Patent Grant
12145982
The instant application contains a Sequence Listing which has been filed electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on May 20, 2021, is named 271416US2_Sequence_Listing.txt and is 227 kilobytes in size.
Chemokine (C-X-C motif) ligand 13 (CXCL13), also known as B lymphocyte chemoattractant (BLC) or B cell-attracting chemokine 1 (BCA-1), is a protein ligand that in humans is encoded by the CXCL13 gene. CXCL13 is a small chemokine belonging to the CXC chemokine family. As its name suggests, this chemokine is selectively chemotactic for B cells belonging to both the B-1 and B-2 subsets, and elicits its effects by interacting with chemokine receptor CXCR5.
CXCL13 and its receptor CXCR5 control the organization of B cells within follicles of lymphoid tissues, and is expressed highly in the liver, spleen, lymph nodes, and gut of humans. The gene for CXCL13 is located on human chromosome 4 in a cluster of other CXC chemokines.
In T lymphocytes, CXCL13 expression is thought to reflect a germinal center origin of the T cell, particularly a subset of T cells called follicular B helper T cells (or TFH cells). Hence, expression of CXCL13 in T-cell lymphomas, such as Angioimmunoblastic T-cell Lymphoma, is thought to reflect a germinal center origin of the neoplastic T-cells.
The need for therapies that target CXCL13-mediated signaling pathways has become increasingly apparent in the recent years. The mechanisms of action for such treatments would include, e.g., blockade of CXCL13 interaction with its receptor resulting in interference with B cell and follicular B-helper T cell migration into inflamed tissues and germinal center formation (e.g., in the case of autoimmune disease) and inhibition of cancer cell proliferation and ability to spread in oncological disorders.
The present disclosure provides antibodies or fragments thereof having binding specificity to the human chemokine (C-X-C motif) ligand 13 (CXCL13) protein, as well as bispecific antibodies having specificity to CXCL13 and another antigen such as BAFF and IFNαRI. These antibodies and fragments are useful in the treatment of autoimmune diseases as well as cancer.
One embodiment of the present disclosure provides an antibody or fragment thereof having specificity to a human chemokine (C-X-C motif) ligand 13 (CXCL13) protein, wherein the antibody or fragment thereof comprises a heavy chain variable region comprising heavy chain complementarity determining regions HCDR1, HCDR2, and HCDR3, and a light chain variable region comprising light chain complementarity determining regions LCDR1,
In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCD2 and LCDR3 comprise SEQ ID NO:127, 129, 367, 360, 132 and 133, respectively. In some embodiments,
In some embodiments, the antibody or fragment thereof is humanized and wherein the heavy chain variable region comprises one or more back mutations selected from the group consisting of 5Q, 47I, 48G, and 85V, according to Kabat numbering, and combinations thereof, or wherein the light chain variable region comprises a mutation 78V according to Kabat numbering.
In some embodiments, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO:181, and the light chain variable region comprises the amino acid sequence of SEQ ID NO:179.
In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCD2 and LCDR3 comprise SEQ ID NO: 127, 129, 359, 360, 132 and 133, respectively. In some embodiments, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO:174 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 174, and the light chain variable region comprises the amino acid sequence of SEQ ID NO: 179 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:179.
In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCD2 and LCDR3 comprise SEQ ID NO: 127, 129, 359, 360, 132 and 361, respectively. In some embodiments, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO:174 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:174, and the light chain variable region comprises the amino acid sequence of SEQ ID NO: 175 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:175.
In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCD2 and LCDR3 comprise SEQ ID NO:127, 129, 130, 131, 132 and 133, respectively. In some embodiments, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO:156 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:156, and the light chain variable region comprises the amino acid sequence of SEQ ID NO: 138 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:138.
In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCD2 and LCDR3 comprise SEQ ID NO:127, 128, 130, 131, 132 and 133, respectively. In some embodiments, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO:134 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:134, and the light chain variable region comprises the amino acid sequence of SEQ ID NO: 138 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:138.
In some embodiments, the antibody or fragment thereof is humanized and the heavy chain variable region comprises one or more back mutations selected from the group consisting of 5Q, 47I, 48G, and 85V, according to Kabat numbering, and combinations thereof, or wherein the light chain variable region comprises a mutation 78V according to Kabat numbering.
Also provided, in one embodiment, is an antibody or fragment thereof having specificity to a human chemokine (C-X-C motif) ligand 13 (CXCL13) protein, wherein the antibody or fragment thereof can bind to one or more amino acid residues selected from the group consisting of F20, P22, R24 and F25 of the CXCL13 protein.
In some embodiments, the antibody or fragment thereof can bind to F20 and P22, F20 and R24, F20 an F25, P22 and R24, P22 and F25, or R24 and F25 of the CXCL13 protein. In some embodiments, the antibody or fragment thereof can bind to of F20, P22, and R24; F20, P22, and F25; F20, R24 and F25; or P22, R24 and F25 of the CXCL13 protein. In some embodiments, the antibody or fragment thereof can bind to F20, P22, R24 and F25 of the CXCL13 protein. In some embodiments, the antibody or fragment thereof can further bind to the cynomolgus CXCL13 protein.
In one embodiment, provided is a bispecific antibody, comprising a first antigen-binding portion having specificity to a human chemokine (C-X-C motif) ligand 13 (CXCL13) protein and a second antigen-binding portion having specificity to a human B-cell-activating factor (BAFF) protein, wherein the first antigen-binding portion comprises an antibody fragment of the present disclosure. In some embodiments, the bispecific antibody has a format comprising a full antibody fused to two single chain fragments (scFv) or to two Fab fragments. In some embodiments, the second portion comprises an antigen-binding fragment of Belimumab.
Methods and uses are also provided. In one embodiment, a method of suppressing an immune response or treating an autoimmune disease or disorder in a patient in need thereof is provided, comprising administering to the patient the antibody or fragment thereof of a bispecific antibody of the present disclosure.
In one embodiment, provided is a method of treating cancer in a patient in need thereof, comprising administering to the patient the antibody or fragment thereof.
It is to be noted that the term “a” or “an” entity refers to one or more of that entity; for example, “an antibody,” is understood to represent one or more antibodies. As such, the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein.
As used herein, an “antibody” or “antigen-binding polypeptide” refers to a polypeptide or a polypeptide complex that specifically recognizes and binds to an antigen. An antibody can be a whole antibody and any antigen binding fragment or a single chain thereof. Thus the term “antibody” includes any protein or peptide containing molecule that comprises at least a portion of an immunoglobulin molecule having biological activity of binding to the antigen. Examples of such include, but are not limited to a complementarity determining region (CDR) of a heavy or light chain or a ligand binding portion thereof, a heavy chain or light chain variable region, a heavy chain or light chain constant region, a framework (FR) region, or any portion thereof, or at least one portion of a binding protein.
The terms “antibody fragment” or “antigen-binding fragment”, as used herein, is a portion of an antibody such as F(ab′)2, F(ab)2, Fab′, Fab, Fv, scFv and the like. Regardless of structure, an antibody fragment binds with the same antigen that is recognized by the intact antibody. The term “antibody fragment” includes aptamers, spiegelmers, and diabodies. The term “antibody fragment” also includes any synthetic or genetically engineered protein that acts like an antibody by binding to a specific antigen to form a complex.
A “single-chain variable fragment” or “scFv” refers to a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of immunoglobulins. In some aspects, the regions are connected with a short linker peptide of ten to about 25 amino acids. The linker can be rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa. This protein retains the specificity of the original immunoglobulin, despite removal of the constant regions and the introduction of the linker. ScFv molecules are known in the art and are described, e.g., in U.S. Pat. No. 5,892,019.
The term antibody encompasses various broad classes of polypeptides that can be distinguished biochemically. Those skilled in the art will appreciate that heavy chains are classified as gamma, mu, alpha, delta, or epsilon (γ, μ, α, δ, ε) with some subclasses among them (e.g., γ1-γ4). It is the nature of this chain that determines the “class” of the antibody as IgG, IgM, IgA IgG, or IgE, respectively. The immunoglobulin subclasses (isotypes) e.g., IgG1, IgG2, IgG3, IgG4, IgG5, etc. are well characterized and are known to confer functional specialization. Modified versions of each of these classes and isotypes are readily discernable to the skilled artisan in view of the instant disclosure and, accordingly, are within the scope of the instant disclosure. All immunoglobulin classes are clearly within the scope of the present disclosure, the following discussion will generally be directed to the IgG class of immunoglobulin molecules. With regard to IgG, a standard immunoglobulin molecule comprises two identical light chain polypeptides of molecular weight approximately 23,000 Daltons, and two identical heavy chain polypeptides of molecular weight 53,000-70,000. The four chains are typically joined by disulfide bonds in a “Y” configuration wherein the light chains bracket the heavy chains starting at the mouth of the “Y” and continuing through the variable region.
Antibodies, antigen-binding polypeptides, variants, or derivatives thereof of the disclosure include, but are not limited to, polyclonal, monoclonal, multispecific, human, humanized, primatized, or chimeric antibodies, single chain antibodies, epitope-binding fragments, e.g., Fab, Fab′ and F(ab′)2, Fd, Fvs, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv), fragments comprising either a VK or VH domain, fragments produced by a Fab expression library, and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to LIGHT antibodies disclosed herein). Immunoglobulin or antibody molecules of the disclosure can be of any type (e.g., IgG, IgE, IgM, IgD, IgA, and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass of immunoglobulin molecule.
