Amination Method for Polystyrene-type Resin, and Method for Immobilizing Enzyme Using Aminated Resin

Information

  • Patent Application
  • 20240191008
  • Publication Number
    20240191008
  • Date Filed
    May 10, 2021
    5 years ago
  • Date Published
    June 13, 2024
    2 years ago
Abstract
Provided is an amination method for a polystyrene-type resin, and a method for immobilizing an enzyme using an aminated polystyrene-type resin. The amination method includes: in a solvent, a catalyst is used to catalyze a polystyrene-type resin and an enamine salt to perform a Friedel-Crafts alkylation reaction, to obtain an aminated polystyrene-type resin, herein the catalyst is a Lewis acid catalyst. By means of the Friedel-Crafts alkylation reaction, the enamine salt is grafted onto the polystyrene-type resin, and the polystyrene-type resin is aminated. The conditions of the Friedel-Crafts alkylation reaction are easy to control, the post-treatment process is simple, and it is only necessary to remove the catalyst and the unreacted enamine salt by washing. Therefore, the above amination method in the present application has few steps and is simple and easy to implement. Meanwhile, the amination method further avoids the use of a noble metal catalyst, thereby reducing production cost. When the obtained polystyrene resin is used as an enzyme immobilization carrier, good immobilization effect and usability are achieved. This method also provides a new class of enzyme immobilization carriers to the current library.
Description
TECHNICAL FIELD

The present disclosure relates to the technical field of enzyme immobilization, in particular to an amination method for a polystyrene-type resin, and a method for immobilizing an enzyme using an aminated polystyrene-type resin.


BACKGROUND

Compared with chemical catalysts, biocatalysts (enzymes) are widely used in industrial production processes due to their high activity, selectivity and substrate specificity. Biocatalysis is therefore becoming an important part in manufacturing plans for chemical drugs, intermediates, fine chemicals and final drug molecules. Although the enzyme has the high regioselectivity, high catalytic efficiency and mild reaction conditions, free enzymes often suffer from inactivation problems due to fluctuations in temperature, pH, solvent environment and other factors. As process requirements continue to expand, so do the demands on the efficiency and economy of enzyme applications. Therefore, this requires not only enhanced enzyme activity, specificity, and productivity, but also improved enzyme recyclability and reusability.


A good solution to the aforementioned problem is to utilize heterogeneous catalyst systems by enzyme immobilization. The unique catalytic performances of the enzymes are retained, while new advantages such as high stability, easy separation and recovery, superior resuability, and process simplification can be introduced as well. The performance of the immobilized enzyme mainly depends on immobilization methods and carrier materials used. According to different binding modes between the enzyme and the carrier, common methods used for enzyme immobilization may include adsorption, covalent binding, cross-linking and encapsulation and the like. Herein the adsorption method is a combination of physical adsorption, Van der Waals force and hydrophobic effect and the like between the enzyme and the carrier, and is the most commonly used method for the immobilized enzyme because of the advantages of simple and convenient operation, large adsorption capacity and low cost in industrial applications. However, due to the weak binding force between the carrier and the enzyme by the physical adsorption, there is a problem that the enzyme is fallen off from the carrier during repeated use, so that the conversion rate is decreased. Covalent binding, on the other hand, is to link the enzyme and the carrier by a covalent bond. Therefore, the carrier must have a corresponding functional group that may react with the enzyme to generate the covalent bond. Compared with the adsorption method, the linkage between the enzyme and the carrier is stronger, and the problem that the enzyme is fallen off in the use process is solved, thus the stability and cyclicity are better.


In the early 1970s, Davankov et. al. prepared a type of a porous polymer with unique structure and excellent performance by crosslinking of linear polystyrene or re-crosslinking of loosely crosslinked polystyrene by Friedel-Crafts reaction. This type of the reactions is known as ultra-high crosslinking reaction (or Davankov ultra-high crosslinking reaction). The porous polymer prepared by such reaction is called ultra-high crosslinked adsorption resin. Ultra-high crosslinked adsorption resin is considered as the third-generation adsorption resin, in comparison of gel-type and macroporous-type adsorption resins. The ultra-high crosslinking adsorption resin typically has the structural characteristics such as large specific surface area, small average pore size, narrow pore size distribution, and good mechanical strength. At present, it shows broad application prospects in treatment of toxic organic wastewater, extraction of traditional Chinese herbs and antibiotics, gas storage and separation, as well as several other fields.


