coli are up-regulated, and intracellular GDP-fucose concentrations are enhanced. The lon gene was almost entirely deleted and replaced by an inserted functional, wild-type, but promoter-less E. coli lacZ+ gene (Δlon::(kan, lacZ+). λ Red recombineering was used to perform the construction. A schematic of the kan, lacZ+ insertion into the lon locus is shown in
Genomic DNA sequence surrounding the lacZ+ insertion into the lon region in the E. coli strain is set forth below (SEQ ID NO: 290):
Fourth, a thyA (thymidylate synthase) mutation was introduced into the strain by P1 transduction. In the absence of exogenous thymidine, thyA strains are unable to make DNA and die. The defect can be complemented in trans by supplying a wild-type thyA gene on a multicopy plasmid (Belfort, M., Maley, G. F., and Maley, F. (1983). Proc Natl Acad Sci USA 80, 1858-861). This complementation was used here as a means of plasmid maintenance.
An additional modification that is useful for increasing the cytoplasmic pool of free lactose (and hence the final yield of 2′-FL) is the incorporation of a lacA mutation. LacA is a lactose acetyltransferase that is only active when high levels of lactose accumulate in the E. coli cytoplasm. High intracellular osmolarity (e.g., caused by a high intracellular lactose pool) can inhibit bacterial growth, and E. coli has evolved a mechanism for protecting itself from high intra cellular osmlarity caused by lactose by “tagging” excess intracellular lactose with an acetyl group using LacA, and then actively expelling the acetyl-lactose from the cell (Danchin, A. Bioessays 31, 769-773 (2009)). Production of acetyl-lactose in E. coli engineered to produce 2′-FL or other human milk oligosaccharides is therefore undesirable: it reduces overall yield. Moreover, acetyl-lactose is a side product that complicates oligosaccharide purification schemes. The incorporation of a lacA mutation resolves these problems. Sub-optimal production of fucosylated oligosaccharides occurs in strains lacking either or both of the mutations in the colanic acid pathway and the lon protease. Diversion of lactose into a side product (acetyl-lactose) occurs in strains that do not contain the lacA mutation. A schematic of the lacA deletion and corresponding genomic sequence is provided above (SEQ ID NO: 288).
The strain used to test the different α(1,2) FT candidates incorporates all the above genetic modifications and has the following genotype: ΔampC::PtrpBcI, A(lacI-lacZ)::FRT, PlacIqlacY+, ΔwcaJ::FRT, thyA::Tn10, Δlon:(npt3, lacZ+), ΔlacA
The E. coli strains harboring the different α(1,2) FT candidate expression plasmids were analyzed. Strains were grown in selective media (lacking thymidine) to early exponential phase. Lactose was then added to a final concentration of 0.5%, and tryptophan (200 μM) was added to induce expression of each candidate α(1,2) FT from the PL promoter. At the end of the induction period (˜24 h) equivalent OD 600 units of each strain and the culture supernatant was harvested. Lysates were prepared and analyzed for the presence of 2′-FL by thin layer chromatography (TLC).
A map of plasmid pG217 is shown in
Fucosylated oligosaccharides produced by metabolically engineered E. coli cells are purified from culture broth post-fermentation. An exemplary procedure comprises five steps. (1) Clarification: Fermentation broth is harvested and cells removed by sedimentation in a preparative centrifuge at 6000×g for 30 min. Each bioreactor run yields about 5-7 L of partially clarified supernatant. (2) Product capture on coarse carbon: A column packed with coarse carbon (Calgon 12×40 TR) of ˜4000 ml volume (dimension 5 cm diameter×60 cm length) is equilibrated with 1 column volume (CV) of water and loaded with clarified culture supernatant at a flow rate of 40 ml/min. This column has a total capacity of about 120 g of sugar. Following loading and sugar capture, the column is washed with 1.5 CV of water, then eluted with 2.5 CV of 50% ethanol or 25% isopropanol (lower concentrations of ethanol at this step (25-30%) may be sufficient for product elution.) This solvent elution step releases about 95% of the total bound sugars on the column and a small portion of the color bodies. In this first step capture of the maximal amount of sugar is the primary objective. Resolution of contaminants is not an objective. (3) Evaporation: A volume of 2.5 L of ethanol or isopropanol eluate from the capture column is rotary-evaporated at 56 C.° and a sugar syrup in water is generated. Alternative methods that could be used for this step include lyophilization or spray-drying. (4) Flash chromatography on fine carbon and ion exchange media: A column (GE Healthcare HiScale50/40, 5×40 cm, max pressure 20 bar) connected to a Biotage Isolera One FLASH Chromatography System is packed with 750 ml of a Darco Activated Carbon G60 (100-mesh): Celite 535 (coarse) 1:1 mixture (both column packings were obtained from Sigma). The column is equilibrated with 5 CV of water and loaded with sugar from step 3 (10-50 g, depending on the ratio of 2′-FL to contaminating lactose), using either a celite loading cartridge or direct injection. The column is connected to an evaporative light scattering (ELSD) detector to detect peaks of eluting sugars during the chromatography. A four-step gradient of isopropanol, ethanol or methanol is run in order to separate 2′-FL from monosaccharides (if present), lactose and color bodies. Fractions corresponding to sugar peaks are collected automatically in 120-ml bottles, pooled and directed to step 5. In certain purification runs from longer-than-normal fermentations, passage of the 2′-FL-containing fraction through anion-exchange and cation exchange columns can remove excess protein/DNA/caramel body contaminants. Resins tested successfully for this purpose are Dowex 22.
The gene screening approach described herein was successfully utilized to identify new α(1,2) FTs for the efficient biosynthesis of 2′-FL in metabolically engineered E. coli host strains. The results of the screen are summarized in Table 1.
Production Host Strains
E. coli K-12 is a well-studied bacterium which has been the subject of extensive research in microbial physiology and genetics and commercially exploited for a variety of industrial uses. The natural habitat of the parent species, E. coli, is the large bowel of mammals. E. coli K-12 has a history of safe use, and its derivatives are used in a large number of industrial applications, including the production of chemicals and drugs for human administration and consumption. E. coli K-12 was originally isolated from a convalescent diphtheria patient in 1922. Because it lacks virulence characteristics, grows readily on common laboratory media, and has been used extensively for microbial physiology and genetics research, it has become the standard bacteriological strain used in microbiological research, teaching, and production of products for industry and medicine. E. coli K-12 is now considered an enfeebled organism as a result of being maintained in the laboratory environment for over 70 years. As a result, K-12 strains are unable to colonize the intestines of humans and other animals under normal conditions. Additional information on this well known strain is available at http://epa.gov/oppt/biotech/pubs/fra/fra004.htm. In addition to E. coli K12, other bacterial strains are used as production host strains, e.g., a variety of bacterial species may be used in the oligosaccharide biosynthesis methods, e.g., Erwinia herbicola (Pantoea agglomerans), Citrobacter freundii, Pantoea citrea, Pectobacterium carotovorum, or Xanthomonas campestris. Bacteria of the genus Bacillus may also be used, including Bacillus subtilis, Bacillus licheniformis, Bacillus coagulans, Bacillus thermophilus, Bacillus laterosporus, Bacillus megaterium, Bacillus mycoides, Bacillus pumilus, Bacillus lentus, Bacillus cereus, and Bacillus circulans. Similarly, bacteria of the genera Lactobacillus and Lactococcus may be modified using the methods of this invention, including but not limited to Lactobacillus acidophilus, Lactobacillus salivarius, Lactobacillus plantarum, Lactobacillus helveticus, Lactobacillus delbrueckii, Lactobacillus rhamnosus, Lactobacillus bulgaricus, Lactobacillus crispatus, Lactobacillus gasseri, Lactobacillus casei, Lactobacillus reuteri, Lactobacillus jensenii, and Lactococcus lactis. Streptococcus thermophiles and Proprionibacterium freudenreichii are also suitable bacterial species for the invention described herein. Also included as part of this invention are strains, modified as described here, from the genera Enterococcus (e.g., Enterococcus faecium and Enterococcus thermophiles), Bifidobacterium (e.g., Bifidobacterium longum, Bifidobacterium infantis, and Bifidobacterium bifidum), Sporolactobacillus spp., Micromomospora spp., Micrococcus spp., Rhodococcus spp., and Pseudomonas (e.g., Pseudomonas fluorescens and Pseudomonas aeruginosa).
Suitable host strains are amenable to genetic manipulation, e.g., they maintain expression constructs, accumulate precursors of the desired end product, e.g., they maintain pools of lactose and GDP-fucose, and accumulate endproduct, e.g., 2′-FL. Such strains grow well on defined minimal media that contains simple salts and generally a single carbon source. The strains engineered as described above to produce the desired fucosylated oligosaccharide(s) are grown in a minimal media. An exemplary minimal medium used in a bioreactor, minimal “FERM” medium, is detailed below.
Ferm (10 liters): Minimal medium comprising:
40 g (NH4)2HPO4
100 g KH2PO4
10 g MgSO4.7H2O
40 g NaOH
1× Trace elements:
1.3 g NTA (nitrilotriacetic acid)
0.5 g FeSO4.7H2O
0.09 g MnCl2.4H2O
0.09 g ZnSO4.7H2O
0.01 g CoCl2.6H2O
0.01 g CuCl2.2H2O
0.02 g H3BO3
0.01 g Na2MoO4.2H2O (pH 6.8)
Water to 10 liters
DF204 antifoam (0.1 ml/L)
150 g glycerol (initial batch growth), followed by fed batch mode with a 90% glycerol-1% MgSO4-1× trace elements feed, at various rates for various times.
A suitable production host strain is one that is not the same bacterial strain as the source bacterial strain from which the fucosyltransferase-encoding nucleic acid sequence was identified.
Bacteria comprising the characteristics described herein are cultured in the presence of lactose, and a fucosylated oligosaccharide is retrieved, either from the bacterium itself or from a culture supernatant of the bacterium. The fucosylated oligosaccharide is purified for use in therapeutic or nutritional products, or the bacteria are used directly in such products.
To identify additional novel α(1,2)fucosyltransferases, a multiple sequence alignment query was generated using the alignment algorithm of the CLCbio Main Workbench package, version 6.9 (CLCbio, 10 Rogers Street #101, Cambridge, Mass. 02142, USA) using four previously identified lactose-utilizing α(1,2)fucosyltransferase protein sequences: H. pylori futC (SEQ ID NO: 1), H. mustelae FutL (SEQ ID NO: 2), Bacteroides vulgatus futN (SEQ ID NO: 3), and E. coli 0126 wbgL (SEQ ID NO: 4). This sequence alignment and percentages of sequence identity between the four previously identified lactose-utilizing α(1,2)fucosyltransferase protein sequences is shown in
A portion of the initial position-specific scoring matrix file used is shown below:
The command line of PSI-BLAST that was used is as follows: psiblast-db<LOCAL NR database name>-max_target_seqs 2500-in_msa<MSA file in FAST format>-out<results output file>-outfmt “7sskingdoms sscinames scomnames sseqid stitle evalue length pident”-out_pssm<PSSM file output>-out_ascii_pssm<PSSM (ascii) output>-num_iterations 6-num_threads 8
This PSI-BLAST search resulted in an initial 2515 hits. There were 787 hits with greater than 22% sequence identity to FutC. 396 hits were of greater than 275 amino acids in length. Additional analysis of the hits was performed, including sorting by percentage identity to FutC, comparing the sequences by BLAST to an existing α(1,2) fucosyltransferase inventory (of known α(1,2) fucosyltransferases, to eliminate known lactose-utilizing enzymes and duplicate hits), and manual annotation of hits to identify those originating from bacteria that naturally exist in the gastrointestinal tract. An annotated list of the novel α(1,2) fucosyltransferases identified by this screen are listed in Table 1. Table 1 provides the bacterial species from which the enzyme is found, the GenBank Accession Number, GI Identification Number, amino acid sequence, and % sequence identity to FutC.