Light chains are classified as either kappa or lambda (K, λ). Each heavy chain class may be bound with either a kappa or lambda light chain. In general, the light and heavy chains are covalently bonded to each other, and the “tail” portions of the two heavy chains are bonded to each other by covalent disulfide linkages or non-covalent linkages when the immunoglobulins are generated either by hybridomas, B cells or genetically engineered host cells. In the heavy chain, the amino acid sequences run from an N-terminus at the forked ends of the Y configuration to the C-terminus at the bottom of each chain.
Both the light and heavy chains are divided into regions of structural and functional homology. The terms “constant” and “variable” are used functionally. In this regard, it will be appreciated that the variable domains of both the light (VK) and heavy (VH) chain portions determine antigen recognition and specificity. Conversely, the constant domains of the light chain (CK) and the heavy chain (CH1, CH2 or CH3) confer important biological properties such as secretion, transplacental mobility, Fc receptor binding, complement binding, and the like. By convention the numbering of the constant region domains increases as they become more distal from the antigen-binding site or amino-terminus of the antibody. The N-terminal portion is a variable region and at the C-terminal portion is a constant region; the CH3 and CK domains actually comprise the carboxy-terminus of the heavy and light chain, respectively.
As indicated above, the variable region allows the antibody to selectively recognize and specifically bind epitopes on antigens. That is, the VK domain and VH domain, or subset of the complementarity determining regions (CDRs), of an antibody combine to form the variable region that defines a three dimensional antigen-binding site. This quaternary antibody structure forms the antigen-binding site present at the end of each arm of the Y. More specifically, the antigen-binding site is defined by three CDRs on each of the VH and VK chains (i.e. CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2 and CDR-L3). In some instances, e.g., certain immunoglobulin molecules derived from camelid species or engineered based on camelid immunoglobulins, a complete immunoglobulin molecule may consist of heavy chains only, with no light chains. See, e.g., Hamers-Casterman et al., Nature 363:446-448 (1993).
In naturally occurring antibodies, the six “complementarity determining regions” or “CDRs” present in each antigen-binding domain are short, non-contiguous sequences of amino acids that are specifically positioned to form the antigen-binding domain as the antibody assumes its three dimensional configuration in an aqueous environment. The remainder of the amino acids in the antigen-binding domains, referred to as “framework” regions, show less inter-molecular variability. The framework regions largely adopt a β-sheet conformation and the CDRs form loops which connect, and in some cases form part of, the β-sheet structure. Thus, framework regions act to form a scaffold that provides for positioning the CDRs in correct orientation by inter-chain, non-covalent interactions. The antigen-binding domain formed by the positioned CDRs defines a surface complementary to the epitope on the immunoreactive antigen. This complementary surface promotes the non-covalent binding of the antibody to its cognate epitope. The amino acids comprising the CDRs and the framework regions, respectively, can be readily identified for any given heavy or light chain variable region by one of ordinary skill in the art, since they have been precisely defined (see “Sequences of Proteins of Immunological Interest,” Kabat, E., et al., U.S. Department of Health and Human Services, (1983); and Chothia and Lesk, J. Mol. Biol., 196:901-917 (1987)).
In the case where there are two or more definitions of a term which is used and/or accepted within the art, the definition of the term as used herein is intended to include all such meanings unless explicitly stated to the contrary. A specific example is the use of the term “complementarity determining region” (“CDR”) to describe the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. This particular region has been described by Kabat et al., U.S. Dept. of Health and Human Services, “Sequences of Proteins of Immunological Interest” (1983) and by Chothia et al., J. Mol. Biol. 196:901-917 (1987), which are incorporated herein by reference in their entireties. The CDR definitions according to Kabat and Chothia include overlapping or subsets of amino acid residues when compared against each other. Nevertheless, application of either definition to refer to a CDR of an antibody or variants thereof is intended to be within the scope of the term as defined and used herein. The appropriate amino acid residues which encompass the CDRs as defined by each of the above cited references are set forth in the table below as a comparison. The exact residue numbers which encompass a particular CDR will vary depending on the sequence and size of the CDR. Those skilled in the art can routinely determine which residues comprise a particular CDR given the variable region amino acid sequence of the antibody.
Antibodies disclosed herein may be from any animal origin including birds and mammals. Preferably, the antibodies are human, murine, donkey, rabbit, goat, guinea pig, camel, llama, horse, or chicken antibodies. In another embodiment, the variable region may be condricthoid in origin (e.g., from sharks).
As used herein, the term “heavy chain constant region” includes amino acid sequences derived from an immunoglobulin heavy chain. A polypeptide comprising a heavy chain constant region comprises at least one of: a CH1 domain, a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, or a variant or fragment thereof. For example, an antigen-binding polypeptide for use in the disclosure may comprise a polypeptide chain comprising a CH1 domain; a polypeptide chain comprising a CH1 domain, at least a portion of a hinge domain, and a CH2 domain; a polypeptide chain comprising a CH1 domain and a CH3 domain; a polypeptide chain comprising a CH1 domain, at least a portion of a hinge domain, and a CH3 domain, or a polypeptide chain comprising a CH1 domain, at least a portion of a hinge domain, a CH2 domain, and a CH3 domain. In another embodiment, a polypeptide of the disclosure comprises a polypeptide chain comprising a CH3 domain. Further, an antibody for use in the disclosure may lack at least a portion of a CH2 domain (e.g., all or part of a CH2 domain). As set forth above, it will be understood by one of ordinary skill in the art that the heavy chain constant region may be modified such that they vary in amino acid sequence from the naturally occurring immunoglobulin molecule.
The heavy chain constant region of an antibody disclosed herein may be derived from different immunoglobulin molecules. For example, a heavy chain constant region of a polypeptide may comprise a CH1 domain derived from an IgG1 molecule and a hinge region derived from an IgG3 molecule. In another example, a heavy chain constant region can comprise a hinge region derived, in part, from an IgG1 molecule and, in part, from an IgG3 molecule. In another example, a heavy chain portion can comprise a chimeric hinge derived, in part, from an IgG1 molecule and, in part, from an IgG4 molecule.
As used herein, the term “light chain constant region” includes amino acid sequences derived from antibody light chain. Preferably, the light chain constant region comprises at least one of a constant kappa domain or constant lambda domain.
A “light chain-heavy chain pair” refers to the collection of a light chain and heavy chain that can form a dimer through a disulfide bond between the CL domain of the light chain and the CH1 domain of the heavy chain.
As previously indicated, the subunit structures and three dimensional configuration of the constant regions of the various immunoglobulin classes are well known. As used herein, the term “VH domain” includes the amino terminal variable domain of an immunoglobulin heavy chain and the term “CH1 domain” includes the first (most amino terminal) constant region domain of an immunoglobulin heavy chain. The CH1 domain is adjacent to the VH domain and is amino terminal to the hinge region of an immunoglobulin heavy chain molecule.
As used herein the term “CH2 domain” includes the portion of a heavy chain molecule that extends, e.g., from about residue 244 to residue 360 of an antibody using conventional numbering schemes (residues 244 to 360, Kabat numbering system; and residues 231-340, EU numbering system; see Kabat et al., U.S. Dept. of Health and Human Services, “Sequences of Proteins of Immunological Interest” (1983). The CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule. It is also well documented that the CH3 domain extends from the CH2 domain to the C-terminal of the IgG molecule and comprises approximately 108 residues.
As used herein, the term “hinge region” includes the portion of a heavy chain molecule that joins the CH1 domain to the CH2 domain. This hinge region comprises approximately 25 residues and is flexible, thus allowing the two N-terminal antigen-binding regions to move independently. Hinge regions can be subdivided into three distinct domains: upper, middle, and lower hinge domains (Roux et al., J. Immunol 161:4083 (1998)).
As used herein the term “disulfide bond” includes the covalent bond formed between two sulfur atoms. The amino acid cysteine comprises a thiol group that can form a disulfide bond or bridge with a second thiol group. In most naturally occurring IgG molecules, the CH1 and CK regions are linked by a disulfide bond and the two heavy chains are linked by two disulfide bonds at positions corresponding to 239 and 242 using the Kabat numbering system (position 226 or 229, EU numbering system).
As used herein, the term “chimeric antibody” will be held to mean any antibody wherein the immunoreactive region or site is obtained or derived from a first species and the constant region (which may be intact, partial or modified in accordance with the instant disclosure) is obtained from a second species. In certain embodiments the target binding region or site will be from a non-human source (e.g. mouse or primate) and the constant region is human.
By “specifically binds” or “has specificity to,” it is generally meant that an antibody binds to an epitope via its antigen-binding domain, and that the binding entails some complementarity between the antigen-binding domain and the epitope. According to this definition, an antibody is said to “specifically bind” to an epitope when it binds to that epitope, via its antigen-binding domain more readily than it would bind to a random, unrelated epitope. The term “specificity” is used herein to qualify the relative affinity by which a certain antibody binds to a certain epitope. For example, antibody “A” may be deemed to have a higher specificity for a given epitope than antibody “B,” or antibody “A” may be said to bind to epitope “C” with a higher specificity than it has for related epitope “D.”
As used herein, the terms “treat” or “treatment” refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder, such as the progression of cancer. Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable. “Treatment” can also mean prolonging survival as compared to expected survival if not receiving treatment. Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
By “subject” or “individual” or “animal” or “patient” or “mammal,” is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired. Mammalian subjects include humans, domestic animals, farm animals, and zoo, sport, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows, and so on.
As used herein, phrases such as “to a patient in need of treatment” or “a subject in need of treatment” includes subjects, such as mammalian subjects, that would benefit from administration of an antibody or composition of the present disclosure used, e.g., for detection, for a diagnostic procedure and/or for treatment.
