The present invention generally relates to a novel highly discriminating antibiotic, plantazolicin (PZN), which was isolated from Bacillus amyloliquefaciens FZB42 or Bacillus pumilus, and to pharmaceutical compositions comprising plantazolicin or a salt or an ester thereof. Also provided are methods for producing and using such plantazolicin compounds.
With facile access to low-cost next-generation DNA sequencing technology, there has been a recent surge in genome sequencing. The availability of nearly 2,000 microbial genomes has rekindled interest in the biosynthetic capabilities of bacteria (Challis, G. L. (2008) J Med Chem 51, 2618-2628; Gross, H. (2009) Curr Opin Drug Discov Devel 12, 207-219; Melby et al., (2011) Curr Opin Chem. Biol., 15(3):369-78). Given the status of natural products and their derivatives as the largest source of all medicines, exploring uncharted biosynthetic territory holds vast potential (Newman and Cragg, (2007) J Nat Prod 70, 461-477). One such region of natural product space includes the thiazole/oxazole-modified microcin (TOMM) family (Haft et al., (2010) BMC Biol 8, 70; Lee et al., (2008) Proc Natl Acad Sci USA 105, 5879-5884; Scholz et al. (2011) J Bacteriol 193, 215-224).
Microcins are antibacterial peptides that differ from popular broad-range antibiotics in a variety of ways. One important difference is that microcins target a narrow spectrum of bacteria. As a result, natural human microbial flora will go undisturbed aiding in decreased side effects. A second important difference is that microcins are less likely to be horizontally transferred due to their narrow target spectrum and complex machinery required for synthesis and export, which is often encoded on multiple genes.
Unlike the well-known non-ribosomal peptides and polyketides, TOMMs are derived from inactive, ribosomally synthesized precursor peptides. Each TOMM precursor peptide harbors an N-terminal leader region that serves as the binding site for enzymes that posttranslationally modify a C-terminal core region (Madison et al., (1997) Mol Microbiol 23, 161-168; Mitchell et al., (2009) J Biol Chem 284, 13004-13012). The distinguishing chemical features of a TOMM are heterocycles that derive from cysteine, serine, and threonine residues, which are abundant in the core region of the precursor peptide. During processing by a genetically conserved cyclodehydratase, select cysteines and serine/threonine amino acids undergo peptide backbone cyclization to become thiazoline and (methyl)oxazoline heterocycles. A subset of these are further subjected to a flavin mononucleotide (FMN)-dependent dehydrogenation, which yields the aromatic thiazole and (methyl)oxazole heterocycles. The formation of heterocycles on TOMM precursor peptides is dependent on the presence of a third component, termed the docking protein, whose exact function remains enigmatic (McIntosh, J. A. and Schmidt, E. W., (2010) Chembiochem 11, 1413-1421; Milne et al., (1998) Biochemistry 37, 13250-13261; Milne et al., (1999) Biochemistry 38, 4768-4781). Together, the TOMM cyclodehydratase (C), dehydrogenase (B), and docking protein (D) comprise a functional, heterotrimeric thiazole/oxazole synthetase.
The genes encoding for this synthetase are typically located as adjacent open reading frames in bacterial genomes, making such biosynthetic clusters relatively easy to identify using routine bioinformatic methods (Lee et al., (2008) Proc Natl Acad Sci USA 105, 5879-5884). TOMM biosynthetic clusters often contain ancillary tailoring enzymes that increase the chemical complexity of this natural product family.
Although the unification of the TOMM family of natural products has only recently emerged, the molecular structure and biological function of some TOMMs have long been established. Examples include microcin B17 (DNA gyrase inhibitor), the cyanobactins (eukaryotic cytotoxins), streptolysin S (virulence-promoting cytolysin), and the thiopeptides (ribosome inhibitors) (Melby et al., (2011) Curr Opin Chem. Biol., 15(3):369-78). Bacillus amyloliquefaciens FZB42 is known to produce a plethora of complex small molecules, including bacillaene, difficidin, macrolactin, surfactin, fengycin, bacillomycin D, and bacillibactin (Chen et al., (2007) Nat Biotechnol 25, 1007-1014; Chen et al., (2006) J Bacteriol 188, 4024-4036; Borriss et al., (2010) Int J Syst Evol Microbiol, 61(Pt 8):1786-801).