Multiple sequence alignment of the 4 known α(1,2) FTs used for the PSI-BLAST query and 12 newly identified α(1,2) FTs is shown in
To test for lactose-utilizing fucosyltransferase activity, the production of fucosylated oligosaccharides (i.e., 2′-FL) is evaluated in a host organism that expresses the candidate enzyme (i.e., syngene) and which contains both cytoplasmic GDP-fucose and lactose pools. The production of fucosylated oligosaccharides indicates that the candidate enzyme-encoding sequence functions as a lactose-utilizing α(1,2)fucosyltransferase. Of the identified hits, 12 novel α(1,2) fucosyltransferases were further analyzed for their functional capacity to produce 2′-fucosyllactose: Prevotella melaninogenica FutO, Clostridium bolteae FutP, Clostridium bolteae+13 FutP, Lachnospiraceae sp. FutQ, Methanosphaerula palustries FutR, Tannerella sp. FutS, Bacteroides caccae FutU, Butyrivibrio FutV, Prevotellaa sp. FutW, Parabacteroides johnsonii FutX, Akkermansia muciniphilia FutY, Salmonella enterica FutZ, and Bacteroides sp. FutZA.
Syngenes were constructed comprising the 12 novel α(1,2) FTs in the configuration as follows: EcoRI-T7g10 RBS-syngene-XhoI.
The candidate α(1,2) FTs (i.e., syngenes) were cloned by standard molecular biological techniques into an exemplary expression plasmid pEC2-(T7)-Fut syngene-rcsA-thyA. This plasmid utilizes the strong leftwards promoter of bacteriophage λ (termed PL) to direct expression of the candidate genes (Sanger, F. et al. (1982). J Mol Biol 162, 729-773). The promoter is controllable, e.g., a trp-cI construct is stably integrated the into the E. coli host's genome (at the ampC locus), and control is implemented by adding tryptophan to the growth media. Gradual induction of protein expression is accomplished using a temperature sensitive cI repressor. Another similar control strategy (temperature independent expression system) has been described (Mieschendahl et al., 1986, Bio/Technology 4:802-808). The plasmid also carries the E. coli rcsA gene to up-regulate GDP-fucose synthesis, a critical precursor for the synthesis of fucosyl-linked oligosaccharides. In addition, the plasmid carries a β-lactamase (bla) gene for maintaining the plasmid in host strains by ampicillin selection (for convenience in the laboratory) and a native thyA (thymidylate synthase) gene as an alternative means of selection in thyA− hosts.
The expression constructs were transformed into a host strain useful for the production of 2′-FL. The host strain used to test the different α(1,2) FT candidates incorporates all the above genetic modifications described above and has the following genotype: ΔampC::PtrpBcI, A(lacI-lacZ)::FRT, PlacIqlacY+, ΔwcaJ::FRT, thyA::Tn10, Δlon:(npt3, lacZ+), ΔlacA
The E. coli strains harboring the different α(1,2) FT candidate expression plasmids were analyzed. Strains were grown in selective media (lacking thymidine) to early exponential phase. Lactose was then added to a final concentration of 0.5%, and tryptophan (200 μM) was added to induce expression of each candidate α(1,2) FT from the PL promoter. At the end of the induction period (˜24 h) the culture supernatants and cells were harvested. Heat extracts were prepared from whole cells and the equivalent of 0.2OD600 units of each strain analyzed for the presence of 2′-FL by thin layer chromatography (TLC), along with 2 μl of the corresponding clarified culture supernatant for each strain.
Table 4 summarizes the fucosyltransferase activity for each candidate syngene as determined by the 2′FL synthesis screen described above. 11 of the 12 candidate α(1,2) FTs were found to have lactose-utilizing fucosyltransferase activity.
Escherichia coli
Prevotella
melaninogenica
Clostridium bolteae
Lachnospiraceae sp.
Methanosphaerula
palustris
Tannerella sp.
Bacteroides caccae
Butyrivibrio
Prevotella sp.
Parabacteroides
johnsonii
Akkermansia
muciniphilia
Salmonella enterica
Bacteroides sp.
Further characterization of the bacterium expressing novel α(1,2) FTs FutO, FutQ, and FutX was performed. Specifically, proliferation rate and exogenous α(1,2) FT expression was examined.
Expression plasmids containing fucosyltransferases WbgL (plasmid pG204), FutN (plasmid pG217), and novel α(1,2) FTs FutO (plasmid pG393), FutQ (plasmid pG395), and FutX (pG401) were introduced into host bacterial strains. For example, the host strains utilized has the following genotype: ΔampC::PtrpBcI, A(lacI-lacZ)::FRT, PlacIqlacY+, ΔwcaJ::FRT, thyA::Tn10, Δlon:(npt3, lacZ+), ΔlacA
Bacterial cultures expressing each exogenous fucosyltransferase were induced by addition of tryptophan (to induce expression of the exogenous fucosyltransferases) in the presence of lactose. Growth of the cultures was monitored by spectrophotometric readings at A600 at the following timepoints: 4 hours and 1 hour before induction, at the time of induction (time 0), and 3 hours, 7 hours, and 24 hours after induction. The results are shown in
Protein expression was also assessed for the bacterial cultures expressing each fucosyltransferase after induction. Cultures were induced as described previously, and protein lysates were prepared from the bacterial cultures at the time of induction (0 hours), 3 hours, 7 hours, and 24 hours after induction. The protein lysates were run on an SDS-PAGE gel and stained to examine the distribution of proteins at each time point. As shown in
Finally, additional TLC analysis to assess the efficiency and yield of 2′FL production in bacterial cultures expressing novel α(1,2) FTs FutO, FutQ, and FutX compared to known fucosyltransferases WbgL and FutN. Cultures were induced at 7 hours and 24 hours, and run out on TLC.
Fucosylated oligosaccharides produced by metabolically engineered E. coli cells to express B. vulgatus FutN was purified from culture broth post-fermentation.
Fermentation broth was harvested and cells were removed by sedimentation in a preparative centrifuge at 6000×g for 30 min. Each bioreactor run yields about 5-7 L of partially clarified supernatant. A column packed with coarse carbon (Calgon 12×40 TR) of ˜1000 ml volume (dimension 5 cm diameter×60 cm length) was equilibrated with 1 column volume (CV) of water and loaded with clarified culture supernatant at a flow rate of 40 ml/min. This column had a total capacity of about 120 g of sugar. Following loading and sugar capture, the column is washed with 1.5 CV of water, then was eluted with 2.5 CV of 50% ethanol or 25% isopropanol (lower concentrations of ethanol at this step (25-30%) may be sufficient for product elution.) This solvent elution step released about 95% of the total bound sugars on the column and a small portion of color bodies (caramelized sugars). A volume of 2.5 L of ethanol or isopropanol eluate from the capture column was rotary-evaporated at 56 C.° and a sugar syrup in water was generated. A column (GE Healthcare HiScale50/40, 5×40 cm, max pressure 20 bar) connected to a Biotage Isolera One FLASH Chromatography System was packed with 750 ml of a Darco Activated Carbon G60 (100-mesh): Celite 535 (coarse) 1:1 mixture (both column packings were obtained from Sigma). The column was equilibrated with 5 CV of water and loaded with sugar from step 3 (10-50 g, depending on the ratio of 2′-FL to contaminating lactose), using either a celite loading cartridge or direct injection. The column was connected to an evaporative light scattering (ELSD) detector to detect peaks of eluting sugars during the chromatography. A four-step gradient of isopropanol, ethanol or methanol was run in order to separate 2′-FL from monosaccharides (if present), lactose and color bodies. Fractions corresponding to sugar peaks were collected automatically in 120-ml bottles, pooled.
The results from two fermentation runs are shown in
Helicobacter
pylori
pylori]
Helicobacter
mustelae;
Helicobacter
mustelae 12198
mustelae
Bacteroides;
Bacteroides
vulgatus
Bacteroides
vulgatus ATCC
Bacteroides
Bacteroides
vulgatus
Bacteroides
vulgatus
Bacteroides
vulgatus
Bacteroides
vulgatus
coli;
Escherichia
coli]
coli
Helicobacter
bilis;
Helicobacter
bilis
bilis]
Escherichia
coli
coli]
Vibrio
cholerae
cholerae]
Bacteroides
fragilis;
Bacteroides
fragilis
fragilis
Bacteroides
fragilis
Bacteroides
fragilis
Escherichia
coli;
Escherichia
coli]
coli
Prevotella
melaninogenica;
melaninogenica
melaninogenica
Clostridium
bolteae;
Clostridium
bolteae]
bolteae
Clostridium
bolteae
Clostridium
bolteae 90B8
Lachnospiraceae
bacterium
bacterium
Methanosphaerula
palustris;
Methanosphaerula
palustris E1-9c
palustris E1-
Tannerella sp.
Bacteroides
caccae;
Bacteroides
caccae]
Butyrivibrio sp.
Prevotella sp.
Parabacteroides
johnsonii;
Parabacteroides
johnsonii
johnsonii]
Akkermansia
muciniphila;
Akkermansia
muciniphila
muciniphila
Salmonella
enterica;
Salmonella
enterica subsp.
enterica]
enterica
Poona str.
Bacteroides sp.
Clostridium sp.
Prevotella sp.
Prevotella
Brachyspira sp.
Thalassospira
profundimaris;
Thalassospira
profundimaris
profundimaris]
Acetobacter sp.
Dysgonomonas
mossii;
Dysgonomonas
mossii]
mossii
Gillisia
limnaea;
Gillisia
limnaea
limnaea]
Methylotenera
mobilis;
Methylotenera
mobilis JLW8
mobilis JLW8]
Runella
slithyformis;
Runella
slithyformis
slithyformis
Pseudo-
alteromonas
haloplanktis;
Pseudo-
alteromonas
alteromonas
haloplanktis
haloplanktis]
Clostridium sp.