Anti-CXCL13 Antibodies
The present disclosure provides antibodies, including bispecific antibodies and fragments, that have binding specificity to the human chemokine (C-X-C motif) ligand 13 (CXCL13) protein. As demonstrated in the experimental examples, numerous murine anti-human CXCL13 antibodies were obtained, having high binding affinity to the human CXCL13 protein. Some of them can also cross react with cynomolgus, and mouse CXCL13 proteins.
Four of the murine antibody clones, 21H12D9, 64C10G1, 71F4A3, and 411A11E9, were selected for further humanization and characterization. The humanized antibodies retained high binding activity to the CXCL13 protein, inhibited CXCL13 induced calcium flux, blocked CXCL13 mediated IP1 signaling, blocked CXCL13 derived cell migration, inhibited production of anti-KLH specific IgG, neutralized CXCL13 in peripheral blood, and blocked germinal center (GC) B cell production, class switch, and GC formation. In in vivo tests, the antibodies were able to inhibit primary splenocytes migration toward CXCL13, and decrease GC B cell population.
Interestingly, the antibodies that cross bind human and cynomolgus CXCL13 bound to the same epitope of CXCL13. The epitope included amino acid residues F20, P22, R24 and F25 on the human protein.
In accordance with one embodiment of the present disclosure, provided are antibodies and fragments thereof that include the heavy chain and light chain variable domains with the CDR regions of the antibodies prepared in the experimental examples. The CDRs are summarized in Table A below.
In some embodiments, the VH CDR1, CDR2, and CDR3 are selected from any set of VH CDR1, CDR2, and CDR3 shown in Table A, and the VL CDR1, CDR2, and CDR3 are selected from any set of VL CDR1, CDR2, and CDR3 shown in Table A. In some embodiments, the VH CDR1, CDR2, and CDR3 and the VL CDR1, CDR2, and CDR3 are selected from those derived from the same antibody in the examples.
In some embodiments, at least one, or two, or three, or four, or five, or six of the VH CDR1, CDR2, and CDR3 and the VL CDR1, CDR2, and CDR3 of the above are modified by one, two or three amino acid additions, deletions, substitutions, or the combinations thereof.
In one embodiment, the anti-CXCL13 antibody or fragment thereof includes the
In some embodiments, the antibody is humanized but with one or more of the following back mutations on the heavy chain: 12V, 20M, 48I, 68A, 70L, 72V, 77G and 112L, according to Kabat numbering, and combinations thereof. In some embodiments, the antibody is humanized but with one or more of the following back mutations on the light chain: 13T and 78V according to Kabat numbering, and combinations thereof.
Non-limiting examples of heavy chain variable regions include SEQ ID NO: 95, and 103-106. Non-limiting example of light chain variable regions include SEQ ID NO: 96, and 107-109.
In one embodiment, the anti-CXCL13 antibody or fragment thereof includes the following CDRs: HCDR1: SYAMS (SEQ ID NO: 112), HCDR2:
In some embodiments, the antibody is humanized but with one or more of the following back mutations on the light chain: 49H, 58I, 71Y, and 83F according to Kabat numbering, and combinations thereof.
Non-limiting examples of heavy chain variable regions include SEQ ID NO: 110, and 120. Non-limiting example of light chain variable regions include SEQ ID NO: 111, and 121-124.
In one embodiment, one or more of the amino acid residues in the CDRs are substituted with a different amino acid to avoid post-translational modification. An example anti-CXCL13 antibody or fragment thereof includes the following CDRs: HCDR1: SYAMS (SEQ ID NO: 112), HCDR2: TISEGGSDAYYPDNVKG (SEQ ID NO:114), HCDR3: DYYGSGYEESPMDY (SEQ ID NO:116), LCDR1: KASQDINKYIA (SEQ ID NO: 117), LCDR2: YTSTLQP (SEQ ID NO: 118), and LCDR3: LQYDNLYT (SEQ ID NO: 119).
In some embodiments, the antibody is humanized but with one or more of the following back mutations on the light chain: 49H, 58I, 71Y, and 83F according to Kabat numbering, and combinations thereof.
Non-limiting examples of heavy chain variable regions include SEQ ID NO: 157. Non-limiting example of light chain variable regions include SEQ ID NO: 111, and 121-124, in particular SEQ ID NO:121.
In one embodiment, the anti-CXCL13 antibody or fragment thereof includes the
In one embodiment, one or more of the amino acid residues in the CDRs are substituted with a different amino acid to avoid post-translational modification. An example anti-CXCL13 antibody or fragment thereof includes the following CDRs: HCDR1: RYWMS
In some embodiments, the antibody is humanized but with one or more of the following back mutations on the heavy chain: 5Q, 47I, 48G, and 85V according to Kabat numbering, and combinations thereof. In some embodiments, the antibody is humanized but with one or more of the following back mutation on the light chain: 78V according to Kabat numbering.
Non-limiting examples of heavy chain variable regions include SEQ ID NO: 125, and 134-137. Non-limiting example of light chain variable regions include SEQ ID NO: 126, and 138-139.
Following humanization, the 71F4A3 antibody further went through rounds of affinity maturation. The CDR sequences from various variants of 71F4A3 are provided in Table B and summarized in Table C below.
In one embodiment, provided is an antibody or fragment thereof having specificity to a human chemokine (C-X-C motif) ligand 13 (CXCL13) protein, wherein the antibody or fragment thereof comprises CDR sequences as listed in Table B or Table C.
In one embodiment, provided is an antibody or fragment thereof having specificity to a human chemokine (C-X-C motif) ligand 13 (CXCL13) protein, wherein the antibody or fragment thereof comprises a heavy chain variable region comprising heavy chain complementarity determining regions HCDR1, HCDR2, and HCDR3, and a light chain variable region comprising light chain complementarity determining regions LCDR1, LCDR2, and LCDR3, wherein: the HCDR1 comprises the amino acid sequence of
In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCD2 and LCDR3 comprise SEQ ID NO: 127, 129, 367, 360, 132 and 133, respectively. In some embodiments, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO:181 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:181, and the light chain variable region comprises the amino acid sequence of SEQ ID NO:179 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:179.
In some embodiments, the antibody or fragment is humanized and wherein the heavy chain variable region comprises one or more back mutations selected from the group consisting of 5Q, 47I, 48G, and 85V, according to Kabat numbering, and combinations thereof, or wherein the light chain variable region comprises a mutation 78V according to Kabat numbering.
In some embodiments, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO:181, and the light chain variable region comprises the amino acid sequence of SEQ ID NO:179.
6 In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCD2 and LCDR3 comprise SEQ ID NO:127, 129, 359, 360, 132 and 133, respectively. In some embodiments, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO:174 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:174, and the light chain variable region comprises the amino acid sequence of SEQ ID NO: 179 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:179.
In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCD2 and LCDR3 comprise SEQ ID NO:127, 129, 359, 360, 132 and 361, respectively. In some embodiments, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO:174 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:174, and the light chain variable region comprises the amino acid sequence of SEQ ID NO:175 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:175.
In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCD2 and LCDR3 comprise SEQ ID NO:127, 129, 130, 131, 132 and 133, respectively. In some embodiments, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO:156 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:156, and the light chain variable region comprises the amino acid sequence of SEQ ID NO: 138 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:138.
In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCD2 and LCDR3 comprise SEQ ID NO:127, 128, 130, 131, 132 and 133, respectively. In some embodiments, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO:134 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:134, and the light chain variable region comprises the amino acid sequence of SEQ ID NO: 138 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:138.
In one embodiment, the anti-CXCL13 antibody or fragment thereof includes the following CDRs: HCDR1: DYYMA (SEQ ID NO: 142), HCDR2:
In some embodiments, the antibody is humanized but with one or more of the following back mutations on the heavy chain: 24V, 70V, 98T and 105A according to Kabat numbering, and combinations thereof. In some embodiments, the antibody is humanized but with one or more of the following back mutations on the light chain: 58I, 71Y, and 87F according to Kabat numbering, and combinations thereof.
Non-limiting examples of heavy chain variable regions include SEQ ID NO: 140, and 148-151. Non-limiting example of light chain variable regions include SEQ ID NO: 141, and 152-155.
It was an interesting discovery that those antibodies that cross-bound to both human and cynomolgus CXCL13 proteins target an epitope that is different from known anti-CXCL13 antibodies. Accordingly, in one embodiment, provided is an antibody or fragment thereof having specificity to a human chemokine (C-X-C motif) ligand 13 (CXCL13) protein, wherein the antibody or fragment thereof can bind to one or more amino acid residues selected from the group consisting of F20, P22, R24 and F25 of the CXCL13 protein.
In some embodiments, the antibody or fragment thereof can bind to F20 and P22, F20 and R24, F20 an F25, P22 and R24, P22 and F25, or R24 and F25 of the CXCL13 protein. In some embodiments, the antibody or fragment thereof can bind to of F20, P22, and R24; F20, P22, and F25; F20, R24 and F25; or P22, R24 and F25 of the CXCL13 protein.
In some embodiments, the antibody or fragment thereof can bind to F20, P22, R24 and F25 of the CXCL13 protein. In some embodiments, the antibody or fragment thereof can further bind to the cynomolgus CXCL13 protein.
The CDRs, heavy chain variable regions and light chain variable regions of the present disclosure can be further modified. In some embodiments, the modified heavy chain variable region or light chain variable region retains at least about 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% sequence identity and is still capable of binding to CXCL13.
In some embodiments, the modification is substitution at no more than one hot spot position from each of the CDRs. In some embodiments, the modification is substitution at one, two or three such hot spot positions. In one embodiment, the modification is substitution at one of the hot spot positions. Such substitutions, in some embodiments, are conservative substitutions.