Due to the ideal reactivity of amino groups, strong electron acceptability and easy protonation, aminated polystyrene resins have seen wide applications in the fields of separation and passivation of organic drugs, biomedical polymer materials, adsorption of contaminants in sewage treatment, polymeric catalyst supports and the like. The following methods can be used for synthesizing aminated polystyrene resin:


Nitro compound reduction method: it is an important method to synthesize the aminated polystyrene resin by reducing a nitro compound to obtain an amino compound. There are many process routes, mainly including the following modes:


Catalytic hydrogenation reduction: the catalytic hydrogenation reduction method mainly uses noble metals or alloys thereof as catalysts, such as Ni, Pd, and Pt. While the reaction conditions reach a certain temperature and pressure, the nitro group is reduced to the amino group. The method has many advantages, firstly, it may reduce the manpower investment and has the strong mechanical operability; and secondly, the yield is higher, the product purity is high, the reaction steps are controllable, and it is green and pollution-free. However, it requires noble metal catalysis during the process, and requires the high temperature and pressure, the requirements for devices are higher. These undoubtedly greatly increase the cost of material synthesis.


Hydrazine hydrate reduction method: in the method, the catalysts need to be added to promote the reaction. One commonly used catalyst is the noble metals and the alloys thereof, usually including Pd/C, Pt/C, Raney Ni and the like.


Metal reduction method: the method is applied earlier, specifically by coexisting metals with acids, and also by dissolving salt electrolytes in water to achieve the reduction reaction of the nitro group. It is known by theoretical analysis that metals with electromotive forces before H, such as Li, Na, K, and Mg, may all be used as reducing agents under certain conditions. However, the drawback is that iron sludge is generated at the end of the reaction, and it may cause serious pollution to the environment.


Bromination-amination method: A p-bromine atom is firstly introduced onto phenyl ring by electrophilic substitution reaction. The obtained resin is then reacted with LIN (SiMe3)2 with the existence of a palladium catalyst. Finally, p-aminopolystyrene resin is afforded with post-treatment using acid or alkali.


Chloromethylated polystyrene amination method: Firstly, polystyrene microspheres are linked to a chloromethyl in the para-position of the benzene ring by a chloromethylation reaction, and are then subjected to an amination reaction with an amination reagent to prepare aminopolystyrene. However, the method requires chloromethyl methyl ether or dichloromethyl methyl ether, these chemical reagents are harmful to human bodies and have a strong cancer risk, and are therefore widely banned for use internationally. In addition, the reaction is also accompanied by side reactions such as multi-substitution and post-crosslinking, so that the chloromethyl resin structure becomes complex.


Chloroacetylated polystyrene amination method: an acyl group is introduced into the para-position of the benzene ring by an Friedel-Crafts acylation reaction, and then aminated polystyrene is prepared by the amination reaction, as follows:




embedded image


SUMMARY

A main purpose of the present disclosure is to provide a new amination method for a polystyrene-type resin, and to use an aminated polystyrene-type resin as an enzyme immobilization carrier to immobilize a transaminase. The method not only provides a new method for synthesis of the aminated polystyrene resin, but also provides a new class of enzyme immobilization carriers to the current library.


In order to achieve the above purpose, according to one aspect of the present disclosure, an amination method for a polystyrene-type resin is provided, and the amination method includes: in a solvent, a catalyst is used to catalyze a polystyrene-type resin and an enamine salt to perform a Friedel-Crafts alkylation reaction, to obtain an aminated polystyrene-type resin, herein the catalyst is a Lewis acid catalyst.




embedded image


Furthermore, the temperature of the above Friedel-Crafts alkylation reaction is 40˜80° C., and preferably, the time of the Friedel-Crafts alkylation reaction is 12˜20 h.


Further, the mass ratio of the above polystyrene-type resin to the enamine salt is 2:1˜2:3.


Further, the molar ratio of the above enamine salt to the Lewis acid catalyst is 1:3˜1:5.


Further, the above Lewis acid catalyst is selected from anhydrous aluminum trichloride or ferric trichloride.


Further, the above enamine salt is 3-butenamine hydrochloride.


Further, the above solvent is 1,2-dichloroethane.


Further, the above polystyrene-type resin is selected from any one of polystyrene resin, polystyrene-methacrylate resin, AB8 polystyrene resin, ECR1090 polystyrene resin, NKA9 polystyrene resin, D101 polystyrene resin, and SXD11 polystyrene resin.


Further, the above amination method includes: the polystyrene-type resin and enamine salt are dispersed in the solvent to form a system to be reacted; and in a nitrogen or inert atmosphere, the system to be reacted is mixed with the catalyst and heated to the temperature of the Friedel-Crafts alkylation reaction to perform the Friedel-Crafts alkylation reaction, to obtain the aminated polystyrene-type resin.


According to another aspect of the present disclosure, a method for immobilizing an enzyme using an aminated polystyrene-type resin is provided, and the method includes: the aminated polystyrene-type resin is prepared by using any one of the above amination methods; and the aminated polystyrene-type resin is used as a carrier, to immobilize the enzyme by using glutaraldehyde as a crosslinking agent.