Francisella
philomiragia;
Francisella
philomiragia
philomiragia]
philomiragia
Pseudomonas
fluorescens;
Pseudomonas
fluorescens]
fluorescens
Herbaspirillum
Prevotella
histicola;
Prevotella
histicola]
histicola
Flavobacterium
Polaribacter
franzmannii]
Polaribacter
Methanococcus
maripaludis;
Methanococcus
maripaludis
maripaludis C7]
Gallionella
Azospira
oryzae;
Dechlorosoma
suillum PS
suillum PS]
Prevotella
paludivivens
paludivivens]
Gramella
forsetii;
Gramella
forsetii
forsetii
Mariprofundus
ferrooxydans;
Mariprofundus
ferrooxydans
ferrooxydans]
Bacillus
cereus;
Bacillus
cereus]
cereus VD107
Firmicutes
bacterium
bacterium
Sideroxydans
lithotrophicus;
Sideroxydans
lithotrophicus
lithotrophicus
Pedobacter
heparinus;
Pedobacter
heparinus
heparinus
Methylophilus
methylotrophus]
Rhodobacterales
bacterium
bacterium
Spirulina
subsalsa
subsalsa]
Vibrio
cyclitrophicus
cyclitrophicus]
Lachnospiraceae
bacterium
[
Lachnospiraceae
bacterium
Bacteroides
fragilis;
Bacteroides
fragilis]
fragilis
Butyrivibrio
Bacteroides
ovatus;
Bacteroides
ovatus]
ovatus
Desulfospira
joergensenii
joergensenii]
Lachnospiraceae
bacterium 10-1
bacterium 10-1]
Bacteroides
dorei;
Bacteroides
dorei]
dorei
bacterium
bacterium
Clostridium
hathewayi
hathewayi
Syntrophus
aciditrophicus
aciditrophicus
aciditrophicus
Bacteroides
caccae;
Bacteroides
caccae]
caccae
Butyrivibrio
fibrisolvens
fibrisolvens]
Parabacteroides
distasonis;
Parabacteroides
distasonis
Geobacter
uraniireducens;
Geobacter
uraniireducens
uraniireducens
Lachnospiraceae
bacterium A4
bacterium A4]
Colwellia
psychrerythraea;
Colwellia
psychrerythraea
psychrerythraea
Roseobacter sp.
Cesiribacter
andamanensis;
Cesiribacter
andamanensis
andamanensis]
Rhodopirellula
sallentina;
Rhodopirellula
sallentina
sallentina]
Butyrivibrio
Segetibacter
koreensis
koreensis]
Amphritea
japonica
japonica]
Desulfovibrio
vulgaris;
Desulfovibrio
vulgaris str.
vulgaris str.
Spirosoma
spitsbergense
spitsbergense]
Lachnospiraceae
bacterium 28-4
bacterium 28-
Lachnospiraceae
bacterium COE1
bacterium
Parabacteroides;
Parabacteroides
Parabacteroides
distasonis
Bacteroides sp.
Bacteroides
thetaiotaomicron;
Bacteroides
thetaiotaomicron]
thetaiotaomicron
Desulfovibrio
alaskensis;
Desulfovibrio
alaskensis G20
alaskensis G20]
Prevotella
oralis
oralis CC98A]
Comamonadaceae
bacterium CR
bacterium
Vibrio
nigripulchritudo;
Vibrio
nigripulchritudo]
Vibrio
nigripulchritudo
nigripulchritudo
nigripulchritudo
Sulfurospirillum
deleyianum;
Sulfurospirillum
deleyianum
deleyianum
Escherichia coli;
Escherichia coli
Escherichia coli
coli]
Escherichia coli
Escherichia coli
Escherichia coli
Escherichia coli
Escherichia coli
Escherichia coli
Escherichia coli
Escherichia coli
Escherichia coli
Escherichia coli
Escherichia coli
Escherichia coli
Firmicutes
bacterium
bacterium
Amphritea
japonica
japonica]
Bacteroides
salyersiae;
Bacteroides
salyersiae]
salyersiae
Bacteroides
fragilis;
Bacteroides
fragilis]
fragilis
Bacteroides
fragilis
Bacteroides
nordii;
Bacteroides
nordii]
nordii
Butyrivibrio
proteoclasticus;
Butyrivibrio
proteoclasticus
proteoclasticus
Prevotella
ruminicola;
Prevotella
ruminicola 23
ruminicola 23]
Prevotella
salivae;
Prevotella
salivae]
salivae
Lachnospiraceae
bacterium COE1
bacterium
Bacteroides
dorei;
Bacteroides
dorei
dorei]
Roseobacter sp.
Helicobacter
bilis;
Helicobacter
bilis]
bilis
Ralstonia sp.
Bacteroides
ovatus;
Bacteroides
ovatus]
ovatus
Loktanella
vestfoldensis
vestfoldensis]
Flavobacterium
Bacteroides
fragilis;
Bacteroides
fragilis
fragilis]
Spirosoma
panaciterrae
panaciterrae]
synechococcus
elongatus;
Thermo-
synechococcus
synechococcus
elongatus
elongatus
Colwellia
piezophila
piezophila]
Prevotella
maculosa
maculosa]
Salmonella
enterica;
Salmonella
enterica subsp.
enterica subsp.
enterica serovar
enterica serovar
Worthington str.
Cubana str.
enterica subsp.
enterica serovar
Cubana str.
Salmonella
enterica subsp.
enterica serovar
Cubana str.
Salmonella
enterica subsp.
enterica serovar
Cubana str.
Bacteroides sp.
Clostridium sp.
Rhodopirellula
europaea;
Rhodopirellula
europaea SH398
europaea]
Bacillus
cereus; Bacillus
cereus AH1271
cereus]
Firmicutes
bacterium
bacterium
Prevotella oris;
Prevotella oris
oris]
coli
coli]
Leeia oryzae
oryzae]
Desulfovibrio
africanus;
Desulfovibrio
africanus PCS
africanus]
Akkermansia
muciniphila
muciniphila
Dysgonomonas
mossii;
Dysgonomonas
mossii]
mossii
Prevotella
oris;
Prevotella
oris
oris]
Pseudogul-
benkiania
ferrooxidans
Pseudogul-
benkiania
benkiania
ferrooxidans]
ferrooxidans
Salmonella
enterica
enterica]
Carnobacterium
Prevotella sp.
Selenomonas sp.
Bacteroides
nordii;
Bacteroides
nordii]
nordii
Parabacteroides
merdae;
Parabacteroides
merdae]
merdae ATCC
Parabacteroides
merdae
Butyrivibrio sp.
Bacteroides
ovatus;
Bacteroides
ovatus]
ovatus
Bacteroides
ovatus
Mesotoga prima
Mesotoga prima
prima
Clostridium sp.
Bacteroides
plebeius
plebeius
Treponema
lecithinolyticum;
Treponema
lecithinolyticum
lecithinolyticum]
Bacteroides
eggerthii;
Bacteroides
eggerthii
eggerthii]
Bacteroides
stercoris;
Bacteroides
stercoris
stercoris]
Butyrivibrio
proteoclasticus;
Butyrivibrio
proteoclasticus
proteoclasticus
Roseobacter sp.
Thalassobacter
arenae;
Thalassobacter
arenae
arenae]
Prevotella
oris; Prevotella
oris C735
oris]
Prevotella
oulorum;
Prevotella
oulorum]
oulorum F0390
Spirosoma
panaciterrae
panaciterrae]
Butyrivibrio
proteoclasticus;
Butyrivibrio
proteoclasticus
proteoclasticus
Butyrivibrio sp.
Bacteroides sp.
Bacteroides
fragilis;
Bacteroides
fragilis
fragilis
Bacteroides sp.
Coraliomargarita
Pseudorhodobacter
ferrugineus
rhodobacter
ferrugineus]
Escherichia coli;
Escherichia coli
coli O127:
Lachnospiraceae
bacterium
bacterium
Butyrivibrio
fibrisolvens
fibrisolvens]
Anaeromusa
acidaminophila
acidaminophila]
Bacteroides sp.
Chlorobium
phaeobacteroides;
Chlorobium
phaeobacteroides
phaeobacteroides
Treponema
bryantii
bryantii]
Bacteroides
fragilis;
Bacteroides
fragilis 638R
fragilis 638R]
Firmicutes
bacterium
bacterium
Firmicutes
bacterium
bacterium
parahaemolyticus;
Vibrio
parahaemolyticus
parahaemo-
parahaemolyticus
lyticus]
parahaemolyticus
parahaemolyticus
Herbaspirillum
frisingense;
Herbaspirillum
frisingense
frisingense]
Rhizobium sp.
Verrucomicrobium
spinosum
spinosum]
Fibrella
aestuarina;
Fibrella
aestuarina
aestuarina
Rhodobacter sp.
Rhodopirellula
baltica
Rhodopirellula
baltica SH 1]
baltica
Spirosoma
spitsbergense
spitsbergense]
Prevotella
micans;
Prevotella
micans]
micans F0438
Thermo-
synechococcus
synechococcus
Coleofasciculus
chthonoplastes;
Coleofasciculus
chthonoplastes
chthonoplastes]
Bacteroides
gallinarum]
Firmicutes
bacterium
bacterium
Bacteroides
xylanisolvens;
Bacteroides
xylanisolvens]
xylanisolvens
Geobacter sp.
Ruegeria
pomeroyi
pomeroyi
Lachnospiraceae
bacterium 28-4
bacterium 28-
Prevotella sp.
Spirosoma luteum
luteum]
Marinomonas
posidonica
Marinomonas
posidonica
posidonica
Bacteroides;
Bacteroides sp.
Bacteroides sp.
Bacteroides
dorei
Bacteroides
vulgatus
Bacteroides
dorei
Bacteroides
vulgatus dnLKV7
Candidatus
Pelagibacter
ubique
Pelagibacter
ubique]
Bacteroides sp.
Butyrivibrio
fibrisolvens
fibrisolvens]
Roseburia
hominis;
Roseburia
hominis
hominis A2-183]
Rhodopirellula
europaea;
Rhodopirellula
europaea 6C
europaea]
Rudanella lutea
lutea]
Bacteroidetes;
Capnocytophaga
Paraprevotella
clara YIT 11840
Smaragdicoccus
niigatensis
niigatensis]
Bacteroides
fragilis
fragilis
Desulfovibrio
desulfuricans
desulfuricans]
Hoeflea
phototrophica;
Hoeflea
phototrophica
phototrophica]
Vibrio cholerae;
Vibrio cholerae
cholerae]
Lachnospiraceae
bacterium
bacterium
Cecembia
lonarensis;
Cecembia
lonarensis
lonarensis]
Bacteroides
ovatus;
Bacteroides
ovatus]
Bacteroides
coprocola
coprocola
Bacteroides
dorei;
Bacteroides
dorei DSM
dorei]
Bacteroides
dorei
Bacteroides;
Bacteroides
intestinalis
Bacteroides
intestinalis
Lachnospiraceae
bacterium A4
bacterium A4]
Phaeobacter
gallaeciensis;
Phaeobacter
gallaeciensis
gallaeciensis
Firmicutes
bacterium
bacterium
Butyrivibrio
proteoclasticus;
Butyrivibrio
proteoclasticus
proteoclasticus
Bacteroides sp.
Desulfomicrobium
baculatum;
Desulfomicrobium
baculatum
baculatum
Prevotella
pleuritidis;
Prevotella
pleuritidis
pleuritidis]
Bacteroides sp.
Agromyces
subbeticus
subbeticus]
Prevotella
salivae;
Prevotella
salivae
salivae]
Carnobacterium
Butyrivibrio sp.
Clostridium sp.
Bacteroides;
Bacteroides
vulgatus
Bacteroides
vulgatus ATCC
dorei DSM
Bacteroides
massiliensis
Paraprevotella
xylaniphila;
Paraprevotella
xylaniphila
xylaniphila]
Thauera sp. 28
Subdoligranulum
variabile;
Subdoligranulum
variabile
variabile]
Firmicutes
bacterium
bacterium
Prevotella sp.
Roseburia
intestinalis]MRGNRGMIAVKIGDGMGNQLFNYACGYAQARRDGDSLVLDISECDNSTLRDFELDKFHL
intestinalis;
Roseburia
intestinalis]
Bacteroides
ovatus;
Bacteroides
ovatus]
ovatus
Butyrivibrio sp.