One aspect of the present invention is directed to a plantazolicin-like compound having the structure:
(X1)—(X2)5—(X3)2—(X4)5—(X5)n
or a pharmaceutically acceptable salt or ester thereof, wherein X1 is
R1 and R2 are each independently hydrogen or lower alkyl; each X2 is independently an azole; each X3 is independently a hydrophobic amino acid; each X4 is independently an azole or azoline; and each X5 is independently an amino acid, wherein n is 1 or 2.
Another aspect of the present invention is directed to a plantazolicin compound having the structure
or a pharmaceutically acceptable salt or ester thereof.
It is still another aspect of the present invention to provide a pharmaceutical composition comprising a plantazolicin-like compound described herein or plantazolicin, and a pharmaceutically acceptable carrier.
Yet another aspect of the present invention is a pharmaceutical composition for treating or preventing a Bacillus anthracis infection or a Bacillus cereus infection wherein the therapy comprises administering a pharmaceutical composition disclosed herein to an animal subject in need thereof.
It is another aspect of the present invention to provide a method for treating or preventing a Bacillus anthracis infection or a Bacillus cereus infection, the method comprising administering to a pharmaceutical composition disclosed herein to an animal subject in need thereof.
Among other aspects of the present invention is a method for identifying a plantazolicin-like protein by identifying a bacterial amino acid sequence exhibiting at least 50% amino acid identity to a plantazolicin precursor peptide from Bacillus amyloliquefaciens FZB42; obtaining a post-translationally modified product of the bacterial amino acid sequence; and testing the post-translationally modified product of the bacterial amino acid sequence in a Bacillus anthracis growth inhibitory assay, wherein ability to inhibit the growth of Bacillus anthracis indicates that the bacterial amino acid sequence encodes a plantazolicin-like protein.
Still other aspects of the present invention are directed to methods for producing the plantazolicin. In one aspect, plantazolicin is produced by growing Bacillus amyloliquefaciens FZB42 cells in culture; collecting the Bacillus amyloliquefaciens FZB42 cells, thereby obtaining the harvested Bacillus amyloliquefaciens FZB42 cells; obtaining a crude plantazolicin extract from the harvested Bacillus amyloliquefaciens FZB42 cells; and purifying the plantazolicin compound from the crude plantazolicin extract.
In another aspect, plantazolicin is produced by growing Bacillus pumilus cells in culture; collecting the Bacillus pumilus cells, thereby obtaining the harvested Bacillus pumilus cells; obtaining a crude plantazolicin extract from the harvested Bacillus pumilus cells; and purifying the plantazolicin compound from the crude plantazolicin extract.
Other objects and features will be in part apparent and in part pointed out hereinafter.
B, Same as A except the trace is the total ion chromatogram (TIC). C, Extracted ion chromatogram (EIC) of m/z 1336, 1338, and 1354 from a low oxygen fermentation.
D, Same as C except under high oxygenation conditions.
Corresponding reference characters indicate corresponding parts throughout the drawings.
The term “gene” refers to a nucleic acid (e.g., DNA) sequence that comprises coding sequences necessary for the production of a polypeptide or precursor or RNA (e.g., tRNA, siRNA, rRNA, etc.). The polypeptide can be encoded by a full length coding sequence or by any portion of the coding sequence so long as the desired activity or functional properties (e.g., enzymatic activity, ligand binding, signal transduction, etc.) of the full-length or fragment are retained. The term also encompasses the coding region of a structural gene and the sequences located adjacent to the coding region on both the 5′ and 3′ ends, such that the gene corresponds to the length of the full-length mRNA. The sequences that are located 5′ of the coding region and which are present on the mRNA are referred to as 5′ untranslated sequences. The sequences that are located 3′ or downstream of the coding region and that are present on the mRNA are referred to as 3′ untranslated sequences. The term “gene” encompasses both cDNA and genomic forms of a gene. A genomic form or clone of a gene contains the coding region, which may be interrupted with non-coding sequences termed “introns” or “intervening regions” or “intervening sequences.” Introns are removed or “spliced out” from the nuclear or primary transcript, and are therefore absent in the messenger RNA (mRNA) transcript. The mRNA functions during translation to specify the sequence or order of amino acids in a nascent polypeptide.