Further, the above method includes: the aminated polystyrene-type resin is modified with a buffer solution of the glutaraldehyde, to obtain a glutaraldehyde-modified resin; and enzyme solution is crosslinked with the glutaraldehyde-modified resin, to achieve immobilization.


Further, the above method includes: the enzyme solution is mixed with the aminated polystyrene-type resin, to obtain a resin adsorbed with the enzyme; and the resin adsorbed with the enzyme is crosslinked with the buffer solution of the glutaraldehyde, to achieve immobilization.


Further, the above buffer solution of the glutaraldehyde includes a phosphate buffer solution, the mass content of the glutaraldehyde in the buffer solution of the glutaraldehyde is 1˜2%, and the enzyme is a transaminase.


By applying technical schemes of the present disclosure, the present application utilizes the Friedel-Crafts alkylation reaction to graft the enamine salt onto the polystyrene-type resin in one step, and the amination of the polystyrene-type resin is completed. The conditions of the Friedel-Crafts alkylation reaction are easy to control, the post-treatment process is simple, and it is only necessary to remove the catalyst and the unreacted enamine salt by washing, such that the above amination method in the present application has few steps and is simple and easy to implement. Meanwhile, the amination method further avoids the use of a noble metal catalyst, thereby reducing the production cost. The commercial polystyrene resin modified by amination may be successfully used as an enzyme immobilization carrier, and has better immobilization effects and reusability. The present application also provides new insights for the design of enzyme immobilization carrier, so that more selections for immobilization of the different enzymes are provided in terms of carrier pore size, specific surface area, skeleton structure, carrier polarity, and other aspects.







DETAILED DESCRIPTION OF THE EMBODIMENTS

It should be noted that examples and features in the present application may be combined with each other if no other conflicts exist. The present disclosure is described in detail below in combination with examples.


As analyzed in the background of the present application, the preparation method for the aminated polystyrene-type resin in prior art may use a complex preparation method, require a plurality of steps or multiple post-treatment methods. In order to address the problem, the present application provides a facile amination method for a polystyrene-type resin, and a method for immobilizing an enzyme using an aminated polystyrene-type resin.


In a typical embodiment of the present application, an amination method for a polystyrene-type resin is provided, and the amination method includes: in a solvent, a catalyst is used to catalyze a polystyrene-type resin and an enamine salt to perform a Friedel-Crafts alkylation reaction, to obtain an aminated polystyrene-type resin, herein the catalyst is a Lewis acid catalyst.


The present application achieves amination of polystyrene-type resin by utilizing the Friedel-Crafts alkylation reaction to graft the enamine salt onto the polystyrene-type resin. The conditions of the Friedel-Crafts alkylation reaction are easy to control, the post-treatment process is simple, and it is only necessary to remove the catalyst and the unreacted enamine salt by washing. Therefore, the above amination method in the present application has fewer steps and is simple and easy to implement. Meanwhile, the amination method further avoids the use of a noble metal catalyst, thereby the production cost is reduced. The commercial polystyrene resins modified by aforementioned amination method may be successfully used as an enzyme immobilization carriers, and exhibit good immobilization effects and reusability. The present application also provides new insights for the design of enzyme immobilization carrier, so that more selections for immobilization of the different enzymes are provided in terms of carrier pore size, specific surface area, skeleton structure, carrier polarity, and other aspects.


In order to improve the efficiency of the above Friedel-Crafts alkylation reaction, for the above reaction raw materials, preferably the temperature of the above Friedel-Crafts alkylation reaction is 40˜80° C., and preferably the time of the Friedel-Crafts alkylation reaction is 12˜20 h.


The above Friedel-Crafts alkylation reaction essentially involves grafting an alkyl group with an amino group onto a benzene ring of polystyrene. Due to the macromolecular characteristics of the polystyrene-type resin, it is difficult to achieve uniform grafting on each benzene ring. In order to improve the amount of amino groups grafted onto polystyrene-type resins, preferably the molar ratio of the above polystyrene-type resin to the enamine salt is 2:1˜2:3.


In addition, in order to improve catalytic efficiency, avoid catalyst waste, and facilitate catalyst removal, preferably the molar ratio of the above enamine salt to the Lewis acid catalyst is 1:3˜1:5.


In the above method, the Lewis acid catalyst used for the Friedel-Crafts alkylation reaction may be selected from Lewis acid catalysts commonly used for the Friedel-Crafts alkylation reaction in prior art. In order to facilitate catalyst removal and ensure efficient catalysis, preferably the above Lewis acid catalyst is any one of anhydrous aluminum trichloride and ferric trichloride or a combination thereof.


In some embodiments, the enamine salt used for the above amination method is 3-butenamine hydrochloride, to achieve efficient amination.