Butyrivibrio
proteoclasticus;
Butyrivibrio
proteoclasticus
proteoclasticus
Prevotella
nanceiensis
nanceiensis]
Ruegeria sp. R11
Winogradskyella
psychrotolerans
Winogradskyella
psychrotolerans
skyella
psychro-
tolerans]
Lachnospiraceae
bacterium
bacterium
Prevotella sp.
Prevotella
Butyrivibrio sp.
Butyrivibrio
fibrisolvens
fibrisolvens]
Cylindro-
spermopsis
raciborskii;
Cylindro-
spermopsis
spermopsis
raciborskii
raciborskii]
Prevotella
multiformis;
Prevotella
multiformis
multiformis]
Desulfovibrio
africanus;
Desulfovibrio
africanus PCS
africanus]
Roseburia sp.
Lachnospiraceae
bacterium 10-1
bacterium 10-1]
Prevotella
nigrescens;
Prevotella
nigrescens]
nigrescens
Bacteroides sp.
Prevotella sp.
Prevotella
Paraprevotella
xylaniphila;
Paraprevotella
xylaniphila
xylaniphila]
Dethio-
sulfovibrio
peptidovorans;
Dethio-
sulfovibrio
sulfovibrio
peptidovorans
peptidovorans]
Lachnospiraceae
bacterium 10-1
bacterium 10-1]
Treponema
maltophilum;
Treponema
maltophilum]
maltophilum
Bacteroides
massiliensis;
Bacteroides
massiliensis]
massiliensis
faecium;
Enterococcus
faecium
faecium DO]
Enterococcus
faecium
Bacteroides;
Bacteroides sp.
Bacteroides sp.
Bacteroides
Bacteroides
xylanisolvens
Bacteroides
xylanisolvens
Bacteroides
ovatus CAG: 22
Synechococcus
Geobacter
metallireducens;
Geobacter
metallireducens
metallireducens
Geobacter
metallireducens
Lachnospiraceae
bacterium
bacterium
Bacteroides
coprophilus;
Bacteroides
coprophilus]
coprophilus DSM
Bacteroidetes;
Capnocytophaga
Paraprevotella
clara
Butyrivibrio sp.
Paraprevotella
xylaniphila;
Paraprevotella
xylaniphila
xylaniphila]
Blautia
hydrogenotrophica
Blautia
hydrogenotrophica
Geobacter
lovleyi;
Geobacter
lovleyi SZ]
Lachnospiraceae
bacterium
bacterium
Bacteroides
vulgatus;
Bacteroides
vulgatus
vulgatus]
Planctomyces
brasiliensis;
Planctomyces
brasiliensis
brasiliensis
Butyrivibrio sp.
Roseovarius
nubinhibens
Roseovarius
nubinhibens
nubinhibens]
Providencia
alcalifaciens
alcalifaciens]
Salmonella
enterica
enterica]
Sulfurospirillum
deleyianum;
Sulfurospirillum
deleyianum
spirillum
deleyianum
Pseudovibrio
Prevotella sp.
Prevotella
Butyrivibrio
fibrisolvens
fibrisolvens]
Lewinella
persica]
While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
The patent and scientific literature referred to herein establishes the knowledge that is available to those with skill in the art. All United States patents and published or unpublished United States patent applications cited herein are incorporated by reference. All published foreign patents and patent applications cited herein are hereby incorporated by reference. Genbank and NCBI submissions indicated by accession number cited herein are hereby incorporated by reference. All other published references, documents, manuscripts and scientific literature cited herein are hereby incorporated by reference.
While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.
This application is a continuation of U.S. patent application Ser. No. 15/307,914 filed Oct. 31, 2016, now U.S. Pat. No. 11,046,984 issued on Jun. 29, 2021, which is a national stage application, filed under 35 U.S.C. § 371, of PCT International Patent Application No. PCT/US2015/030823, filed on May 14, 2015, and claims benefit of priority to U.S. Provisional Patent Application No. 61/993,742, filed on May 15, 2014, both of which, including their contents, are incorporated herein by reference in their entireties.
| Number | Name | Date | Kind |
|---|---|---|---|
| 7521212 | Samain | Apr 2009 | B1 |
| 9029136 | Heidtman et al. | May 2015 | B2 |
| 9453230 | Merighi et al. | Sep 2016 | B2 |
| 9587241 | Merighi et al. | Mar 2017 | B2 |
| 9970018 | Merighi et al. | May 2018 | B2 |
| 11046984 | McCoy et al. | Jun 2021 | B2 |
| 20100120701 | McCoy et al. | May 2010 | A1 |
| 20120208181 | Merighi et al. | Aug 2012 | A1 |
| 20140031541 | Heidtman et al. | Jan 2014 | A1 |
| 20170081353 | McCoy et al. | Mar 2017 | A1 |
| Number | Date | Country |
|---|---|---|
| 103328630 | Sep 2013 | CN |
| 3083938 | Oct 2016 | EP |
| 2014-506474 | Mar 2014 | JP |
| 2014018596 | Jan 2014 | WO |
| 2015150328 | Aug 2015 | WO |
| Entry |
|---|
| Engles et al., WbgL: a novel bacterial α1,2-fucosyltransferase for the synthesis of 2′-fucosyllactose, Glycobiology 24, 2014, 170-78. (Year: 2014). |
| Uniprot, Accession No. R7LF73, 2014, www.uniprot.org. (Year: 2014). |
| Database Genbank, (2013) “Hypothetical Protein HMPREF0994_01394 [Lachnospiraceae Bacterium 3_1_57FAA_CT1]”, GenBank Accession No. EGN42256.1, 2 pages. |
| Database Genbank, (2013) “Hypothetical Protein HMPREF1097_05434 [Enterocloster Bolteae 90B8]”, GenBank Accession No. ENZ32021.1, 2 pages. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella salivae]”, GenBank Accession No. WP_007135533.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides dorei]”, GenBank Accession No. WP_007842931.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Roseobacter sp. SK209-2-6]”, GenBank Accession No. WP_008210047.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [alpha proteobacterium SCGC AAA076-CO3]”, GenBank Accession No. WP_020056701.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Helicobacter bilis]”, GenBank Accession No. WP_004087499.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Cupriavidus sp. GA3-3]”, GenBank Accession No. WP_010813809.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides ovatus]”, GenBank Accession No. WP_004303999.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Yoonia vestfoldensis]”, GenBank Accession No. WP_019955906.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Flavobacterium sp. ACAM 123]”, GenBank Accession No. WP_016991189.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides fragilis]”, GenBank Accession No. WP_005779407.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Spirosoma panaciterrae]”, GenBank Accession No. WP_020598002.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Colwellia piezophila]”, GenBank Accession No. WP_019028421.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella maculosa]”, GenBank Accession No. WP_019966794.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Clostridium sp. CAG:510] ”, GenBank Accession No. WP_022124550.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Rhodopirellula europaea]”, GenBank Accession No. WP_008665459.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacillus cereus]”, GenBank Accession No. WP_000587678.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Firmicutes bacterium CAG:95]”, GenBank Accession No. WP_022499937.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella oris]”, GenBank Accession No. WP_004374901.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Desulfovibrio africanus] ”, GenBank Accession No. WP_005984173.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Akkermansia muciniphila CAG:154]”, GenBank Accession No. WP_022196965.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Dysgonomonas mossii]”, GenBank Accession No. WP_006843524.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella oris]”, GenBank Accession No. WP_004372410.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Pseudogulbenkiania ferrooxidans]”, GenBank Accession No. WP_008952440.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Salmonella enterica]”, GenBank Accession No. WP_000286641.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella sp. CAG:1185] ”, GenBank Accession No. WP_021964668.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Selenomonas sp. CM52]”, GenBank Accession No. WP_009645343.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides nordii]”, GenBank Accession No. WP_007486621.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Parabacteroides merdae]”, GenBank Accession No. WP_005635503.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Butyrivibrio sp. NC2007]”, GenBank Accession No. WP_022768139.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides ovatus]”, GenBank Accession No. WP_004302233.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Clostridium sp. KLE 1755]”, GenBank Accession No. WP_021639228.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides plebeius CAG:211]”, GenBank Accession No. WP_022052991.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Treponema lecithinolyticum]”, GenBank Accession No. WP_021686002.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides eggerthii]”, GenBank Accession No. WP_004291980.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides stercoris]”, GenBank Accession No. WP_005656005.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Roseobacter sp. GAI101]”, GenBank Accession No. WP_008228724.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella oris]”, GenBank Accession No. WP_004377401.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella oulorum]”, GenBank Accession No. WP_004380180.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Spirosoma panaciterrae]”, GenBank Accession No. WP_020596174.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Butyrivibrio sp. XPD2006]”, GenBank Accession No. WP_022765786.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Coraliomargarita sp. CAG:312]”, GenBank Accession No. WP_022477844.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Pseudorhodobacter ferrugineus]”, GenBank Accession No. WP_022705649.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Anaeromusa acidaminophila]”, GenBank Accession No. WP_018702959.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Treponema bryantii]”, GenBank Accession No. WP_022932606.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Firmicutes bacterium CAG:534]”, GenBank Accession No. WP_022352105.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Firmicutes bacterium CAG:882]”, GenBank Accession No. WP_022368748.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Vibrio parahaemolyticus]”, GenBank Accession No. WP_005496882.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Herbaspirillum frisingense]”, GenBank Accession No. WP_006463714.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Rhizobium sp. CF080]”, GenBank Accession No. WP_007759661.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Verrucomicrobium spinosum]”, GenBank Accession No. WP_009959380.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Rhodobacter sp. CACIA14H1]”, GenBank Accession No. WP_023665745.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Spirosoma spitsbergense]”, GenBank Accession No. WP_020604054.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella micans]”, GenBank Accession No. WP_006950883.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Coleofasciculus chthonoplastes]”, GenBank Accession No. WP_006100814.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides gallinarum]”, GenBank Accession No. WP_018666797.1. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Firmicutes bacterium CAG:882]”, GenBank Accession No. WP_022367483.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides xylanisolvens]”, GenBank Accession No. WP_008021494.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Lachnospiraceae bacterium 28-4]”, GenBank Accession No. WP_016291997.