The term “expression cassette” is used to define a nucleotide sequence containing regulatory elements operably linked to a coding sequence that result in the transcription and translation of the coding sequence in a cell.
The term “plasmid” as used herein, refers to an independently replicating piece of DNA. It is typically circular and double-stranded.
As used herein, Bacillus anthracis spore (or anthrax spore) is a small reproductive body produced by B. anthracis bacteria. Such spores do not form normally during active growth and cell division. Rather, their differentiation begins when a population of vegetative cells passes out of the exponential phase of growth, usually as a result of nutrient depletion.
“Preventing” a disease refers to inhibiting the full development of a disease, for example preventing development of anthrax disease. Prevention of a disease does not require a total absence of infection. For example, a decrease of at least 50% can be sufficient.
“Treatment” or “treating” refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition, such a sign or symptom of anthrax disease (e.g., fever, ulcers, swollen lymph nodes, skin blisters). Treatment can also induce remission or cure of a condition, such as anthrax disease, including inhalational anthrax, gastrointestinal anthrax, oropharyngeal anthrax and cutaneous anthrax.
The term “pharmaceutically acceptable salt” refers to the relatively non-toxic, inorganic and organic acid addition salts of compounds of the present invention. These salts can be prepared in situ in the administration vehicle or the dosage form manufacturing process, or by reacting a purified compound of the invention in its free base form with a suitable organic or inorganic acid, and isolating the salt thus formed during subsequent purification. Representative salts include the hydrobromide, hydrochloride, sulfate, bisulfate, malate, citrate, flurbiprofen, ketoprofen, loxoprofen, diclofenac, etodolac, indomethacin, phosphate, nitrate, acetate, valerate, oleate, palmitate, stearate, laurate, benzoate, lactate, phosphate, tosylate, citrate, maleate, fumarate, succinate, tartrate, napthylate, mesylate, glucoheptonate, lactobionate, laurylsulphonate salts and the like. (See, for example, Berge et al. (1977) “Pharmaceutical Salts,” J. Pharm. Sci. 66: 1-19).
“PZN” as used herein is an abbreviation for plantazolicin.
“Percentage of sequence identity” is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the comparison window, and multiplying the result by 100 to yield the percentage of sequence identity.
A “comparison window”, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by the search for similarity method of Pearson and Lipman (1988) Proc. Nat'l. Acad. Sci. USA 85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Ausubel et al., Current Protocols in Molecular Biology (1995 supplement)).
The terms “identical” or percent “identity,” in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 60% identity, optionally 65%, 70%, 75%, 80%, 85%, 90%, or 95% identity over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Such sequences are then said to be “substantially identical.” This definition also refers to the complement of a test sequence. Optionally, the identity exists over a region that is at least about 50 nucleotides in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides in length.
The term “similarity,” or percent “similarity,” in the context of two or more polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of amino acid residues that are either the same or similar as defined in the 8 conservative amino acid substitutions defined above (i.e., 60%, optionally 65%, 70%, 75%, 80%, 85%, 90%, or 95% similar over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Such sequences are then said to be “substantially similar.” Optionally, this identity exists over a region that is at least about 50 amino acids in length, or more preferably over a region that is at least about 100 to 500 or 1000 or more amino acids in length.
The present invention is directed to novel plantazolicin-like compounds, which are highly discriminating antibiotics (i.e., they are narrow-spectrum antibiotics in that they are active against a selected group of bacterial types and used for the specific infections arising from these bacterial types). The plantazolicin-like compounds structurally belong to a family of thiazole/oxazole-modified microcins (TOMMs).