A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a nonessential amino acid residue in an immunoglobulin polypeptide is preferably replaced with another amino acid residue from the same side chain family. In another embodiment, a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members.
Non-limiting examples of conservative amino acid substitutions are provided in the table below, where a similarity score of 0 or higher indicates conservative substitution between the two amino acids.
It will also be understood by one of ordinary skill in the art that antibodies as disclosed herein may be modified such that they vary in amino acid sequence from the naturally occurring binding polypeptide from which they were derived. For example, a polypeptide or amino acid sequence derived from a designated protein may be similar, e.g., have a certain percent identity to the starting sequence, e.g., it may be 60%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the starting sequence.
In certain embodiments, the antibody comprises an amino acid sequence or one or more moieties not normally associated with an antibody. Exemplary modifications are described in more detail below. For example, an antibody of the disclosure may comprise a flexible linker sequence, or may be modified to add a functional moiety (e.g., PEG, a drug, a toxin, or a label).
Antibodies, variants, or derivatives thereof of the disclosure include derivatives that are modified, i.e., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from binding to the epitope. For example, but not by way of limitation, the antibodies can be modified, e.g., by glycosylation, acetylation, pegylation, phosphorylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the antibodies may contain one or more non-classical amino acids.
In some embodiments, the antibodies may be conjugated to therapeutic agents, prodrugs, peptides, proteins, enzymes, viruses, lipids, biological response modifiers, pharmaceutical agents, or PEG.
The antibodies may be conjugated or fused to a therapeutic agent, which may include detectable labels such as radioactive labels, an immunomodulator, a hormone, an enzyme, an oligonucleotide, a photoactive therapeutic or diagnostic agent, a cytotoxic agent, which may be a drug or a toxin, an ultrasound enhancing agent, a non-radioactive label, a combination thereof and other such agents known in the art.
Bi-Functional Molecules
Bi-functional molecules such as bispecific antibodies are also provided. In one embodiment, the bi-functional molecule has a first specificity to CXCL13 as well as a second specificity. The second specificity, in one embodiment is to another cytokine or to an immune cell.
For instance, B-cell activating factor (BAFF), also known as tumor necrosis factor ligand superfamily member 13B, is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFF-R. This cytokine is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells. The anti-BAFF specificity can be derived from an anti-BAFF antibody such as Belimumab.
In another example, the second specificity can be at IFNαRI (interferon-alpha/beta receptor alpha chain, or IFNAR1). Type I IFNs, particularly the IFN-αs and IFN-β, have received attention for their roles in the pathogenesis autoimmune and inflammatory syndromes. By signaling through a common receptor (IFNAR), these pleiotropic cytokines affect almost every aspect of innate and adaptive immune responses, including upregulation of MHC and costimulatory molecules, and production of B cell survival factors (BAFF, April) by antigen-presenting cells, culminating in the engagement and expansion of autoreactive T and B cells.
In some embodiments, the immune cell is selected from the group consisting of a T cell, a B cell, a monocyte, a macrophage, a neutrophil, a dendritic cell, a phagocyte, a natural killer cell, an eosinophil, a basophil, and a mast cell. Molecules on the immune cell which can be targeted include, for example, CD3, CD16, CD19, CD28, and CD64. Other examples include PD-1, CTLA-4, LAG-3 (also known as CD223), CD28, CD122, 4-1BB (also known as CD137), TIM3, OX-40 or OX40L, CD40 or CD40L, LIGHT, ICOS/ICOSL, GITR/GITRL, TIGIT, CD27, VISTA, B7H3, B7H4, HEVM or BTLA (also known as CD272), killer-cell immunoglobulin-like receptors (KIRs), and CD47.
The anti-CXCL13 specificity can also be combined with specificity to a tumor antigen. A “tumor antigen” is an antigenic substance produced in tumor cells, i.e., it triggers an immune response in the host. Tumor antigens are useful in identifying tumor cells and are potential candidates for use in cancer therapy. Normal proteins in the body are not antigenic. Certain proteins, however, are produced or overexpressed during tumorigenesis and thus appear “foreign” to the body. This may include normal proteins that are well sequestered from the immune system, proteins that are normally produced in extremely small quantities, proteins that are normally produced only in certain stages of development, or proteins whose structure is modified due to mutation.
An abundance of tumor antigens are known in the art and new tumor antigens can be readily identified by screening. Non-limiting examples of tumor antigens include EGFR, Her2, EpCAM, CD20, CD30, CD33, CD47, CD52, CD133, CD73, CEA, gpA33, Mucins, TAG-72, CIX, PSMA, folate-binding protein, GD2, GD3, GM2, VEGF, VEGFR, Integrin, αVβ3, α5β1, ERBB2, ERBB3, MET, IGF1R, EPHA3, TRAILR1, TRAILR2, RANKL, FAP and Tenascin.
Different format of bispecific antibodies are also provided. In some embodiments, each of the anti-CXCL13 fragment and the second fragment each is independently selected from a Fab fragment, a single-chain variable fragment (scFv), or a single-domain antibody. In some embodiments, the bispecific antibody further includes a Fc fragment.
Polynucleotides Encoding the Antibodies and Methods of Preparing the Antibodies
The present disclosure also provides isolated polynucleotides or nucleic acid molecules encoding the antibodies, variants or derivatives thereof of the disclosure. The polynucleotides of the present disclosure may encode the entire heavy and light chain variable regions of the antigen-binding polypeptides, variants or derivatives thereof on the same polynucleotide molecule or on separate polynucleotide molecules. Additionally, the polynucleotides of the present disclosure may encode portions of the heavy and light chain variable regions of the antigen-binding polypeptides, variants or derivatives thereof on the same polynucleotide molecule or on separate polynucleotide molecules.
Methods of making antibodies are well known in the art and described herein. In certain embodiments, both the variable and constant regions of the antigen-binding polypeptides of the present disclosure are fully human. Fully human antibodies can be made using techniques described in the art and as described herein. For example, fully human antibodies against a specific antigen can be prepared by administering the antigen to a transgenic animal which has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled. Exemplary techniques that can be used to make such antibodies are described in U.S. Pat. Nos. 6,150,584; 6,458,592; 6,420,140 which are incorporated by reference in their entireties.
Treatment and Diagnostic Methods
As described herein, the antibodies, variants or derivatives of the present disclosure may be used in certain treatment and diagnostic methods.
The present disclosure is further directed to antibody-based therapies which involve administering the antibodies of the disclosure to a patient such as an animal, a mammal, and a human for treating one or more of the disorders or conditions described herein. Therapeutic compounds of the disclosure include, but are not limited to, antibodies of the disclosure (including variants and derivatives thereof as described herein) and nucleic acids or polynucleotides encoding antibodies of the disclosure (including variants and derivatives thereof as described herein).
One embodiment provides a method of suppressing an immune response in a patient in need thereof. The method entails administering to the patient an antibody, fragment, or bi-functional molecule of the present disclosure. In some embodiments, the patient is a tissue or organ transplant recipient.
In some embodiments, a method of treating an autoimmune disease or disorder is provided. Non-limiting examples of autoimmune disease or disorder include type 1 diabetes, rheumatoid arthritis (RA), psoriasis/psoriatic arthritis, multiple sclerosis, systemic lupus erythematosus (lupus), inflammatory bowel disease, Addison's disease, Graves' disease, Sjögren's syndrome, Hashimoto's thyroiditis, myasthenia gravis, vasculitis, pernicious anemia, and celiac disease.
The antibodies of the disclosure can also be used to treat or inhibit cancer. Accordingly, in some embodiments, provided are methods for treating a cancer in a patient in need thereof. The method, in one embodiment, entails administering to the patient an effective amount of an antibody of the present disclosure. Non-limiting examples of cancers include bladder cancer, liver cancer, colon cancer, rectal cancer, endometrial cancer, leukemia, lymphoma, pancreatic cancer, small cell lung cancer, non-small cell lung cancer, breast cancer, urethral cancer, head and neck cancer, gastrointestinal cancer, stomach cancer, oesophageal cancer, ovarian cancer, renal cancer, melanoma, prostate cancer and thyroid cancer.
Additional diseases or conditions associated with increased cell survival, that may be treated, prevented, diagnosed and/or prognosed with the antibodies or variants, or derivatives thereof of the disclosure include, but are not limited to, progression, and/or metastases of malignancies and related disorders such as leukemia (including acute leukemias (e.g., acute lymphocytic leukemia, acute myelocytic leukemia (including myeloblastic, promyelocytic, myelomonocytic, monocytic, and erythroleukemia)) and chronic leukemias (e.g., chronic myelocytic (granulocytic) leukemia and chronic lymphocytic leukemia)), polycythemia vera, lymphomas (e.g., Hodgkin's disease and non-Hodgkin's disease), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors including, but not limited to, sarcomas and carcinomas such as fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyo sarcoma, colon carcinoma, pancreatic cancer, breast cancer, thyroid cancer, endometrial cancer, melanoma, prostate cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, testicular tumor, lung carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, melanoma, neuroblastoma and retinoblastoma.
A specific dosage and treatment regimen for any particular patient will depend upon a variety of factors, including the particular antibodies, variant or derivative thereof used, the patient's age, body weight, general health, sex, and diet, and the time of administration, rate of excretion, drug combination, and the severity of the particular disease being treated. Judgment of such factors by medical caregivers is within the ordinary skill in the art. The amount will also depend on the individual patient to be treated, the route of administration, the type of formulation, the characteristics of the compound used, the severity of the disease, and the desired effect. The amount used can be determined by pharmacological and pharmacokinetic principles well known in the art.