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella sp. CAG:1092]”, GenBank Accession No. WP_021989703.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Spirosoma luteum]”, GenBank Accession No. WP_018618567.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Candidatus Pelagibacter ubique]”, GenBank Accession No. WP_020169431.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides sp. CAG:875]”, GenBank Accession No. WP_022353174.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Butyrivibrio fibrisolvens]”, GenBank Accession No. WP_022756327.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Rhodopirellula europaea]”, GenBank Accession No. WP_008659200.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Rudanella lutea]”, GenBank Accession No. WP_019988573.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Paraprevotella clara]”, GenBank Accession No. WP_008618094.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Smaragdicoccus niigatensis]”, GenBank Accession No. WP_018159152.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides fragilis CAG:558]”, GenBank Accession No. WP_022012576.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Desulfovibrio desulfuricans]”, GenBank Accession No. WP_022657592.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Hoeflea phototrophica]”, GenBank Accession No. WP_007199917.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Lachnospiraceae bacterium NK4A179]”, GenBank Accession No. WP_022784718.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Cecembia lonarensis]”, GenBank Accession No. WP_009185692.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides coprocola GAG:162]”, GenBank Accession No. WP_022125287.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides intestinalis]”, GenBank Accession No. WP_007662951.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Lachnospiraceae bacterium A4]”, GenBank Accession No. WP_016283022.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella pleuritidis]”, GenBank Accession No. WP_021584236.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides sp. 1_1_14]”, GenBank Accession No. WP_008763191.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Agromyces subbeticus]”, GenBank Accession No. WP_022893737.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella salivae]”, GenBank Accession No. WP_007133870.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Paraprevotella xylaniphila]”, GenBank Accession No. WP_008626629.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Thauera sp. 28]”, GenBank Accession No. WP_002930798.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Subdoligranulum variabile]”, GenBank Accession No. WP_007048308.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Firmicutes bacterium CAG:24]”, GenBank Accession No. WP_021916223.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella sp. CAG:474]”, GenBank Accession No. WP_022310139.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Roseburia intestinalis]”, GenBank Accession No. WP_006855899.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Butyrivibrio sp. AE3009]”, GenBank Accession No. WP_022779599.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella nanceiensis]”, GenBank Accession No. WP_018362656.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Winogradskyella psychrotolerans]”, GenBank Accession No. WP_020895733.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Lachnospiraceae bacterium NK4A179]”, GenBank Accession No. WP_022785342.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella sp. oral taxon 317]”, GenBank Accession No. WP_009230832.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Butyrivibrio sp. XPD2006]”, GenBank Accession No. WP_022765796.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Butyrivibrio fibrisolvens]”, GenBank Accession No. WP_022752717.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Cylindrospermopsis raciborskii]”, GenBank Accession No. WP_006278973.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella multiformis]”, GenBank Accession No. WP_007368154.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides sp. CAG:462]”, GenBank Accession No. WP_022384635.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Roseburia sp. CAG:100]”, GenBank Accession No. WP_022518697.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Lachnospiraceae bacterium 10-1]”, GenBank Accession No. WP_022742385.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella nigrescens]”, GenBank Accession No. WP_004362670.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides sp. CAG:875]”, GenBank Accession No. WP_022353235.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Paraprevotella xylaniphila]”, GenBank Accession No. WP_008628783.1, 1 page. |
| Han et al., “Biotechnological production of human milk oligosaccharides”. Biotechnol Adv. Nov.-Dec. 2012;30(6):1268-78. |
| Kajiwara et al., “Isolation of fucosyltransferase-producing bacteria from marine environments”. Microbes Environ. 2012;27(4):515-8. |
| Lee et al., “Whole cell biosynthesis of a functional oligosaccharide, 2′-fucosyllactose, using engineered Escherichia coli”. Microb Cell Fact. Apr. 30, 2012;11:48. |
| UniParc Accession No. UPI00000BD7C3, 1999. |
| UniParc Accession No. UPI000156E7D1, 2007. |
| UniParc Accession No. UPI00017402F0, 2008. |
| UniParc Accession No. UPI0001848D3F, 2008. |
| UniParc Accession No. UPI0002135809, 2011. |
| UniParc Accession No. UPI0002D1E562, 2013. |
| UniParc Accession No. UPI000335587F, 2013. |
| Albermann et al., “Synthesis of the milk oligosaccharide 2′-fucosyllactose using recombinant bacterial enzymes”. Carbohydr Res. Aug. 23, 2001;334(2):97-103. |
| Altschul et al., “Basic local alignment search tool”. J Mol Biol. Oct. 5, 1990;215(3):403-10. |
| Altschul et al., “Gapped BLAST and PSI-BLAST: a new generation of protein database search programs”. Nucleic Acids Res. Sep. 1, 1997;25(17):3389-402. |
| Amonsen et al., “Human parainfluenza viruses hPIV1 and hPIV3 bind oligosaccharides with alpha2-3-linked sialic acids that are distinct from those bound by H5 avian influenza virus hemagglutinin”. J Virol. Aug. 2007;81(15):8341-5. |
| Bachmann, B. “Pedigrees of some mutant strains of Escherichia coli K-12”. Bacteriol Rev. Dec. 1972;36(4):525-57. |
| Belfort et al., “Characterization of the Escherichia coli thyA gene and its amplified thymidylate synthetase product”. Proc Natl Acad Sci U S A. Apr. 1983;80(7):1858-61. |
| Bettler et al., “The living factory: in vivo production of N-acetyllactosamine containing carbohydrates in E. coli”. Glycoconj J. Mar. 1999;16(3):205-12. |
| Bode, L. “Recent advances on structure, metabolism, and function of human milk; oligosaccharides”. J Nutr. Aug. 2006;136(8):2127-30. |
| Charlwood et al., “A detailed analysis of neutral and acidic carbohydrates in human milk”. Anal Biochem. Sep. 10, 1999;273(2):261-77. |
| Chaturvedi et al., “Fucosylated human milk oligosaccharides vary between individuals and over the course of lactation”. Glycobiology. May 2001;11(5):365-72. |
| Chaturvedi et al., “Survival of human milk oligosaccharides in the intestine of infants”. Adv Exp Med Biol. 2001;501:315-23. |
| Couceiro et al., “Influenza virus strains selectively recognize sialyloligosaccharides on human respiratory epithelium; the role of the host cell in selection of hemagglutinin receptor specificity”. Virus Res. Aug. 1993;29(2):155-65. |
| Court et al., “Genetic engineering using homologous recombination”. Annu Rev Genet. 2002;36:361-88. |
| Crout et al., “Glycosidases and glycosyl transferases in glycoside and oligosaccharide synthesis”. Curr Opin Chem Biol. Feb. 1998;2(1):98-111. |
| Danchin, A. “Cells need safety valves”. Bioessays. Jul. 2009;31(7):769-73. |
| Drouillard et al., “Large-scale synthesis of H-antigen oligosaccharides by expressing Helicobacter pylori alpha1,2-fucosyltransferase in metabolically engineered Escherichia coli cells”. Angew Chem Int Ed Engl. Mar. 3, 2006;45(11):1778-80. |
| Dumon et al., “Assessment of the two Helicobacter pylori alpha-1,3 fucosyltransferase ortholog genes for the large-scale synthesis of LewisX human milk oligosaccharides by metabolically engineered Escherichia coli”. Biotechnol Prog. Mar.-Apr. 2004;20(2):412-9. |
| Dumon et al., “In vivo fucosylation of lacto-N-neotetraose and lacto-N-neohexaose by heterologous; expression of Helicobacter pylori alpha-1,3 fucosyltransferase in engineered Escherichia coli”. Glycoconj J. Jun. 2001;18(6):465-74. |
| Dumon et al., “Production of Lewis x tetrasaccharides by metabolically engineered Escherichia coli”. Chembiochem. Feb. 2006;7(2):359-65. |
| Endo et al., “Large-scale production of CMP-NeuAc and sialylated oligosaccharides through bacterial coupling”. Appl Microbiol Biotechnol. Mar. 2000;53(3):257-61. |
| Endo et al., “Large-scale production of N-acetyllactosamine through bacterial coupling”. Carbohydr Res. Mar. 31, 1999;316(1-4):179-83. |
| Endo et al., “Large-scale production of oligosaccharides using engineered; bacteria”. Curr Opin Struct Biol. Oct. 2000;10(5):536-41. |
| Endo et al., “Large-scale production of the carbohydrate portion of the sialyl-Tn epitope, alpha-Neup5Ac-(2->6)-D-GalpNAc, through bacterial coupling”. Carbohydr Res. Feb. 28, 2001;330(4):439-43. |
| Flowers H. “Chemical synthesis of oligosaccharides”. Methods Enzymol. 1978;50:93-121. |
| Gottesman et al., “Regulation of capsular polysaccharide synthesis in Escherichia coli K12”. Mol Microbiol. Jul. 1991;5(7):1599-606. |
| Hamosh M. “Bioactive factors in human milk”. Pediatr Clin North Am. Feb. 2001;48(1):69-86. |
| Johnson K. “Synthesis of oligosaccharides by bacterial enzymes”. Glycoconj J. Feb. 1999;16(2):141-6. |
| Koeller et al., “Synthesis of complex carbohydrates and glycoconjugates: enzyme-based and programmable one-pot strategies”. Chem Rev. Dec. 13, 2000;100(12):4465-94. |
| Koizumi et al., “Large-scale production of UDP-galactose and globotriose by coupling metabolically engineered bacteria”. Nat Biotechnol. Sep. 1998;16(9):847-50. |
| Kuhlenschmidt et al., “Sialic acid dependence and independence of group A rotaviruses”. Adv Exp Med Biol. 1999;473:309-17. |
| Kunz et al. “Oligosaccharides in Human Milk: Structural, Functional, and Metabolic Aspects”. Annu. Rev. Nutr. 2000;20:699-722. |
| LaVallie et al., “A thioredoxin gene fusion expression system that circumvents inclusion body; formation in the E. coli cytoplasm”. Biotechnology (N Y). Feb. 1993;11(2):187-93. |
| LaVallie et al., “Thioredoxin as a fusion partner for production of soluble recombinant proteins in Escherichia coli”. Methods Enzymol. 2000;326:322-40. |
| Li et al., “Characterization of a novel alpha 1,2-fucosyltransferase of Escherichia coli; O128:b12 and functional investigation of its common motif”. Biochemistry. Jan. 2008; 8;47(1):378-87. |
| Mahdavi et al., “Helicobacter pylori SabA adhesin in persistent infection and chronic inflammation”. Science. Jul. 26, 2002;297(5581):573-8. |
| Marcobal et al., “Consumption of human milk oligosaccharides by gut-related microbes”. J Agric Food Chem. May 12, 2010;58(9):5334-40. |
| Martin-Sosa et al., “Sialyloligosaccharides in human and bovine milk and in infant formulas: variations with the progression of lactation”. J Dairy Sci. Jan. 2003;86(1):52-9. |