The above solvent used in the present application is mainly for dissolving the enamine salt and Lewis acid catalyst, in order to facilitate its full contact with the polystyrene-type resin. In order to improve the solubility of the enamine salt and Lewis acid catalyst, preferably the above solvent is 1,2-dichloroethane.


The polystyrene-type resin used in the present application includes but not limited to any one of polystyrene resin, polystyrene methacrylate resin, AB8 polystyrene resin, ECR1090 polystyrene resin, NKA9 polystyrene resin, D101 polystyrene resin, and SXD11 polystyrene resin. Whether it is a pure polystyrene resin or a modified polystyrene resin, the above amination method may be used for amino modification.


In some embodiments of the present application, the above amination method includes: the polystyrene-type resin and the enamine salt are dispersed in the solvent, to form a system to be reacted; and in a nitrogen or inert atmosphere, the system to be reacted is mixed with the catalyst and heated to the temperature of the Friedel-Crafts alkylation reaction to perform the Friedel-Crafts alkylation reaction, obtaining the aminated polystyrene-type resin. The enamine salt and the polystyrene-type resin are dispersed in the solvent, so that the enamine salt may enter the pores of the polystyrene-type resin in advance, then the catalyst is added for the Friedel-Crafts alkylation reaction, ensuring faster reaction and a uniform alkylation.


In another typical embodiment of the present application, a method for immobilizing an enzyme using an aminated polystyrene-type resin is provided, and the method includes: the aminated polystyrene-type resin is prepared by any one of the above amination methods; and the aminated polystyrene-type resin is used as a carrier, to immobilize the enzyme by using glutaraldehyde as a crosslinking agent.


The aforementioned preparation method for aminoated polystyrene-type resins benefits from merits such as facile operation and low production cost. The degree of amination can be flexibly adjusted in this aminoation method, thereby controlling the degree of enzyme immobilization in the next steps.


In some embodiments of the present application, the above method includes: the aminated polystyrene-type resin is modified with a buffered solution of glutaraldehyde, to obtain a glutaraldehyde-modified resin; and enzyme solution is crosslinked with the glutaraldehyde-modified resin to achieve immobilization.


In the above method firstly uses the glutaraldehyde to modify the resin, as to use the amino group on the polystyrene-type resin to crosslink with the glutaraldehyde to form a crosslinking network; and then, amine groups on the enzyme is crosslinked with the glutaraldehyde to achieve crosslinking and curing of the enzyme. This procedure makes the crosslinking and curing efficiency of the enzyme higher, especially for enzymes that are sensitive to the glutaraldehyde.


In other embodiments of the present application, the above method includes: the enzyme solution is mixed with the aminated polystyrene-type resin, to obtain a resin adsorbed with the enzyme; and the resin adsorbed with the enzyme is crosslinked with a buffered solution of glutaraldehyde, to achieve immobilization.


In the above method, the enzymes are firstly adsorbed onto the internal and external surfaces of the polystyrene-type resin by the adsorption action, and then reacts with the glutaraldehyde, to achieve the use of the glutaraldehyde to immobilize the enzyme on the polystyrene-type resin by a crosslinking mode. The above method is particularly applicable to enzymes that are not sensitive to the glutaraldehyde.


The buffered solution for glutaraldehyde used in the present application may be a conventional buffer solution used for crosslinking and curing. For example, the above buffer solution of the glutaraldehyde includes the phosphate buffer solution. In addition, in order to improve the immobilization rate of enzyme, preferably the mass content of the glutaraldehyde in the above buffered solution of the glutaraldehyde is 1˜2%, as to improve the utilization rate of the glutaraldehyde. In the process of immobilizing the enzyme, the loading amount may be adjusted by varying the ratio of enzyme to the carrier, which is already well known in the art.


Since the above immobilization uses the crosslinking action between the aldehyde group of the glutaraldehyde and the amino group on the enzyme, the method of the present application is applicable to conventional enzymes, for example, the above enzyme is selected from a transaminase.


The beneficial effects of the present application are further described below in combination with embodiments and contrast examples.


EXAMPLES OF AMINATION
Example 1-1
Synthesis of Polystyrene Resin

150 mL of aqueous solution containing 0.5% polyvinyl alcohol (PVA) was added to a 500 mL four-necked flask, and the temperature was increased to 40° C. 16 g of styrene, 5 g of divinylbenzene (80%), 10 mL of toluene, 20 mL of n-heptane, and 100 mg of benzoyl peroxide were mixed evenly, and then added into the four-necked flask. The droplet size were adjusted to an appropriate range by controlling stirring speed, and the temperature was increased to 80° C. and kept for 2 h, and then 88° C. and kept for 4 h. After the reaction was completed, it was cooled to room temperature, it was filtered to obtain a target bead body. The obtained polystyrene resins were washed sequentially with hot water, ethanol, and deionized water, and finally screened and dried.