Methods of administration of the antibodies, variants or include but are not limited to intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes. The antigen-binding polypeptides or compositions may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Thus, pharmaceutical compositions containing the antigen-binding polypeptides of the disclosure may be administered orally, rectally, parenterally, intracistemally, intravaginally, intraperitoneally, topically (as by powders, ointments, drops or transdermal patch), bucally, or as an oral or nasal spray.
The term “parenteral” as used herein refers to modes of administration which include intravenous, intramuscular, intraperitoneal, intrasternal, subcutaneous and intra-articular injection and infusion.
Administration can be systemic or local. In addition, it may be desirable to introduce the antibodies of the disclosure into the central nervous system by any suitable route, including intraventricular and intrathecal injection; intraventricular injection may be facilitated by an intraventricular catheter, for example, attached to a reservoir, such as an Ommaya reservoir. Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent.
It may be desirable to administer the antigen-binding polypeptides or compositions of the disclosure locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, e.g., in conjunction, with a wound dressing after surgery, by injection, by means of a catheter, by means of a suppository, or by means of an implant, said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers. Preferably, when administering a protein, including an antibody, of the disclosure, care must be taken to use materials to which the protein does not absorb.
Methods of detecting expression of a human chemokine (C-X-C motif) ligand 13 (CXCL13) protein in a sample are also provided, in some embodiments, comprising contacting the sample with the antibody or fragment thereof, and detecting the binding which indicates expression of CXCL13 in the sample.
Compositions
The present disclosure also provides pharmaceutical compositions. Such compositions comprise an effective amount of an antibody, and an acceptable carrier. In some embodiments, the composition further includes a second anticancer agent (e.g., an immune checkpoint inhibitor).
In a specific embodiment, the term “pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. Further, a “pharmaceutically acceptable carrier” will generally be a non-toxic solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type.
The term “carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents such as acetates, citrates or phosphates. Antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; and agents for the adjustment of tonicity such as sodium chloride or dextrose are also envisioned. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like. The composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides. Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical carriers are described in Remington's Pharmaceutical Sciences by E. W. Martin, incorporated herein by reference. Such compositions will contain a therapeutically effective amount of the antigen-binding polypeptide, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient. The formulation should suit the mode of administration. The parental preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
In an embodiment, the composition is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings. Typically, compositions for intravenous administration are solutions in sterile isotonic aqueous buffer. Where necessary, the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection. Generally, the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
The compounds of the disclosure can be formulated as neutral or salt forms. Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
This example shows generation of anti-human-CXCL13 mouse monoclonal antibodies using the hybridoma technology.
Immunizations
Recombinant human CXCL13 proteins were used as the immunogen to raise anti-human CXCL13 antibodies. C57BL/6, Balb/c, SJL mice or wistar rats were first immunized subcutaneously (s.c.). with 50 μg immunogen and then immunized intraperitoneally (i.p.). or s.c. biweekly with 25 μg immunogen. Immune response was monitored by retroorbital bleeds. Plasma was screened by ELISA binding assay. In short, human CXCL13 or mouse CXCL13 or cynomolgus CXCL13 was coated at 0.5 μg/ml overnight and then blocked by 5% BSA in PBS. Serial diluted sera were incubated with the coated antigen for 1 h at room temperature (RT). The resulting plates were washed with PBS/T and incubated with goat anti-mouse IgG-HRP for 1 hour at RT. The plates were developed with TMB substrate and stopped with 1N HCl and analyzed by spectrophotometer at OD 450-630 nm. The mice with high titers of anti-CXCL13 immunoglobulin were selected for fusion and further screening. Four days prior to sacrifice and removal of the spleens, the mice were boosted i.p. with 25 μg antigen. The spleens were used for fusion.
Fusion and Hybridoma Screening
Splenocytes were electro-fused with mouse myeloma cell line SP2/0 cells and plated into 96-well culture plate. The hybridoma supernatants were tested by ELISA binding assay for anti-human CXCL13 binders. Supernatants of positive binding clones were screened for function in blocking of human CXCL13 binding to its ligand CXCR5 by Cell-based receptor blocking ELISA assay. Briefly, 5×104 CHO-K1-CXCR5 cells were plated in 96-well plate with 100 μl of culture medium and incubated at 37° C. overnight. Cells were fixed with 100 μl of 2% PFA at RT for 1 hr after washing with PBS for 1 time. Blocking was done with 1% BSA in PBST for 1 hr at RT. Supernatants were diluted with PBS and pre-incubated with equal volume of 0.3 μg/ml human CXCL13 for 30 min at RT. 100 μl of antibody-antigen complex was then transferred into each cell wells for 30 min at RT. The samples were washed with 1×PBST for 3 times and 100 μl of 3 μg/ml of human Mab5261 antibody was add into each well to capture human CXCL13 and anti-human Fc-HRP was used to indirectly detect human CXCL13 when it bound to CHO-K1-CXCR5 cells. The secondary antibody was revealed by 100 μl of TMB and stopped with 100 μl 1N HCl. Reading was done at 450 nM.
Clones showing strong blocking ability in this assay were selected for subcloning. Supernatants of one-round subclones were used to confirm ELISA-based human CXCL13 or mouse CXCL13 or cynomolgus CXCL13 binding and receptor blocking ability, followed by sequencing and further analysis. After these screenings, 20 clones (329F2E1, 348B10B1, 360A3D4E3, 414D10F5, 339A9E7, 339H3E2, 367F1C2, 21H12D9, 408E3F3, 415A3D1F4, 348E12F12, 368D6D10, 1H3A11, 355A1F6, 353F9C4, 19H7E10, 411A11E9, 64C10G1, 397C3B3) that cross bound to human CXCL13 and cynomolgus CXCL13 were identified and 14 clones (402H2G12, 409G9C2, 410A4D10, 414G3F4, 416C9H8, 418D3H6, 423A6H6, 424H7F2, 427C4F11, 430D9B3, 432C12E1, 442C9H4, 445A6G7, 537C8D7) that cross bound to human CXCL13 and mouse CXCL13 were identified, and 13 clones (119H10D6, 30D6G1, 156H3H7, 168A2D4, 168D6F2, 175E3B10, 177D2G10, 178B2E8, 178E2B3, 181B11G12, 184H10B5, 345G1B4, 396A5A1) that only bound to human CXCL13 were identified.
Those antibodies were purified from hybridoma supernatants by binding with Protein G column and characterized by ELISA binding assays and cell-based blocking ELISA assays. The binding and blocking properties are listed in Table 1 and sequences of all the clones are listed in Table 2. 27 clones binding to only huCXCL13 or binding to both huCXCL13 and mouse CXCL13 showed completely or partially blocking activity. 11/20 clones bound to both human CXCL13 and cynomolgus CXCL13 appeared to completely block human CXCL13 to human CXCR5. 11 blockers bound to both huCXCL13 and cynoCXCL13 were produced as chimeric human IgG1 antibodies for further Characterization.
This example tested the blocking of the anti-CXCL13 chimeric antibodies to CHO-K1-CXCR5 cells. Briefly, 5×104 CHO-K1-CXCR5 cells were plated in 96-well plate with 100 μl of culture medium and incubated at 37° C. overnight. Cells were fixed with 100 μl of 2% PFA at RT for 1 hr after washing with PBS for 1 time. Samples were blocked with 1% BSA in PBST for 1 hr at RT. Antibodies were serial diluted from 50 μg/ml by 3-fold with 1% BSA/PBST and pre-incubated with equal volume of 0.3 μg/ml human CXCL13 for 30 min at RT. 100 μl of antibody-antigen complex was transferred into each cell wells for 30 min at RT. Samples were washed with 1×PBST for 3 times and 100 μl of 3 μg/ml of human Mab5261 antibody was added into each well to capture human CXCL13 and anti-human Fc-HRP was used to indirectly detect human CXCL13 when it bound to CHO-K1-CXCR5 cells.
The secondary antibody was revealed by 100 μl of TMB and stopped with 100 μl 1N HCl. Then read at 450 nM. IC50 values were summarized in Table 3, which showed IC50 of blocking properties. Among all clones, 415A3D1, 64C10G1, 1H3A11, 414D10F5, 411A11E9, 21H12D9, 71F4A3, 329F2E1 show completely blocking activity and 408E3F3, 19H7E10, 339A6E7 appeared to be partial blockers.
Elisa based binding assay. Antibodies that functionally blocked human CXCL13 were more fully characterized for binding to huCXCL13 and cynoCXCL13. Briefly, 100 μl of human CXCL13 or cynomolgus CXCL13 was coated at 0.5 μg/ml overnight and then blocked by 200 μl of 5% BSA in PBS. Serial diluted antibodies were incubated with the coated antigen for 30 min at RT. The resulting plates were washed with PBS/T and incubated with goat anti-human IgG Fc-HRP for 30 min RT. The plates were developed with TMB substrate after washing with 1×PBST for 5 times and reaction stopped with 1N HCl and analyzed by spectrophotometer at OD 450-630 nm. EC50 values are showed in table 4.
HuCXCL13 binding affinity by Surface Plasmon Resonance. 411A11E9, 415A3D1, 64C10G1, 21H12D9, 329F2E1, 71F4A3 were selected to produce Fab and tested binding affinity. The binding of the antibodies to huCXCL13 was examined by Biacore 8K. 10 mM HEPES, 150 mM NaCl, 3 mM EDTA, 0.05% Tween-20, pH 7.4 served as running buffer and 10 mM glycine-HCl, pH2.0 served as regeneration buffer. CXCL13 protein was immobilized on Sensor Chip CM5 using amine coupling method (immobilization level ˜30RU). The serial concentrations of Fab (0-16 nM) were injected over immobilized CXCL13 at the flow rate of 30 μl/min. The dissociation phases were 600s. The results are shown in Table 5 below.