| Mieschendahl et al., “A Novel Prophage Independent TRP Regulated Lambda PL Expression System”. Bio/Technology. 1986;4:802-8. |
| Morrow et al., “Human milk oligosaccharides are associated with protection against diarrhea in breast-fed infants”. J Pediatr. Sep. 2004,145(3):297-303. |
| Newburg, D. “Bioactive components of human milk: evolution, efficiency, and; protection”. Adv Exp Med Biol. 2001;501:3-10. |
| Newburg, D. “Human milk glycoconjugates that inhibit pathogens”. Curr Med Chem. Feb. 1999;6(2):117-27. |
| Newburg et al. “Human Milk Glycans Protect Infants Against Enteric Pathogens”. Annu. Rev. Nutr. 2005;25:37-58. |
| Newburg et al., “Innate protection conferred by fucosylated oligosaccharides of human milk against diarrhea in breastfed infants”. Glycobiology. Mar. 2004;14(3):253-63. |
| Newburg et al., “Protection of the neonate by the innate immune system of developing gut and of human milk”. Pediatr Res. Jan. 2007;61(1):2-8. |
| Newburg et al., “Role of human-milk lactadherin in protection against symptomatic rotavirus infection”. Lancet. Apr. 18, 1998;351(9110):1160-4. |
| Ninoneuvo et al., “A strategy for annotating the human milk glycome”. J Agric Food Chem. Oct. 4, 2006,54(20):7471-80. |
| Palcic, M. “Biocatalytic synthesis of oligosaccharides”. Curr Opin Biotechnol.; Dec. 1999;10(6):616-24. |
| Parkkinen et al. “Isolation of Sialyl Oligosaccharides and Sialyl Oligosaccharide Phosphates From Bovine Colostrum and Human Urine”. Methods Enzymol. 1987;138:289-300. |
| Rabbani et al., “Molecular cloning and functional expression of a novel Helicobacter pylori alpha-1,4 fucosyltransferase”. Glycobiology. Nov. 2005; 15(11):1076-83. |
| Rasko et al., “Cloning and characterization of the alpha(1,¾) fucosyltransferase of Helicobacter pylori”. J Biol Chem. Feb. 18, 2000;275(7):4988-94. |
| Ruffing et al., “Metabolic engineering of microbes for oligosaccharide and polysaccharide synthesis”. Microb Cell Fact Jul. 21, 2006;5:25. |
| Ruiz-Palacios et al., “Campylobacter jejuni binds intestinal H(O) antigen (Fuc alpha 1, 2Gal beta 1, 4GlcNAc), and fucosyloligosaccharides of human milk inhibit its binding and infection”. J Biol Chem. Apr. 18, 2003;278(16):14112-20. |
| Rydell et al., “Human noroviruses recognize sialyl Lewis x neoglycoprotein”. Glycobiology. Mar. 2009;19(3):309-20. |
| Sager et al., “Nucleotide sequence of bacteriophage lambda DNA”. J Mol Biol. Dec. 25, 1982;162(4)729-73. |
| Scharfman et al., “Sialyl-Le(x) and sulfo-sialyl-Le(x) determinants are receptors for P. aeruginosa”. Glycoconj J. Oct. 2000;17(10):735-40. |
| Seeberger, P. “Automated carbohydrate synthesis to drive chemical glycomics”. Chem Commun (Camb). May 21, 2003;(10):1115-21. |
| Shen et al., “Resolution of structural isomers of sialylated oligosaccharides by capillary electrophoresis”. J Chromatogr A. Jul. 6, 2001;921(2):315-21. |
| Stein et al., “Cloning genes for proline biosynthesis from Neisseria gonorrhoeae: identification by interspecific complementation of Escherichia coli mutants”. J Bacteriol. May 1984;158(2):696-700. |
| Stevenson et al., “Organization of the Escherichia coli K-12 gene cluster responsible for production of the extracellular polysaccharide colanic acid” J Bacteriol. Aug. 1996;178(16):4885-93. |
| Wolfe et al., “Nucleotide sequence and analysis of the purA gene encoding; adenylosuccinate synthetase of Escherichia coli K12”. J Biol Chem. Dec. 1988; 15;263(35):19147-53. |
| Wymer et al., “Enzyme-catalyzed synthesis of carbohydrates”. Curr Opin Chem Biol. Feb. 2000;4(1):110-9. |
| Genbank (Dec. 11, 2013) “Glycosyl Transferase Family 11 [Akkermansia Muciniphila ATCC BAA-835]”, Accession No. ACD04774.1, 1 page. |
| Genbank (May 31, 2013) “Glycosyl Transferase Family 11 [Tannerella Sp. CAG:118]”, Accession No. CCY38847.1, 1 page. |
| Genbank (May 31, 2013) “Glycosyltransferase Family 11 [Bacteroides Sp. CAG:633]”, Accession No. CDB11986.1, 1 page. |
| Genbank (Apr. 19, 2013) “Hypothetical Protein HMPREF1097_05434 [[Clostridium] Bolteae 90B8]”, Accsession No. ENZ32021.1, 2 pages. |
| Genbank (May 31, 2013) “Uncharacterized Protein BN805_01914 [Prevotella Sp. CAG:891]”, Accession No. CDE87265.1, 1 page. |
| Kobata et al. (1978) “Oligosaccharides from Human Milk”, Methods in Enzymology, 50:216-220. |
| Uniprot (Apr. 16, 2014) “Akkermans is Muciniphila (Strain ATCC BAA-835)”, Uniprot Accession No. B2UQN9, 1 page. |
| Uniprot (Apr. 16, 2014) “Bacteroides caccae ATCC 43185.”, Uniprot Accession No. A5ZC72, 1 page. |
| Uniprot (Apr. 16, 2014) “Bacteroides sp. CAG:633.”, Uniprot Accession No. R6FSMO, 1 page. |
| Uniprot, “Lachnospiraceae Bacterium 3_1_57FAA_CT1.”, Uniprot Accession No. F7K6A6, 1 page. |
| Uniprot (Apr. 16, 2014) “Parabacteroides Johnsonii CL02T12C29.”, Uniprot Accession No. K5YCP4, 1 page. |
| Uniprot (Apr. 16, 2014) “Prevotella sp. CAG:891.”, Uniprot Accession No. R7LF73, 1 page. |
| Uniprot (Apr. 16, 2014) “Tannerella sp. CAG:118.”, Uniprot Accession No. R5IPH9, 1 page. |
| Uniprot (Apr. 16, 2014), Accession No. B8GDY9 “Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c).” Uniprot Accession No. B8GDY9, 1 page. |
| Baumgartner et al., “Synthesis of fucosylated lacto-N-tetraose using whole cell biotransformation”, Bioorg. & Medicinal Chem., Oct. 2015, 23, 6799-806. |
| Engles et al., “WbgL: a novel bacterial a1,2-fucosyltransferase for the synthesis of 2′-fucosyllactose”, Glyobiology, Nov. 2013, 24, 170-78. |
| Guo et al., “Protein tolerance to random amino acid change”, Proc. Natl. Acad. Sci. USA, 2004,101, 9205-10. |
| Jung et al., “Production of 3-Fucosyllactose in Engineered Escherichia coli with a-1,3-Fucosyltransferase from Helicobacter pylori”, Biotechnol. J., 2019, 14, 1800498. |
| Kobata, “Isolation of oligosaccharides from human milk”, Methods Enz., 1972, 28, 262-71. |
| Martin et al. , “Lewis X biosynthesis in Helicobacer pylori”, J. Biol. Chem., 1997, 272, 21349-56. |
| Sigma-Aldrich, Prod. No. G5653, 1997. |
| Uniprot Accession No. A6M9C2, www.uniprot.org. |
| Uniprot Accession No. B8GDY9, 2013, www.uniprot.org. |
| Uniprot Accession No. D9RUY6, 2014, www.uniprot.org. |
| Uniprot (Apr. 16, 2014) “Clostridium bolteae 90B8”, Uniprot Accession No. N9YWN5, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Dethiosulfovibrio peptidovorans]”, GenBank Accession No. WP_005658864.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Lachnospiraceae bacterium 10-1]”, GenBank Accession No. WP_016229292.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Treponema maltophilum]”, GenBank Accession No. WP_016525279.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Lachnospiraceae bacterium NK4A136]”, GenBank Accession No. WP_022780989.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides coprophilus]”, GenBank Accession No. WP 008144634.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Paraprevotella clara]”, GenBank Accession No. WP_008619736.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Butyrivibrio sp. NC2007]”, GenBank Accession No. WP_022770361.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Paraprevotella xylaniphila]”, GenBank Accession No. WP_008628536.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Blautia hydrogenotrophica]”, GenBank Accession No. WP_005944761.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Lachnospiraceae bacterium NK4A136]”, GenBank Accession No. WP_022781176.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides vulgatus]”, GenBank Accession No. WP_005840359.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Butyrivibrio sp. AE2015]”, GenBank Accession No. WP_022772730.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Roseovarius nubinhibens]”, GenBank Accession No. WP_009813856.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Eubacterium sp. CAG:581]”, GenBank Accession No. WP_022505071.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella sp. oral taxon 472]”, GenBank Accession No. WP_009236633.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Butyrivibrio fibrisolvens]”, GenBank Accession No. WP_022752732.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “Multispecies: alpha-1,2-fucosyltransferase [Butyrivibrio]”, GenBank Accession No. WP_022762282.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “Multispecies: alpha-1,2-fucosyltransferase [Parabacteroides]”, GenBank Accession No. WP_005867692.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “Multispecies: alpha-1,2-fucosyltransferase [Clostridiales]”, GenBank Accession No. WP_016359991.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “Multispecies: alpha-1,2-fucosyltransferase [Bacteroides]”, GenBank Accession No. WP_005839979.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “Multispecies: alpha-1,2-fucosyltransferase [Butyrivibrio]”, GenBank Accession No. WP_022762290.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “Multispecies: alpha-1,2-fucosyltransferase [Rhodobacteraceae]”, GenBank Accession No. WP_008562971.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “Multispecies: alpha-1,2-fucosyltransferase [Bacteroides]”, GenBank Accession No. WP_004313284.1, 1 page. |
| Genbank Database (Apr. 19, 2017) “Multispecies: alpha-1,2-fucosyltransferase [Clostridiales]”, GenBank Accession No. WP_009251343.1, 1 page. |
| Genbank Database (Jul. 20, 2017) “alpha-1,2-fucosyltransferase [Lewinella persica]”, GenBank Accession No. WP_020571066.1, 1 page. |
| Genbank Database (Jul. 20, 2017) “alpha-1,2-fucosyltransferase [Methylophilus methylotrophus]”, GenBank Accession No. WP_018985060.1, 1 page. |
| Genbank Database (Jul. 22, 2017) “alpha-1,2-fucosyltransferase [Bacteroides sartorii]”, GenBank Accession No. WP_016276676.1, 1 page. |
| Genbank Database (Jul. 27, 2017) “alpha-1,2-fucosyltransferase [Bacteroides fragilis YCH46]”, GenBank Accession No. YP_099857.1, 2 pages. |
| Genbank Database (Jul. 27, 2017) “putative alpha-1,2-fucosyltransferase [Bacteroides fragilis YCH46]”, GenBank Accession No. YP_099118.1, 2 pages. |
| Genbank Database (Aug. 18, 2017) “Multispecies: alpha-1,2-fucosyltransferase [Parabacteroides]”, GenBank Accession No. WP_005857874.1, 1 page. |
| Genbank Database (Jan. 12, 2018) “alpha-1,2-fucosyltransferase [Litoreibacter arenae]”, GenBank Accession No. WP_021099615.1, 1 page. |
| Genbank Database (Mar. 2, 2018) “Multispecies: alpha-1,2-fucosyltransferase [Helicobacter]”, GenBank Accession No. WP_005219731.1, 1 page. |
| Genbank Database (Mar. 9, 2018) “Multispecies: alpha-1,2-fucosyltransferase [Escherichia]”, GenBank Accession No. WP_021554465.1, 1 page. |
| Genbank Database (Apr. 5, 2018) “Multispecies: alpha-1,2-fucosyltransferase [Bacteroides]”, GenBank Accession No. WP_008659600.1, 1 page. |
| Genbank Database (May 2, 2018) “alpha-1,2-fucosyltransferase [Bacteroides thetaiotaomicron]”, GenBank Accession No. WP_008766093.1, 1 page. |
| Genbank Database (May 2, 2018) “alpha-1,2-fucosyltransferase [Bacteroides fragilis]”, GenBank Accession No. WP_008768986.1, 1 page. |
| Genbank Database (May 2, 2018) “alpha-1,2-fucosyltransferase [Bacteroides fragilis]”, GenBank Accession No. WP_008768245.1, 1 page. |
| Genbank Database (Jun. 3, 2018) “glycosyltransferase [Butyrivibrio fibrisolvens]”, GenBank Accession No. WP_022755397.1, 1 page. |