Amination of Polystyrene Resin

1 g of a dried polystyrene resin and 1 g of 3-butenamine hydrochloride were dispersed into 100 mL of 1,2-dichloroethane and stirred at room temperature for 1 h, to form a system to be reacted. Then 2 g of anhydrous aluminum trichloride was weighed and added to the above mixture and the stirring was allowed to continue for another 10 min. Then the temperature was increased to 80° C. and the reaction was allowed to go on for another 20 h under the protection of N2. After the reaction was completed, it was cooled to room temperature and washed sequentially with methanol and deionized water to obtain an aminated polystyrene resin: PS-NH2.


Example 1-2
Synthesis of Polystyrene-Methacrylate Resin

240 mL of aqueous solution containing 0.5% PVA and 10% NaCl was added to a 500 ml four-necked flask, and the temperature was increased to 40° C. 6 g of methyl methacrylate, 15 g of divinylbenzene (80%), 20 mL of 1,2-dichloroethane, 40 mL of methylcyclohexane and 100 mg of azobisisobutyronitrile were mixed evenly, and then added into the four-necked flask. The droplet size were adjusted to an appropriate range by controlling stirring speed, and the temperature was increased to 70° C. and kept for 2 h, and then 80° C. and kept for 4 h, and finally 85° C. for 1 h. After the reaction was completed, it was cooled to a room temperature, it was filtered to obtain a target bead body. The obtained PDMA resins were washed sequentially with hot water, ethanol, and deionized water, and finally screened and dried.


PDMA Resin Modification

1 g of a dried PDMA resin and 0.7 g of 3-butenamine hydrochloride were dispersed into 100 mL of 1,2-dichloroethane and stirred at room temperature for 1 h, to form a system to be reacted. Then 2 g of anhydrous aluminum trichloride was weighed and added to the above mixture and the stirring was allowed to continue for another 10 min. Then the temperature was increased to 80° C. and the reaction was allowed to go on for another 20 h under the protection of N2. After the reaction was completed, it was cooled to room temperature and washed sequentially with methanol and deionized water to obtain an aminated polystyrene resin: PDMA-NH2.


Example 1-3

1 g of a dried ECR1090 polystyrene resin (purchased from Purlite) and 1 g of 3-butenamine hydrochloride were dispersed into 100 mL of 1,2-dichloroethane and stirred at room temperature for 1 h, to form a system to be reacted. Then 2 g of anhydrous aluminum trichloride was weighed and added to the above mixture and the stirring was allowed to continue for another 10 min. Then the temperature was increased to 80° C. and the reaction was allowed to go on for another 20 h under the protection of N2. After the reaction was completed, it was cooled to room temperature and washed sequentially with methanol and deionized water to obtain an aminated polystyrene resin: ECR 1090-NH2.


Example 1-4

1 g of a dried AB8 resin (purchased from Tianjin Nankai Hecheng Science & Technology Co., Ltd.) and 1 g of 3-butenamine hydrochloride were dispersed into 100 mL of 1,2-dichloroethane and stirred at room temperature for 1 h, to form a system to be reacted. Then 2 g of anhydrous aluminum trichloride was weighed and added to the above mixture and the stirring was allowed to continue for another 10 min. Then the temperature was increased to 80° C. and the reaction was allowed to go on for another 20 h under the protection of N2. After the reaction was completed, it was cooled to room temperature and washed sequentially with methanol and deionized water to obtain an aminated AB8 resin: AB8-NH2.


Example 1-5

1 g of a dried NKA9 resin (purchased from Tianjin Nankai Hecheng Science & Technology Co., Ltd.) and 1 g of 3-butenamine hydrochloride were dispersed into 100 mL of 1,2-dichloroethane and stirred at room temperature for 1 h, to form a system to be reacted. Then 2 g of anhydrous aluminum trichloride was weighed and added to the above mixture and the stirring was allowed to continue for another 10 min. Then the temperature was increased to 80° C. and the reaction was allowed to go on for another 20 h under the protection of N2. After the reaction was completed, it was cooled to room temperature and washed sequentially with methanol and deionized water to obtain an aminated NKA9 resin: NKA9-NH2.


Example 1-6

1 g of a dried SXD-11 resin (purchased from Anhui Sanxing Co., Ltd.) and 1 g of 3-butenamine hydrochloride were dispersed into 100 mL of 1,2-dichloroethane and stirred at room temperature for 1 h, to form a system to be reacted. Then 2 g of anhydrous aluminum trichloride was weighed and added to the above mixture and the stirring was allowed to continue for another 10 min. Then the temperature was increased to 80° C. and the reaction was allowed to go on for another 20 h under the protection of N2. After the reaction was completed, it was cooled to room temperature and washed sequentially with methanol and deionized water to obtain an aminated SXD-11 resin: SXD-11-NH2.