Inhibition of CXCL13 induced calcium flux by anti-CXCL13 chimeric antibodies. Treatment with then human CXCL13 simulated the intracellular calcium mobilization in CHO-K1-CXCR5 cells. When serially diluted anti-CXCL13 antibodies were added into the assay, the antibodies dose-dependently inhibited calcium flux production in CHO-K1-CXCR5 cells. Based on the result of binding affinity and cell-based blocking, 64C10G1, 1H3A11, 411A11E9, 21H12D9, 71F4A3, 329F2E1, and 415A3D1 were chosen to test in this calcium flux assay.
CHO-K1-CXCR5 cells (1.5×104 cells/well) in medium were coated to a 384-well assay plate. The next day, they were incubated with 0.75 μg/ml rhCXCL13 with or without serially diluted anti-CXCL13 antibodies in assay buffer (HEPES, 20 nM HBSS) at 37° C. for 30 min. The calcium dye working buffer was prepared and added into cells. Then, transfer mix to cells and obtain the fluorescence intensity (FI) by FLIPRTERA. Statistical analyses were performed by the Graphpad Prism (v5.0) software.
As shown in
Blocking of CXCL13 mediated IP1 signaling by anti-CXCL13 chimeric antibodies. CXCL13 bound to ligand CXCR5, which is a G protein-coupled receptor, on CHO-K1-CXCR5 cells can induce the accumulation of inositol monophosphate (IP1), a stable downstream metabolite of IP3 induced by activation of a phospholipase C (PLC) cascade. An IP1 kit (Cisbio) was used to test the blocking efficacy of anti-CXCL13 antibodies. The kit is a competitive immunoassay intended to measure IP1 accumulation in cells by HTRF technology. Native IP1 produced by cells competed with d2-labeled IP1 for binding to anti-IP1-Cryptate. When the CHO-K1-CXCR5 cells are stimulated with CXCL13, the IP1 will be produced by cells and compete with d2-labeled IP1 leading to the detection signal down-regulated compared to without being treated with CXCL13.
0.25 μg/ml CXCL13 was incubated with or without serially diluted anti-CXCL13 antibodies in stimulation medium (F12 culture medium containing 5 mM LiCl, which function is to accumulate IP1) for 20 minutes at RT in a 384-well assay plate. 5×104 cells were transferred into each well. Incubate the plate for 1 hour in a cell incubator (37° C., humidified, 5% CO2). After incubation, IP1-d2 and anti-IP1-Cryptate working solution mix were added into each well. The plate was sealed and incubated for 1 hour at RT. Finally, the seal was removed and the plate was read on the HTRF compatible reader to obtain the value at 665 nm/615 nm.
As shown in
Blocking of BaF3-CXCR5(human) cells migration toward CXCL13. It is known that CXCL13 binds to its receptor CXCR5 and can derive cells migration. To evaluate the inhibition potency of the anti-CXCL13 antibodies in migration assay, human CXCR5 overexpression cell line, BaF3-CXCR5 cells, were used.
The mix of 50 ng/ml CXCL13 was incubated with or without serially diluted anti-CXCL13 antibodies in dilution media (Gey's Balanced Salt Solution+0.1% BSA) in a 96-well culture plate for 30 minutes at RT. Then, transfer 68.5 μl/well mix to the bottom of the 5 μm pore size transwell plate (Corning, 3387). 100 μl/well (6.5×105 cells) BaF3-CXCR5 cells were added into the top chamber. In addition, wells that only had chemotaxis medium added to the bottom plate and cells to top chamber to remove the background signal. After 3 hours incubation in an incubator, the chamber was disassembled and all the volume was transferred from the bottom plate to a 96-well culture plate. 10 μl/well of Resazurin (R&D) was added to the assay plate and the plate was incubated for additional 16-24 hours in an incubator. Fluorescence was measured at wavelengths 544 nm and 590 nm.
The background signal was removed and the GraphPad (v5.0) software was used to obtain the titration fitting curve. In
Inhibition of primary human tonsil cells migration to CXCL13. To further investigate the blocking function of anti-CXCL13 antibodies, the primary human Tonsil cells migration assay was used. The effect of anti-CXCL13 antibodies mentioned above on primary human tonsil cells migration was tested.
Human tonsil tissues were crashed with 1 mL syringe plunger and passed through 70 μm cell strainer. Collect and wash the cells with PBS. Then, obtain lymphocytes by Ficoll. Wash and re-suspend the lymphocytes with chemotaxis medium (RPMI 1640 containing 0.5% BSA). Then, incubate 0.5 μg/ml CXCL13 with serial concentrations antibodies or control IgG in chemotaxis medium at RT for 30 minutes. Transfer 150 μl/well mix to the bottom of the 5 μm pore size 96-well transwell plate (Corning, 3387), and add 50 μl/well human tonsil cells (5×105 cells) to the top chamber. Besides, design wells that only add chemotaxis medium to bottom plate and cells to top chamber to remove the background signal. After incubation 3 hours in an incubator, disassemble the chamber and discard the filter. Add 1.67 μg/ml calcein-AM (ThermoFisher) into the each well and incubate for additional 20 minutes in the incubator. Measure the fluorescence at wavelength 485 nm and 520 nm.
Delete the background fluorescence intensity (FI) from raw data and obtain the histogram by the GraphPad (v5.0) software. As shown in the
In the normal immune response, CXCL13 and its receptor CXCR5 are involved in the homing of B cells and germinal center formation. Ccynomolgus monkeys Immunized with T-cell-dependent antibody response (TDAR) of keyhole limpet hemocyanin (KLH) is a comprehensive immune response model. In this immune response model, we can evaluate the B and T lymphocyte interactions, class switch and germinal center formation through antigen specific antibody production (i.e., IgM to IgG specific antibody response).
Cynomolgus monkey were randomized into 2 groups (3 monkeys/group) and immunized with 1 ml 10 mg/ml KLH by intramuscular injection on Day 0. 30 mg/kg anti-CXCL13 chimeric antibody 64C10G1 was administered via intravenous injection to alternating peripheral vessels on day-1, 4, 9. Equal volume Saline was administered at the same time of control group monkeys. The serum was collected from the Cephalic or femoral vein on day −4, −1, 4, 9 and 14 for anti-KLH-specific IgG/IgM detection. Elisa for the serum level of monkey anti-KLH IgG and IgM was performed according to the manufacturer's instruction (Life Diagnostics, KLHM-3-INT and KLHG-3-INT). On the day 14, collect the whole blood and obtain the peripheral blood mononuclear cells (PBMC) by Ficoll. Analyze the B cell population (CD20+, Biolegend) and CXCR5 (Thermofisher) expression on B cell surface by flow cytometer (Becton-Dickinson). Data acquisition and analysis were conducted using flowjo software.
As shown in
We obtained a surrogate anti-CXCL13 antibody 424H7F2 which could cross bind to mouse CXCL13 from hybridoma screening mentioned in Example 1. To investigate the blocking activity, we tested the effect of 424H7F2 on rmCXCL13 induced primary mouse splenocytes migration.
Sacrificed the C57BL/6 mice on day 10 which were immunized with MOG35-55 peptide with adjuvant and obtained their spleens. Spleens were crashed 1-ml syringe plunger and passed through 40 μm cell strainer. Red blood cells were lysed with lysis buffer. The cells were filtered and washed with chemotaxis medium. 1 μg/ml rmCXCL13 (R&D) were incubated with different concentrations anti-CXCL13 antibody 424H7F2 or control IgG at room temperature for 30 minutes. Then, transfer 150 μl/well Mix to the bottom of a 0.5 μm transwell plate and 50 μl/well splenocytes (1×107/ml) to the top chamber. Incubate the transwell plate in a cell incubator for 3 hours. Finally, discard the filter and add 1.67 μg/ml calcium-am to each well, and incubate additional 20 minutes. Fluorescence is measured at wavelengths of 485 nm and 520 nm.
As the result in
To determine if the anti-CXCL13 antibody can mediated inhibition of CXCL13 function in germinal center (GC) formation in secondary lymphoid organs and isotype class switching by naïve B cells, C57BL/6 mice were immunized with NP-CGG (100 μg/mouse) via intraperitoneal injection on day 0 and injected 30 mg/kg anti-CXCL13 antibody 424H7F2 or PBS via intraperitoneal on day −1, 2, 5, 8, 11. On day 14, sacrifice the mice and analyze the population of germinal center B cells (B220+IgD−GL7+Fas+), class switch (B220+IgD−GL7+IgM−IgG1+) by flow cytometry in spleen, the high affinity NP-specific (NP5) IgG1 level by Elisa in serum, and GC formation by IHC staining (IgD−PNA+) in spleen.
The GC B cells population was significantly decreased by anti-CXCL13 antibody 424H7F2 treated in the mouse spleen compare to control group (
The epitope binning results showed all the anti-CXCL13 antibodies cross binding to cynomolgus had a same epitope, including 64C10G1, 21H12D9, 329F2E1, 411A11E9, 71F4A3 and 1H3A11. We used the 64C10G1 to do epitope mapping to identify the critical binding residues to antigen CXCL13. Besides, for the screening, a control antibody was synthesized according to the sequence in a published patent (WO2012/031099 A2).
Cells were transfected with different WT construct or 64C10G1 Fab mutant construct which each amino acid was mutant to alanine, totally 87 amino acids. Then, binding of the test Fab to each mutant clone in the alanine scanning library was determined, in duplicate, by high-throughput flow cytometry. For each point, background fluorescence was subtracted from the raw data, which were then normalized to Fab reactivity with WT target protein. For each mutant clone, the mean binding value was plotted as a function of expression (represented by control reactivity). To identify preliminary primary critical clones (red circles), a threshold (dashed lines) of >70% WT binding to control Ab and <20% WT binding to test Fab was applied.