| Genbank Database (Jun. 3, 2018) “glycosyltransferase [Firmicutes bacterium CAG:791]”, GenBank Accession No. WP_021849028.1, 1 page. |
| Genbank Database (Jun. 3, 2018) “glycosyltransferase [Leeia oryzae]”, GenBank Accession No. WP_018150480.1, 2 pages. |
| Genbank Database (Aug. 13, 2018) “glycosyltransferase family 11 [Synechococcus phage S-SM2]”, GenBank Accession No. YP_004322362.1, 2 pages. |
| Genbank Database (Sep. 4, 2018) “Multispecies: alpha-1,2-fucosyltransferase [Bacteroides]”, GenBank Accession No. WP_008671843.1, 1 page. |
| Genbank Database (Sep. 5, 2018) “Multispecies: alpha-1,2-fucosyltransferase [Clostridiales]”, GenBank Accession No. WP_021636935.1, 1 page. |
| Genbank Database (Sep. 6, 2018) “Multispecies: alpha-1,2-fucosyltransferase [Bacteroides]”, GenBank Accession No. WP_007835585.1, 1 page. |
| Genbank Database (Sep. 9, 2018) “Multispecies: alpha-1,2-fucosyltransferase [Bacteroides]”, GenBank Accession No. WP_004295547.1, 1 page. |
| Genbank Database (Nov. 9, 2018) “alpha-1,2-fucosyltransferase [Pseudoalteromonas distincta]”, GenBank Accession No. WP_002958454.1, 1 page. |
| Genbank Database (Jan. 19, 2019) “Multispecies: alpha-1,2-fucosyltransferase [Bacteroides]”, GenBank Accession No. WP_004296622.1, 1 page. |
| Baumgartner et al., “Construction of Escherichia coli strains with chromosomally integrated expression cassettes for the synthesis of 2′-fucosyllactose”. Microb Cell Fact. May 1, 2013;12:40. |
| Bayer, T., “Biotechnological production of fucosylated human milk oligosaccharides (HMO) and core structures thereof”. Graz University of Technology Master thesis, 2014, pp. 1-162. <https://diglib.tugraz.at/download.php?id=576a763d797ed&location=browse>. |
| Choi et al., “Engineering of alpha1,2/alpha1,3-fucosyltransferase to improve yield and productivity for the production of 2′-/3-fucosyllactose of HMO”. Korean Society for Biotechnology and Bioengineering (Abstract Only), 2013, p. 214. <http://www.dbpia.co.kr/Journal/PDFViewNew?id=N0DE02287489&prevPathCode=>. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase family protein [Pedobacter heparinus DSM 2366]”, GenBank Accession No. YP_003090434.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase family protein [Geobacter uraniireducens Rf4]”, GenBank Accession No. YP_001230447.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase family protein [Sulfurospirillum deleyianum DSM 6946]”, GenBank Accession No. YP_003304837.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase family protein [Mesotoga prima MesG1.Ag.4.2]”, GenBank Accession No. YP_006346113.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase family 11 [Fibrella aestuarina BUZ 2]”, GenBank Accession No. YP_007319049.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase family protein [Geobacter sp. M18]”, GenBank Accession No. YP_004197726.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase family protein [Marinomonas posidonica IVIA-Po-181]”, GenBank Accession No. YP_004480472.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase family protein [Roseburia hominis A2-183]”, GenBank Accession No. YP_004839455.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase family protein [Desulfomicrobium baculatum DSM 4028]”, GenBank Accession No. YP_003159045.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase family protein [Planctomyces brasiliensis DSM 5305]”, GenBank Accession No. YP_004271766.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyltransferase family 11 [Prevotella melaninogenica ATCC 25845]”, GenBank Accession No. YP_003814512.1, 1 page. |
| Genbank Database (Dec. 17, 2014) “hypothetical protein Sdel_1779 [Sulfurospirillum deleyianum DSM 6946]”, GenBank Accession No. YP_003304829.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “putative LPS biosynthesis alpha-1,2-fucosyltransferase [Bacteroides fagilis 638R]”, GenBank Accession No. YP_005110943.1, 2 pages. |
| Genbank Database (Dec. 18, 2014) “family 11 glycosyl transferase [Prevotella ruminicola 23]”, GenBank Accession No. YP_003574648.1, 2 pages. |
| Genbank Database (Dec. 18, 2014) “fucosyltransferase [Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050]”, GenBank Accession No. YP_008261369.1, 2 pages. |
| Genbank Database (Dec. 18, 2014) “glycosyl transferase [Carnobacterium sp. WN1359]”, GenBank Accession No. YP_008718687.1, 2 pages. |
| Genbank Database (Dec. 18, 2014) “glycosyl transferase family protein [Runella slithyformis DSM 19594]”, GenBank Accession No. YP_004658567.1, 2 pages. |
| Genbank Database (Dec. 18, 2014) “glycosyl transferase family 11 [Polaribacter sp. MED152]”, GenBank Accession No. YP_007670847.1, 2 pages. |
| Genbank Database (Dec. 18, 2014) “glycosyl transferase family 11 [Carnobacterium sp. WN1359]”, GenBank Accession No. YP_008718688.1, 2 pages. |
| Genbank Database (Dec. 18, 2014) “glycosyltransferase [Candidates Symbiobacter mobilis CR]”, GenBank Accession No. YP_008680725.1, 2 pages. |
| Genbank Database (Dec. 18, 2014) “hypothetical protein HMPREF0669_00176 (plasmid) [Prevotella sp. oral taxon 299 str F0039]”, GenBank Accession No. YP_008444280.1, 2 pages. |
| Genbank Database (Dec. 18, 2014) “hypothetical protein PGA1_c33070 [Phaeobacter inhibens DSM173951”, GenBank Accession No. YP_006574665.1, 2 pages. |
| Genbank Database (Jul. 26, 2016) “E. coli lacY Gene (Codes for Lactose Permease)”, GenBank Accession No. V00295.1, 3 pages. |
| Genbank Database (Aug. 3, 2016) “alpha-1,2-fucosyltransferase [Thermosynechococcus elongatus BP-1]”, GenBank Accession No. NP_681784.1, 2 pages. |
| Genbank Database (Aug. 3, 2016) “family 11 glycosyltransferase [Enterococcus faecium DO]”, GenBank Accession No. YP_006376560.1, 2 pages. |
| Genbank Database (Aug. 28, 2016) “fucosyl transferase [Rhodopirellula baltica SH 1]”, GenBank Accession No. NP_868779.1, 2 pages. |
| Genbank Database (Oct. 7, 2016) “0-antigen Translocase (Escherichia coli str. K-12 substr. W3110)”, GenBank Accession No. BAE77506.1, 13 pages. |
| Genbank Database (Oct. 7, 2016) “Colanic Acid Exporter [Escherichia coli str. K-12 Substr.W3110)”, GenBank Accession No. BAA15899.1, 13 pages. |
| Genbank Database (Oct. 7, 2016) “Lipoprotein Required for Capsular Polysaccharide Translocation through the Outer Membrane (Escherichia coli str. K-12 substr. W3110)”, GenBank Accession No. BAE76576.1, 13 pages. |
| Genbank Database (Oct. 7, 2016) “Predicted Acyl Transferase (Escherichia coli str. K-12 substr. W3110)”, GenBank Accession No. BAA15910.1, 13 pages. |
| Genbank Database (Oct. 7, 2016) “Predicted Colanic Acid Polymerase (Escherichia coli str. K-12 substr. W31101”, GenBank Accession No. BAE76573.1, 13 pages. |
| Genbank Database (Oct. 7, 2016) “Predicted Glycosyl Transferase (Escherichia coli str. K-12 substr. W3110)”, GenBank Accession No. BAE76572.1, 13 pages. |
| Genbank Database (Oct. 7, 2016) “Predicted Glycosyl Transferase (Escherichia coli str. K-12 substr. W3110]”, GenBank Accession No. BAA15906.1, 12 pages. |
| Genbank Database (Oct. 7, 2016) “Predicted Glycosyl Transferase (Escherichia coli str. K-12 substr. W3110]”, GenBank Accession No. BAA15912.1, 13 pages. |
| Genbank Database (Oct. 7, 2016) “Predicted Glycosyl Transferase (Escherichia coli str. K-12 substr. W3110]”, GenBank Accession No. BAE76574.1, 13 pages. |
| Genbank Database (Oct. 7, 2016) “Predicted Glycosyl Transferas (Escherichia coli STR. K-12 Substr. N3110)”, GenBank Accession No. BAA15898.1, 13 pages. |
| Genbank Database (Oct. 7, 2016) “Protein-Tyrosine kinase (Escherichia coli str. K-12 substr. W3110)”, GenBank Accession No. BAA15913.1, 13 pages. |
| Genbank Database (Oct. 7, 2016) “Protein-Tyrosine Phosphatase (Escherichia coli str. K-12 substr. W3110]”, GenBank Accession No. BAE76575.1, 13 pages. |
| Genbank Databse (Oct. 7, 2016) “Predicted Acyl Transferase (Escherichia coli str. K-12 substr. W3110)”, GenBank Accession No. BAA15911.1, 13 pages. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Lachnospiraceae bacterium COE1]”, GenBank Accession No. WP_016299568.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Vibrio cholerae]”, GenBank Accession No. WP_002030616.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Escherichia coli]”, GenBank Accession No. WP_001592236.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [[Clostridium] bolteae]”, GenBank Accession No. WP_002570768.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Tannerella sp. CAG:118]”, GenBank Accession No. WP_021929367.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides caccae]”, GenBank Accession No. WP_005675707.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Butyrivibrio sp. AE2015]”, GenBank Accession No. WP_022772718.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella sp. CAG:891]”, GenBank Accession No. WP_022481266.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Parabacteroides johnsonii]”, GenBank Accession No. WP_008155883.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Salmonella enterica]”, GenBank Accession No. WP_023214330.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides sp. CAG:633]”, GenBank Accession No. WP_022161880.1, 1 page. |
| Genbank Database (Apr. 27, 1993) “Kluyveromyces Lactis Beta-D-Galactosidase (LAC4) Gene, Complete CDS”, GenBank Accession No. M84410.1, 2 pages. |
| Genbank Database (Mar. 17, 1994) “E. coli ATP-dependent Protease La (Ion) Gene, Complete CDS”, GenBank Accession No. L20572.1, 2 pages. |
| Genbank Database (Dec. 6, 1995) “Escherichia coli Capsular Polysaccharide Regulator (rcsA) Gene, Complete CDS”, GenBank Accession No. M58003.1, 2 pages. |
| Genbank Database (May 4, 1999) “alpha-1,2-fucosyltransferase [Helicobacter pylori]”, GenBank Accession No. AAD29869.1, 1 page. |
| Genbank Database (Oct. 16, 1999) “wblA [Vibrio cholerae]”, GenBank Accession No. BAA33632.1, 1 page. |
| Genbank Database (Feb. 20, 2003) “Helicobacter Pylori Alpha-1,¾-Fucosyltransferas (fucTa) Gene, Complete Cds”, GenBank Accession No. AF194963.2, 2 pages. |
| Genbank Database (Oct. 3, 2003) “putative fucosyltransferase [Escherichia coli]”, GenBank Accession No. AAO37698.1, 1 page. |
| Genbank Database (Oct. 25, 2005) “Helicobacter Pylori Strain DSM 6709 Alpha-1, 4 Fucosyltransferas (FfucTIII) gene, Complete CDS”, GenBank Accession No. AY450598.1, 2 pages. |
| Genbank Database (Nov. 4, 2005) “DNA Sequence of rcsB Gene which is Regulator Gene of Capsule Polysaccharide Systhesis Gene (CPS Gene)”, GenBank Accession No. E04821.1, 2 pages. |
| Genbank Database (Dec. 6, 2005) “putative fucosyltransferase [Escherichia coli]”, GenBank Accession No. AAO37719.1, 1 page. |
| Genbank Database (Nov. 20, 2008) “Predicted UDP-Glucose lipid Carrier Transferase (Escherichia coli str. K-12 substr. W3110)”, GenBank Accession No. BAA15900.1, 13 pages. |
| Genbank Database (Dec. 27, 2011) “JP 2011167200-A/17:H. Pylori Fucosyltransferases”, GenBank Accession No. HV532291.1, 1 page. |
| Genbank Database (Apr. 10, 2012) “glycosyltransferase [Providencia alcalifaciens]”, GenBank Accession No. AFH02807.1, 1 page. |
| Genbank Database (Sep. 26, 2012) “glycosyl transferase family 11 [uncultured bacterium]”, GenBank Accession No. EKE06679.1, 1 page. |