Example 1-7

1 g of a dried D101 resin (purchased from Anhui Sanxing Co., Ltd.) and 1 g of 3-butenamine hydrochloride were dispersed into 100 mL of 1,2-dichloroethane and stirred at room temperature for 1 h, to form a system to be reacted. Then 2 g of anhydrous aluminum trichloride was weighed and added to the above mixture and the stirring was allowed to continue for another 10 min. Then the temperature was increased to 80° C. and the reaction was allowed to go on for another 20 h under the protection of N2. After the reaction was completed, it was cooled to room temperature and washed sequentially with methanol and deionized water to obtain an aminated D101 resin: D101-NH2.


The amino contents of the aminated polystyrene resins obtained from the above examples are detected by ninhydrin color development method and acid-base titration method, their specific surface areas and pore sizes are measured by nitrogen adsorption-desorption method. The results are shown in Table 1.














TABLE 1








Specific
Average
Amino




surface area
pore size
content



Name
(m2 g−1)
(nm)
(mmol/g)





















PS-NH2
750
2.3
5.2



PDMA-NH2
420
10
2.1



AB8-NH2
520
8
3.8



ECR1090-NH2
610
50
2.8



NKA9-NH2
150
10
3.2



D101-NH2
450
5
3.8



SXD11-NH2
400
20
2.5










Examples of Enzyme Immobilization

A transaminase is used as a model, and a transaminase derived from Chromobacterium violaceum DSM30191 (CVTA) is used as a model substance, and its sequence SEQ ID NO. 1 is:











MQKQRTCSQWRELDAAHHLHPFTDTASLNQAGARVMTRGEGVYLWD







CEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPFYNTFFGT







THPPVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWD







VQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGDLPIPGMA







HIEQPWWYKHGKDMTPDEFGVVAARWLEEKILEIGADKVAAFVGE







PIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEW







FGHQHFGFQPDLFTAAKGLSSGYLPLGAVFVGDRVAEGLIAGGDF







NHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKDDIGPYMQKRWR







ETFSRFEHVDDVRGVGMMLAFTLVKNKAKRELFPDFGEIGTLCED







IFFRNNLIMTAQGDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQ







TLKARGLA.






Example 2-1

1% glutaraldehyde solution was prepared with 20 mM phosphate buffer solution (pH=7.0). 1 g of the aminated polystyrene resin and a pristine polystyrene resin in Example 1-1 were weighed respectively and dispersed into the above solution. It was incubated at 30° C. for 1 h, and then washed three times with deionized water, to obtain a red glutaraldehyde-modified aminated polystyrene resin and a glutaraldehyde-modified pristine polystyrene resin. The resin might become red brown after being modified with the glutaraldehyde, so it was judged whether the glutaraldehyde is successfully modified according to the color change.


1 g of glutaraldehyde-modified aminated polystyrene resin and glutaraldehyde-modified pristine polystyrene resin were added to an enzyme solution (4 mL, 1 V enzyme solution plus 3 V phosphate buffer solution) to prepare an aminated polystyrene immobilized enzyme and a pristine polystyrene resin immobilized enzyme.


The enzyme loading amount was calculated by measuring the difference of the protein concentration before and after immobilization. The loading of enzyme on the aminated polystyrene immobilized enzyme was 26.44 mg/g; and the loading of enzyme on the pristine polystyrene resin immobilized enzyme was 11.09 mg/g.


Example 2-2

1% glutaraldehyde solution was prepared with 20 mM phosphate buffer solution (pH=7.0). 1 g of the PDMA-NH2 resin and PDMA resin in Example 1-2 were weighed respectively and dispersed into the above solution. It was incubated at 30° C. for 1 h, and then washed three times with deionized water, a red glutaraldehyde-modified PDMA resin and a glutaraldehyde-modified PDMA-NH2 resin.


1 g of glutaraldehyde-modified PDMA resin and glutaraldehyde-modified PDMA-NH2 resin were added to an enzyme solution (4 mL, 1 V enzyme solution plus 3 V phosphate buffer solution) to prepare PDMA-NH2 and PDMA immobilized enzymes, respectively.


The loading of enzyme on the PDMA-NH2 immobilized enzyme was 28.35 mg/g; and the loading of enzyme on the PDMA immobilized enzymes was 9.17 mg/g.


Example 2-3

1% glutaraldehyde solution was prepared with 20 mM phosphate buffer solution (pH=7.0). 1 g of the ECR1090-NH2 resin and ECR1090 resin in Example 1-3 were weighed respectively and dispersed into the above solution. It was incubated at 30° C. for 1 h, and then washed three times with deionized water, to obtain a red glutaraldehyde-modified ECR1090 resin and a glutaraldehyde-modified ECR1090-NH2 resin.