As shown in
A. 21H12D9
The mouse antibody 21H12D9 variable region genes were employed to create a humanized MAb. In the first step of this process, the amino acid sequences of the VH and VK of 21H12D9 were compared against the available database of human Ig gene sequences to identify the overall best-matching human germline Ig gene sequences. For the heavy chain, the closest human match was the IGHV1-2*02 gene. For the light chain, the best human match was the IGKV1-12*01 gene.
Humanized variable domain sequences were then designed where the CDR1-3 sequences of the 21H12D9 VH were grafted onto framework sequences of the IGHV1-2*02 gene and the CDR1-3 of the 21H12D9 light chain were grafted onto framework sequences of the IGKV1-12*01 gene. And then a human acceptor pirlIS49530 anti-Sm antibody VH chain (VH1/DK1 or DM1/JH4b)-human was selected for CDR grafting to obtain humanized VH1. AIT38653.1 immunoglobulin G heavy chain variable region, partial [Homo sapiens] was selected for CDR grafting to obtain humanized VL1. A 3D model was then generated to determine if there were any framework positions where replacing the mouse amino acid to the human amino acid could affect binding and/or CDR conformation. In the case of the heavy chain, K12, V20, M48, V68, M70, R72, S77 and V112 (Kabat numbering) in human framework was identified and subjected to back-mutations to their moue counterpart amino acid i.e.: K12V, V20M, M48I, V68A, M70L, R72V, S77G and V112L. In the case of the light chain, A13, L78 (Kabat numbering) in human framework was identified and subjected to back-mutation to their moue counterpart amino acid i.e.: A13T, L78V.
INPNNGGTTYKEKFKG
KATLTVDKSSGTAYMELNSLTSEDSAVYYCARDD
YDAGY
WGQGTTLTVSS
ASHRYT
GVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQQYTDFPLTFGA
The humanized sequences are listed in Table 8: 21H12D9-VH1 and 21H12D9-VL1 are fully humanized sequences and 21H12D9-VH2, 21H12D9-VH3, 21H12D9-VH4, 21H12D9-VL2, 21H12D9-VL3 are sequences with different back mutation.
B. 64C10G1
The mouse antibody 64C10G1 variable region genes were employed to create a humanized MAb. In the first step of this process, the amino acid sequences of the VH and VK of 64C10G1 were compared against the available database of human Ig gene sequences to find the overall best-matching human germline Ig gene sequences. For the heavy chain, the closest human match was the IGHV3-7*01 gene. For the light chain the closest human match was the IGKV1-33*01 gene. Humanized variable domain sequences were then designed where the CDR1-3 sequences of the 64C10G1 VH were grafted onto framework sequences of the IGHV3-7*01 gene and the CDR1-3 of the 64C10G1 light chain were grafted onto framework sequences of the IGKV1-33*01 gene. And then a human acceptor AAV48954.1: anti-pneumococcal antibody 8B3 immunoglobulin heavy chain variable region, partial [Homo sapiens] was selected for CDR grafting to obtain humanized VH1. ACY78416.1: immunoglobulin kappa light chain variable region, partial [Homo sapiens] was selected for CDR grafting to obtain humanized VL1. A 3D model was then generated to determine if there were any framework positions where replacing the mouse amino acid to the human amino acid could affect binding and/or CDR conformation. In the case of the light chain, Y49, V58, F71, I83 (Kabat numbering) in human framework was identified and subjected to back-mutation to their moue counterpart amino acid i.e.: Y49H, V58I, F71Y, I83F.
ISDGGSDAYYPDNVKG
RFTISRDNAKNNLYLQMSHLKSEDTAMYYCARDY
YGSGYEDSPMDY
WGQGTSVTVSS
TSTLQP
GIPSRFSGSGSGRDYSFSISNLEPEDFATYYCLQYDNLYTFGGG
The humanized sequences are listed in Table 10: 64C10G1-VH1 and 64C10G1-VL1 are fully humanized sequences, 64C10G1-VL2, 64C10G1-VL3 are sequences with different back mutations.
C. 71F4A3
The mouse antibody 71F4A3 variable region genes were employed to create a humanized MAb. In the first step of this process, the amino acid sequences of the VH and VK of 71F4A3 were compared against the available database of human Ig gene sequences to find the overall best-matching human germline Ig gene sequences. For the heavy chain, the closest human match was the IGHV3-7*01 gene. For the light chain the closest human match was the IGKV1-33*01 gene. Humanized variable domain sequences were then designed where the CDR1-3 sequences of the 71F4A3 VH were grafted onto framework sequences of the IGHV3-7*01 gene and the CDR1-3 of the 71F4A3 light chain were grafted onto framework sequences of the IGKV1-33*01 gene. And then a human acceptor AAA18280.1: immunoglobulin heavy chain variable region, partial [Homo sapiens] was selected for CDR grafting to obtain humanized VH1. ACY78416.1: immunoglobulin kappa light chain variable region, partial [Homo sapiens] was selected for CDR grafting to obtain humanized VL1. A 3D model was then generated to determine if there were any framework positions where replacing the mouse amino acid to the human amino acid could affect binding and/or CDR conformation. In the case of the heavy chain, E5, V47, A48, L85 (Kabat numbering) in human framework was identified and subjected to back-mutation to their moue counterpart amino acid i.e.: E5Q, V47I, A48G, L85V. In the case of the light chain, L78 (Kabat numbering) in human framework was identified and subjected to back-mutation to their moue counterpart amino acid i.e.: L78V.
INPDSSTINYAPSLKD
KFIISRDNAKNTLYLQMSKVRSEDTALYYCARQD
DYEYYAMDY
WGQGTSVTVSS
ASYRYT
GVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQYYSTPLTFGA
The humanized sequences are listed in Table 12: 71F4A3-VH1 and 71F4A3-VL1 are fully humanized sequences, 71F4A3-VH2, 71F4A3-VH3, 71F4A3-VH4, 71F4A3-VL2 are sequences with different back mutations.
D. 411A11E9
The mouse antibody 411A11E9 variable region genes were employed to create a humanized MAb. In the first step of this process, the amino acid sequences of the VH and VK of 411A11E9 were compared against the available database of human Ig gene sequences to identify the overall best-matching human germline Ig gene sequences. For the heavy chain, the closest human match was the IGHV3-7*01 gene. For the light chain, the best human match was the IGKV1-17*01 gene.
Humanized variable domain sequences were then designed where the CDR1-3 sequences of the 411A11E9 VH were grafted onto framework sequences of the IGHV3-7*01 gene and the CDR1-3 of the 411A11E9 light chain were grafted onto framework sequences of the IGKV1-17*01 gene. And then a human acceptor ACS96177.1 immunoglobulin heavy chain variable region, partial [Homo sapiens] was selected for CDR grafting to obtain humanized VH1. AAZ09050.1 immunoglobulin kappa light chain variable region, partial [Homo sapiens] was selected for CDR grafting to obtain humanized VL1. A 3D model was then generated to determine if there were any framework positions where replacing the mouse amino acid to the human amino acid could affect binding and/or CDR conformation. In the case of the heavy chain, A24, 170, R98, T105 (Kabat numbering) in human framework was identified and subjected to back-mutations to their moue counterpart amino acid i.e.: A24V, 170V, R98T, T105A. In the case of the light chain, V58, F71, Y87 (Kabat numbering) in human framework was identified and subjected to back-mutation to their moue counterpart amino acid i.e.: V58I, F71Y, Y87F.
INYDGGDTYYRDSVKG
RFTVSRNNAKSSLFLQMDSLRSEDTATYYCKTEE
DYDGSYVMDA
WGQGASVIVSS
TNILQT
GIPSRFSGSGSNTDYTLTISSLQPEDFATYFCLQQSSLYTFGAG
The humanized sequences are listed in Table 14: 411A11E9-VH1 and 411A11E9-VL1 are fully humanized sequences and 411A11E9-VH2, 411A11E9-VH3, 411A11E9-VH4, 411A11E9-VL2, 411A11E9-VL3, 411A11E9-VL4 are sequences with different back mutation.
The humanized VH and VL genes were produced synthetically as humanized Fab and then respectively cloned into vectors containing the human gamma 1 and human kappa constant domains. Humanized VH and VK were paired to produce Fabs and then purified for further off-rate ranking (Table 15) and affinity testing,
Among all humanized Fab samples, 71F4A3-VH2VL1, 71F4A3-VH1VL1 (Hz71F4), 71F4A3-VH1VL2, 71F4A3-VH3VL1, 411A11E9-VH1VL4, 411A11E9-VH3VL4, 411A11E9-VH2VL4, 411A11E9-VH3VL2, 411A11E9-VH1VL2, 21H12D9-VH1VL1, 21H12D9-VH2VL2, 21H12D9-VH3VL3, 21H12D9-VH1VL2, 64C10G1-VH1VL3, 64C10G1-VH1VL4, 64C10G1-VH1VL1, 64C10G1-VH1VL2 were selected to test affinity by Biacore 8K. 10 mM HEPES, 150 mM NaCl, 3 mM EDTA, 0.05% Tween-20, pH 7.4 served as running buffer and 10 mM glycine-HCl, pH2.0 served as regeneration buffer. CXCL13 protein were immobilized on Sensor Chip CM5 using amine coupling method (immobilization level ˜250RU). The serial concentrations of Fab (0-20 nM) were injected over immobilized CXCL13 at the flow rate of 30 μl/min. The dissociation phases were 600s. The results are shown in Table 16 below.