| Genbank Database (Sep. 26, 2012) “glycosyl transferase family protein [uncultured bacterium]”, GenBank Accession No. EKE02186.1, 1 page. |
| Genbank Database (Sep. 26, 2012) “glycosyl transferase family 11 [uncultured bacterium]”, GenBank Accession No. EKE06672.1, 1 page. |
| Genbank Database (Sep. 26, 2012) “glycosyl transferase family protein [uncultured bacterium]”, GenBank Accession No. EKD23702.1, 1 page. |
| Genbank Database (Sep. 26, 2012) “hypothetical protein ACD_46C00193G0003 [uncultured bacterium]”, GenBank Accession No. EKD71402.1, 1 page. |
| Genbank Database (May 29, 2013) “hypothetical protein C819_03052 [Lachnospiraceae bacterium 10-1]”, GenBank Accession No. EOS74299.1, 2 pages. |
| Genbank Database (Jun. 4, 2013) “Glycosyl transferase family 11/Glycosyltransferase family 6 [Desulfovibrio africanus]”, GenBank Accession No. WP_005984176.1, 1 page. |
| Genbank Database (Jun. 4, 2013) “hypothetical protein [Bacteroides fragilis]”, GenBank Accession No. WP_005822375.1, 1 page. |
| Genbank Database (Jun. 29, 2013) “hypothetical protein [Polaribacter franzmannii]”, GenBank Accession No. WP_018944517.1, 1 page. |
| Genbank Database (Aug. 27, 2013) “glycosyltransferase [Salmonella enterica]”, GenBank Accession No. AFW04804.1, 1 page. |
| Genbank Database (Dec. 10, 2013) “hypothetical protein HMPREF1199_00667 [Prevotella oralis CC98A]”, GenBank Accession No. ETD21592.1, 2 pages. |
| Genbank Database (Feb. 28, 2014) “alpha-1,2-fucosyltransferase [Thermosynechococcus sp. NK55a]”, GenBank Accession No. AHB87954.1, 1 page. |
| Genbank Database (Dec. 16, 2014) “glycosyl transferase family protein [Methanosphaerula palustris E1-9c]”, GenBank Accession No. YP_002467213.1, 2 pages. |
| Genbank Database (Dec. 16, 2014) “alpha-1,2-fucosyltransferase [Gramella forsetii KT0803]”, GenBank Accession No. YP_860609.1, 2 pages. |
| Genbank Database (Dec. 16, 2014) “alpha-1,2-fucosyltransferase [Syntrophus aciditrophicus SB]”, GenBank Accession No. YP_462663.1, 2 pages. |
| Genbank Database (Dec. 16, 2014) “alpha-1,2-fucosyltransferase, putative [Ruegeria pomeroyi DSS-3]”, GenBank Accession No. YP_168587.1, 2 pages. |
| Genbank Database (Dec. 16, 2014) “fucosyltransferase [Escherichia coli O127:H6 str. E2348/69]”, GenBank Accession No. YP_002329683.1, 2 pages. |
| Genbank Database (Dec. 16, 2014) “glycoside hydrolase family protein [Geobacter lovleyi SZ]”, GenBank Accession No. YP_001952981.1, 2 pages. |
| Genbank Database (Dec. 16, 2014) “glycosyl transferase [Desulfovibrio alaskensis G20]”, GenBank Accession No. YP_389367.1, 2 pages. |
| Genbank Database (Dec. 16, 2014) “glycosyl transferase family protein [Bacteroides vulgatus ATCC 8482]”, GenBank Accession No. YP_001300461.1, 2 pages. |
| Genbank Database (Dec. 16, 2014) “glycosyl transferase family protein [Methanococcus maripaludis C7]”, GenBank Accession No. YP_001329558.1, 2 pages. |
| Genbank Database (Dec. 16, 2014) “glycosyl transferase family protein [Desulfovibrio vulgaris str. ‘Miyazaki F’]”, GenBank Accession No. YP_002437106.1, 2 pages. |
| Genbank Database (Dec. 16, 2014) “glycosyl transferase family protein [Chlorobium phaeobacteroides BS1]”, GenBank Accession No. YP_001960319.1, 2 pages. |
| Genbank Database (Dec. 16, 2014) “glycosyl transferase family protein [Bacteroides vulgatus ATCC 8482]”, GenBank Accession No. YP_001300694.1, 2 pages. |
| Genbank Database (Dec. 16, 2014) “glycosyltransferase [Geobacter metallireducens GS-15]”, GenBank Accession No. YP_006720295.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “alpha-1,2-fucosyltransferase [Helicobacter mustelae 12198]”, GenBank Accession No. YP_003517185.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “alpha-1,2-fucosyltransferase [Colwellia psychrerythraea 34H]”, GenBank Accession No. YP_270849.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “alpha-1,2-fucosyltransferase [Pseudovibrio sp. FO-BEG1]”, GenBank Accession No. YP_005080114.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase 11 [Butyrivibrio proteoclasticus B316]”, GenBank Accession No. YP_003829743.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase 11 [Butyrivibrio proteoclasticus B316]”, GenBank Accession No. YP_003831842.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase 11 [Butyrivibrio proteoclasticus B316]”, GenBank Accession No. YP_003829826.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase 11 [Butyrivibrio proteoclasticus B316]”, GenBank Accession No. YP_003829733.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase 11 [Butyrivibrio proteoclasticus B316]”, GenBank Accession No. YP_003829712.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase family protein [Akkermansia muciniphila ATCC BAA-835]”, GenBank Accession No. YP_001877555.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase family protein [Methylotenera mobilis JLW8]”, GenBank Accession No. YP_003048467.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “Glycosyl transferase family 11 [Dechlorosoma suillum PS]”, GenBank Accession No. YP_005026324.1, 2 pages. |
| Genbank Database (Dec. 17, 2014) “glycosyl transferase family 11 [Sideroxydans lithotrophicus ES-1]”, GenBank Accession No. YP_003525501.1, 2 pages. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Clostridium sp. CAG:306]”, GenBank Accession No. WP 022247142.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella sp. oral taxon 306]”, GenBank Accession No. WP_009434595.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Brachyspira sp. CAG:484]”, GenBank Accession No. WP_021917109.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Thalassospira profundimaris]”, GenBank Accession No. WP_008889330.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Acetobacter sp. CAG:267]”, GenBank Accession No. WP_022078656.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Dysgonomonas mossii]”, GenBank Accession No. WP_006842165.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Clostridium sp. KLE 1755]”, GenBank Accession No. WP_021636924.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Gillisia limnaea]”, GenBank Accession No. WP_006988068.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Clostridium sp. KLE 1755]”, GenBank Accession No. WP_021636949.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Francisella philomiragia]”, GenBank Accession No. WP_004287502.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Pseudomonas fluorescens]”, GenBank Accession No. WP_017337316.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Herbaspirillum sp. YR522]”, GenBank Accession No. WP_008117381.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella histicola]”, GenBank Accession No. WP_008822166.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Flavobacterium sp. WG21]”, GenBank Accession No. WP_017494954.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Gallionella sp. SCGC AAA018-N21]”, GenBank Accession No. WP_018293379.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Prevotella paludivivens]”, GenBank Accession No. WP_018463017.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Mariprofundus ferrooxydans]”, GenBank Accession No. WP_009849029.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacillus cereus]”, GenBank Accession No. WP_002174293.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Firmicutes bacterium CAG:534]”, GenBank Accession No. WP_022352106.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [zeta proteobacterium SCGC AB-137-CO9]”, GenBank Accession No. WP_018281578.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Rhodobacterales bacterium HTCC2255]”, GenBank Accession No. WP_008033953.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Spirulina subsalsa]”, GenBank Accession No. WP_017302658.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Vibrio cyclitrophicus]”, GenBank Accession No. WP_010433911.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Lachnospiraceae bacterium NK4A179]”, GenBank Accession No. WP_022783177.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Butyrivibrio sp. AE3009]”, GenBank Accession No. WP_022778576.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides ovatus]”, GenBank Accession No. WP_004317929.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Desulfospira joergensenii]”, GenBank Accession No. WP_022664368.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides dorei]”, GenBank Accession No. WP_007832461.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Firmicutes bacterium CAG:24]”, GenBank Accession No. WP_021916201.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Clostridium hathewayi CAG:224]”, GenBank Accession No. WP_022031822.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides caccae]”, GenBank Accession No. WP_005678148.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Butyrivibrio fibrisolvens]”, GenBank Accession No. WP_022756304.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Lachnospiraceae bacterium A4]”, GenBank Accession No. WP_016280341.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Roseobacter sp. MED193]”, GenBank Accession No. WP_009810150.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Cesiribacter andamanensis]”, GenBank Accession No. WP_009197396.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Rhodopirellula sallentina]”, GenBank Accession No. WP_008679055.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Segetibacter koreensis]”, GenBank Accession No. WP_018611017.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Amphritea japonica]”, GenBank Accession No. WP_019621022.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Spirosoma spitsbergense]”, GenBank Accession No. WP_020606886.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Lachnospiraceae bacterium 28-4]”, GenBank Accession No. WP_016292012.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Lachnospiraceae bacterium COE1]”, GenBank Accession No. WP_016302211.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides sp. HPS0048]”, GenBank Accession No. WP_002561428.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides thetaiotaomicron]”, GenBank Accession No. WP_016267863.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Vibrio nigripulchritudo]”, GenBank Accession No. WP_022596860.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Escherichia coli]”, GenBank Accession No. WP_001581194.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Firmicutes bacterium CAG:24]”, GenBank Accession No. WP_021914998.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Amphritea japonica]”, GenBank Accession No. WP_019622926.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides salyersiae]”, GenBank Accession No. WP_005923045.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides fragilis]”, GenBank Accession No. WP_005786334.1, 1 page. |
| Genbank Database (Dec. 9, 2016) “alpha-1,2-fucosyltransferase [Bacteroides nordii]”, GenBank Accession No. WP_007486843.1, 1 page. |
| Number | Date | Country | |
|---|---|---|---|
| 20220056497 A1 | Feb 2022 | US |
| Number | Date | Country | |
|---|---|---|---|
| 61993742 | May 2014 | US |
| Number | Date | Country | |
|---|---|---|---|
| Parent | 15307914 | US | |
| Child | 17354819 | US |