1 g of glutaraldehyde-modified ECR1090-NH2 resin and glutaraldehyde-modified ECR1090 resin were added to an enzyme solution (4 mL, 1 V enzyme solution plus 3 V phosphate buffer solution) to prepare ECR1090-NH2 and ECR1090 immobilized enzymes, respectively.


The loading of enzyme on the ECR1090-NH2 immobilized enzyme was 21.82 mg/g; and the loading of enzyme on the ECR 1090 immobilized enzyme was 21.09 mg/g.


Example 2-4

1% glutaraldehyde solution was prepared with 20 mM phosphate buffer solution (pH=7.0). 1 g of the AB8-NH2 resin and AB8 resin in Example 1-4 were weighed respectively and dispersed into the above solution. It was incubated at 30° C. for 1 h, and then washed three times with deionized water, to obtain a red glutaraldehyde-modified AB8 resin and a glutaraldehyde-modified AB8-NH2 resin.


1 g of glutaraldehyde-modified AB8-NH2 resin and glutaraldehyde-modified AB8 resin were added to an enzyme solution (4 mL, 1 V enzyme solution plus 3 V phosphate buffer solution) to prepare AB8-NH2 and AB8 immobilized enzymes, respectively.


The loading of enzyme on the AB8-NH2 immobilized enzyme was 28.37 mg/g; and the loading of enzyme on the AB8 immobilized enzyme was 12.91 mg/g.


Example 2-5

1% glutaraldehyde solution was prepared with 20 mM phosphate buffer solution (pH=7.0). 1 g of the NKA9-NH2 resin and NKA9 resin in Example 1-5 were weighed respectively and dispersed into the above solution. It was incubated at 30° C. for 1 h, and then washed three times with deionized water, to obtain a red glutaraldehyde-modified NKA9 resin and a glutaraldehyde-modified NKA9-NH2 resin.


1 g of glutaraldehyde-modified NKA9-NH2 resin and glutaraldehyde-modified NKA9 resin were added to an enzyme solution (4 mL, 1 V enzyme solution plus 3 V phosphate buffer solution) to prepare NKA9-NH2 and NKA9 immobilized enzymes, respectively.


The loading of enzyme on the NKA9-NH2 immobilized enzyme was 44.56 mg/g; and the loading of enzyme on the NKA9 immobilized enzyme was 42.31 mg/g.


Example 2-6

1% glutaraldehyde solution was prepared with 20 mM phosphate buffer solution (pH=7.0). 1 g of the SXD-11-NH2 resin and SXD-11 resin in Example 1-5 were weighed respectively and dispersed into the above solution. It was incubated at 30° C. for 1 h, and then washed three times with deionized water, to obtain a red glutaraldehyde-modified SXD-11 resin and a glutaraldehyde-modified SXD-11-NH2 resin.


1 g of glutaraldehyde-modified SXD-11-NH2 resin and glutaraldehyde-modified SXD-11 resin were added to an enzyme solution (4 mL, 1 V enzyme solution plus 3 V phosphate buffer solution) to prepare SXD-11-NH2 and SXD-11 immobilized enzymes, respectively.


The loading of enzyme on the SXD-11-NH2 immobilized enzyme was 13.31 mg/g; and the loading of enzyme on the SXD-11 immobilized enzyme was 13.41 mg/g.


The following enzymatic reaction was employed:




embedded image


In a 20 mL reaction flask, 0.5 mL of methanol was added to dissolve 0.1 g of a carbonyl substrate, and 15 eq of isopropylamine hydrochloride and 25.0 mg of 5′-pyridoxal phosphate (PLP) were added, 0.1 M phosphate buffer solution (pH 8.0) was added until the final volume of reaction solution reached 5 mL, to form a system to be reacted; and


0.1 g of transaminase powder or 0.1 g of an immobilized enzyme (prepared with the transaminase powder) was respectively added to the system to be reacted independently, and the mixture was stirred at 47° C. for 20 h. The conversion rate of the system was detected by high performance liquid chromatography (HPLC). After each round of the reaction, the immobilized enzymes were separated and used in the next round of the reaction to test their reusability. The results were shown in Table 2.













TABLE 2








Conversion
Cycle


Enzyme
Example
Carrier
rate (%)
count



















Transaminase

Free enzyme
99
1


derived from
Example 2-1
PS
9
1



Chromobacterium


PS-NH2
87
10



violaceum

Example 2-2
PDMA
13
1


DSM30191

PDMA-NH2
90
10



Example 2-3
ECR1090
20
1




ECR1090-NH2
98
10



Example 2-4
AB8
1
1




AB8-NH2
80
10



Example 2-5
NK9
36
1




NK9-NH2
95
10



Example 2-6
SXD-11
3
1




SXD-11-NH2
95
10









From the above description, it can be seen that the above examples of the present disclosure achieved the following technical effects.