This example tested the binding and blocking properties in cell-based blocking assay of the humanized anti-CXCL13 antibodies to CXCL13 proteins.
To evaluate the humanized Fabs binding and blocking activities, the 71F4A3H, and 64C10G1H were subjected to ELISA binding test and cell-based blocking assays. The EC50 and IC50 are summarized in Table 17, which demonstrating that the potency of binding activity for humanized 71F4A3, 64C10G1 are better than that of chimeric antibodies. The potency of blocking activity, while comparing with its chimeric counterpart, the humanized 71F4A3 decreased about 2-fold, and the humanized 64C10G1 keep the blocking potency while compared with its chimeric counterpart.
Blocking of CXCL13 induced IP1 signaling. To avoid involving too many mutation sites and based on the results of Elisa binding and cell-based blocking, we chose the 64C10G1-VH1VL2, 64C10G1-VH1VL3, 71F4A3-VH1VL1 (Hz71F4), 71F4A3-VH1VL2 sequence to remove PTM (Post-translational modification) site, the mutant positions of 64C10G1 were D53E and D107E in the VH, for 71F4A3, the mutant position was D54E in the VH, and further verify in IP1 assay which was mentioned previously.
As shown in
Blocking of primary human tonsil cells migration toward human CXCL13. Based on the results of IP1 assay, we evaluated the effect of 64C10G1-VH1VL2, 64C10G1-VH1VL2 (D53E, D107E), 71F4A3-VH1VL1 (Hz71F4) and 71F4A3-VH1VL1 (Hz71F4) (D54E) on primary human tonsil cells migration assay.
We could see in the
This example tested the binding properties of the humanized anti-CXCL13 antibodies to huCXCL13 and cynoCXCL13 proteins.
To evaluate the humanized antibodies binding activities, the 71F4A3-VH1VL1 (Hz71F4), 71F4A3-VH1VL2, 64C10G1-VH1VL2, 64C10G1-VH1VL3 were produced synthetically as humanized full length IgG1 containing the human gamma 1 and human kappa constant domains with PTM removal in the VH to increase stability of the antibody. For 71F4A3, the mutant position was D54E, and for 64C10G1, the mutant positions were D53E, D107E. The cross binding to huCXCL13 and cynoCXCL13 was tested by ELISA binding assays. The results are summarized in
Blocking of CXCL13 induced IP1 signaling. To evaluate the blocking potency of these humanized antibodies, the 71F4A3-VH1VL1 (Hz71F4), 64C10G1-VH1VL2 antibodies were produced synthetically as humanized full length IgG1 with the mutant position of D54E (Table 18) and D53E, D107E (Table 18a), respectively. The blocking activity was evaluated in the IP1 assay which induced by human CXCL13.
The results are summarized in
It was contemplated that certain amino acid residues within the CDR regions or the framework regions could be changed to further improve or retain the activity and/or stability of the antibodies. With a computational tool (VectorNTI, available at www.ebi.ac.uk/tools/msa/clustalo/), with respect to their structural, conformational and functional properties, variants were designed with two different approaches.
In the first approach, mutations were chosen to target the hotspots in LCDR1, HCDR2 and HCDR3. Hotspots in CDRs were identified, as shown in Table 18. Usually, CDR3 contributes most to antigen binding and heavy chain is more important than light chain for antigen binding. Moreover, LCDR1 is important for antigen binding. For the first trial, random mutations were targeted to hotspots in LCDR1, HCDR2 and HCDR3. Eliminate hotspots that code for conserved and buried amino acids in CDRs. Remaining CDRs with hotspots are randomly mutated: HCDR2 (3 amino acids: 55S, 56S, 57T), HCDR3 (2 amino acids: 103E, 104Y), LCDR1 (3 amino acids: 32G, 34A, 36Y). After finishing construction of phage library, antigen CXCL13 screening was followed. Mutated Amino acids that could improve Kon are listed in Table 19. Sequences of lead clones that have greater Kon to human CXCL13 are listed in Table 20. Antibodies of these sequences were generated, and affinity testing was performed by Biacore T200. The results are listed in Table 21.
In the second approach, mutations were carried out by multiple libraries including 4 different sub libraries, such as saturated mutation libraries by CDR walking for CDR L1, CDR L3, CDR H3 or CDR L2, CDR H1, CDR H2 and saturated mutation libraries by three aa mutated continuously for CDR H3 or CDR L3. CDRs were identified according AbM method by abYsis 3 (http://abysis.org/), as shown in Table 22. After finishing construction of phage sub libraries, antigen CXCL13 screening followed. Mutated Amino acids that could improve Koff are listed in Table 23. Sequences of lead clones that have lower Koff to human CXCL13 are listed in Table 24. Antibodies of these sequences were generated, and affinity testing was performed by Biacore T200. The results are listed in Table 25. To further optimize the antibodies, the lead clones were then back mutated to its humanized counterpart one aa by one aa. Sequences were generated and synthesized for antibodies. Affinity was tested by Biacore T200. Results show that one of the back mutation of 005-3-18, sequence was showed in Table 26, which is 92W back mutant to Y in the light chain and named 71F4-B, significantly promote Koff, KD(<1 nM) and blocking activity compared with Hz71F4 and 005-3-18, data were listed in Table 27.
To further optimization of 71F4-B, each Mutations in 71F4A3 useful for improving binding (Kon) were added into 71F4-B, the sequences were listed in Table 28. Antibodies according to these sequences were generated and affinity testing was performed by Biacore T200. The results showed that the affinity of 71F4-B-T, 71F4-B-LT, 71F4-B-H were increased almost 1 log compared to 71F4-B, the affinity of lead clones was listed in Table 29.
Inhibition of CXCL13 mediated IP1 signaling. Based on the results of binding affinity, we selected the 71F4A3-B, 71F4A3-B-T, 71F4A3-B-H, 71F4A3-B-LT to investigate in the functional IP1 signaling assay. Besides, we compared the blocking potency of in house anti-CXCL13 with the reference anti-CXCL13 antibody, Mab5261, which was mention in example 9.
As shown in the
Blocking of BaF3-CXCR5 (human) cells migration toward CXCL13. Furtherly, we validated the activity of these affinity matured antibodies and reference antibody in BaF3-CXCR5 cell line migration assay which was mentioned on example 5.
As shown in the
Inhibition of primary human tonsil cells migration to CXCL13. Besides, we also investigated the blocking function of anti-CXCL13 affinity matured antibodies in primary human tonsil cells migration assay.
As shown in the
The present disclosure is not to be limited in scope by the specific embodiments described which are intended as single illustrations of individual aspects of the disclosure, and any compositions or methods which are functionally equivalent are within the scope of this disclosure. It will be apparent to those skilled in the art that various modifications and variations can be made in the methods and compositions of the present disclosure without departing from the spirit or scope of the disclosure. Thus, it is intended that the present disclosure cover the modifications and variations of this disclosure provided they come within the scope of the appended claims and their equivalents.
All publications and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.
| Number | Date | Country | Kind |
|---|---|---|---|
| PCT/CN2018/106158 | Sep 2018 | WO | international |
This application is a division of U.S. application Ser. No. 16/963,130, filed Jul. 17, 2020, which is a U.S. National Stage Application under 35 U.S.C. 371 of International Application No. PCT/CN2019/106409, filed Sep. 18, 2019, which claims priority to International Application PCT/CN2018/106158, filed Sep. 18, 2018. The contents of each of the aforementioned are hereby incorporated by reference in their entirety into the present disclosure.
| Number | Name | Date | Kind |
|---|---|---|---|
| 7390884 | Segal | Jun 2008 | B2 |
| 7919083 | Lillard, Jr. | Apr 2011 | B2 |
| 8097250 | Lillard | Jan 2012 | B2 |
| 8277809 | Bugelski | Oct 2012 | B2 |
| 8512701 | Lillard | Aug 2013 | B2 |
| 9790271 | Zauderer | Oct 2017 | B2 |
| 9890213 | Smith | Feb 2018 | B2 |
| Number | Date | Country |
|---|---|---|
| 2013-539369 | Oct 2013 | JP |
| 20080040720 | May 2008 | KR |
| 20130101046 | Sep 2013 | KR |
| 2008079361 | Jul 2008 | WO |
| 20080102123 | Aug 2008 | WO |
| 20140137355 | Sep 2014 | WO |
| Entry |
|---|
| Rudikoff et al. —Single amino acid substitution altering antigenbinding specificity, Proc. Natl. Acad. Sci. USA, 79, 1979-1983, 1982. (Year: 1982). |
| Claflin et al. —Patterns of mutations and selection in antibodies to the phosphocholine-specific determinant in Proteus morganii, J. Immunol. 143, 3054-3063, 1989. (Year: 1989). |
| International Search Report and Written Opinion for PCT/CN2019/106409 dated Dec. 20, 2019, 10 pages. |
| European Search Report and Opinion dated Jul. 20, 2021 for EP Application No. 19863616.9, 9 pages. |
| Klimatcheva et al., “CXCL13 antibody for the treatment of autoimmune disorders”, BMC Immunol., Feb. 12, 2015, 16(1):6. |
| R&D Systems, “Monoclonal anti-human CXCL13/BLC/BCA-1 antibody”, R&D Systems Data Sheet, Mar. 11, 2006, 2 pages. |
| Number | Date | Country | |
|---|---|---|---|
| 20210284724 A1 | Sep 2021 | US |
| Number | Date | Country | |
|---|---|---|---|
| Parent | 16963130 | US | |
| Child | 17326019 | US |