The present application utilizes the Friedel-Crafts alkylation reaction to graft the enamine salt onto the polystyrene-type resin, and the amination of the polystyrene-type resin is completed. The conditions of the Friedel-Crafts alkylation reaction are easy to control, the post-treatment process is simple, and it is only necessary to remove the catalyst and the unreacted enamine salt by washing. Therefore, the above amination method in the present application has few steps and is simple and easy to implement. Meanwhile, the amination method further avoids the use of a noble metal catalyst, thereby the production cost is reduced. The commercial polystyrene resins modified by aforementioned amination method may be successfully used as an enzyme immobilization carrier, and exhibit good immobilization effects and reusability. The present application also provides new insights for the design of enzyme immobilization carrier, so that more selections for immobilization of the different enzymes are provided in terms of carrier pore size, specific surface area, skeleton structure, carrier polarity, and other aspects.


It should be understood that the examples described above are only intended to illustrate, but not limit the scope of the invention. Those skilled in the art will recognize many equivalents and modifications to the specific embodiments described herein. These equivalents and modifications are intended to be encompassed in the following claims appended hereto as permitted by applicable law.

Claims
  • 1. An amination method for a polystyrene-type resin, wherein the amination method comprises: in a solvent, catalyzing the polystyrene-type resin and an enamine salt by a catalyst for a Friedel-Crafts alkylation reaction, to obtain an aminated polystyrene-type resin, wherein the catalyst is a Lewis acid catalyst.
  • 2. The amination method according to claim 1, wherein a temperature of the Friedel-Crafts alkylation reaction is 40-80° C., and a time of the Friedel-Crafts alkylation reaction is preferably 12-20 h.
  • 3. The amination method according to claim 1, wherein a mass ratio of the polystyrene-type resin and the enamine salt is 2:1 to 2:3.
  • 4. The amination method according to claim 1, wherein a molar ratio of the enamine salt and the Lewis acid catalyst is 1:3 to 1:5.
  • 5. The amination method according to claim 1, wherein the Lewis acid catalyst is any one of anhydrous aluminum trichloride and iron trichloride or a combination thereof.
  • 6. The amination method according to claim 1, wherein the enamine salt is 3-butenylamine hydrochloride.
  • 7. The amination method according to claim 1, wherein the solvent is 1,2-dichloroethane.
  • 8. The amination method according to claim 1, wherein the polystyrene-type resin is selected from any one of a polystyrene resin, a polystyrene-methacrylate resin, a AB8-type polystyrene resin, a ECR1090-type polystyrene resin, a NKA9-type polystyrene resin, a D101-type polystyrene resin, or an SXD11-type polystyrene resin.
  • 9. The amination method according to claim 1, wherein the amination method comprises: dispersing the polystyrene-type resin and the enamine salt in the solvent, to form a system to be reacted; andin a nitrogen or inert atmosphere, after mixing the system to be reacted with the catalyst, heating to the temperature of Friedel-Crafts alkylation reaction and performing the Friedel-Crafts alkylation reaction, to obtain the aminated polystyrene-type resin.
  • 10. A method for immobilizing an enzyme with an aminated polystyrene-type resin, wherein the method comprises: preparing the aminated polystyrene-type resin by the amination method according to claim 1; andimmobilizing the enzyme with the aminated polystyrene-type resin as a carrier, and the glutaraldehyde as a cross-linking agent.
  • 11. The method according to claim 10, wherein the method comprises: modifying the aminated polystyrene-type resin by a buffer solution of the glutaraldehyde, to obtain a glutaraldehyde-modified resin; andperforming a cross-linking reaction on a enzyme solution and the glutaraldehyde-modified resin, to achieve the immobilization.
  • 12. The method according to claim 10, wherein the method comprises: mixing the enzyme solution with the aminated polystyrene-type resin, to obtain an enzyme-adsorbed resin; andperforming a cross-linking reaction on the enzyme-adsorbed resin and a buffer solution of the glutaraldehyde, to achieve the immobilization.
  • 13. The method according to claim 11, wherein the buffer solution of the glutaraldehyde comprises a phosphate buffer solution, a mass content of the glutaraldehyde in the buffer solution of the glutaraldehyde is 1-2%, and the enzyme is a transaminase.
  • 14. The method according to claim 12, wherein the buffer solution of the glutaraldehyde comprises a phosphate buffer solution, a mass content of the glutaraldehyde in the buffer solution of the glutaraldehyde is 1-2%, and the enzyme is a transaminase.
Priority Claims (1)
Number Date Country Kind
202110329787.6 Mar 2021 CN national
PCT Information
Filing Document Filing Date Country Kind
PCT/CN2021/092799 5/10/2021 WO