One aspect of the present invention is directed to a plantazolicin-like compound having the structure: (X1)—(X2)5—(X3)2—(X4)5—(X5)n or a pharmaceutically acceptable salt or ester thereof, wherein X1 is
R1 and R2 are each independently hydrogen or lower alkyl; each X2 is independently an azole; each X3 is independently a hydrophobic amino acid; each X4 is independently an azole or azoline; and each X5 is independently an amino acid, wherein n is 1 or 2.
In some embodiments, X2 is selected from the group consisting of: pyrazole, imidazole, thiazole, oxazole, isoxazole, isothiazole, pyrrole, triazole, tetrazole, and pentazole, and is preferably thiazole or oxazole.
In some instances, X3 is selected from the group consisting of alanine (Ala), valine (Val), isoleucine (Ile), leucine (Leu), methionine (Met), phenylalanine (Phe), tyrosine (Tyr), and tryptophan (Trp). Preferably, X3 is isoleucine, phenylalanine, or tryptophan.
In some embodiments, X4 is an azole selected from the group consisting of pyrazole, imidazole, thiazole, oxazole, isoxazole, isothiazole, pyrrole, triazole, tetrazole, and pentazole, or an azoline selected from the group consisting of pyrazoline, imidazoline, thiazoline, oxazoline, isoxazoline, isothiazoline, pyrroline, triazoline, tetrazoline, and pentazoline. X4 is preferably is thizole, oxazole or oxazoline.
In some instances, X5 is selected from the group consisting of phenylalanine, tyrosine and tryptophan. In an exemplary preferred embodiment, X5 is phenylalanine.
Preferably, n is 1.
Another aspect of the present invention is directed to plantazolicin having the structure
or a pharmaceutically acceptable salt or ester thereof.
The plantazolicin-like compound described above can be synthesized by any methods known in the art, such as by total chemical synthesis, semi-synthesis or bacterial strain bioengineering.
In one embodiment, plantazolicin is isolated from Bacillus amyloliquefaciens FZB42. Bacillus amyloliquefaciens FZB42 is a gram-positive, plant-growth promoting bacterium with a large capacity to produce secondary metabolites with antimicrobial activity.
Plantazolicin, belonging to a class of TOMM molecules is produced from a small precursor peptide that is posttranslationally modified to contain thiazole and (methyl)oxazole heterocycles. These rings are derived from Cys and Ser/Thr through the action of a trimeric ‘BCD’ synthetase complex, which consists of a cyclodehydratase (C), dehydrogenase (B), and a docking protein (D).
In general, during TOMM biosynthesis, the precursor peptide is bound by the BCD synthetase complex through specific motifs within the N-terminal leader sequence. After substrate recognition, heterocycles are synthesized on the C-terminal core peptide over two enzymatic steps. The first is carried out by a cyclodehydratase, which converts Cys and Ser/Thr residues into the corresponding thiazolines and (methyl)oxazolines. A dehydrogenase then oxidizes the ‘azoline’ rings to yield ‘azole’ rings [thiazoles and (methyl)oxazoles], resulting in a net loss of 20 Da. The completion of TOMM biosynthesis includes the incorporation of ancillary modifications (e.g. dehydrations, methylations, macrocyclization, etc.), and leader peptide proteolysis. In many cases, the fully mature TOMM natural product is then actively exported from the cell through the use of an ABC transport system.
The PZN biosynthetic 12-gene cluster spans nearly 10 kb of the FZB42 chromosome as shown in
The first operon (pznFKGHI) consists of genes predicted to be involved in immunity, regulation, and transport (
Based on sequence alignment with other known TOMM biosynthetic cluster genes, PznC is related to the TOMM cyclodehydratase and believed to act as one. PznD is highly similar to SagD from the SLS biosynthetic cluster and is termed the docking scaffold protein, while PznE is believed to be a leader peptidase.
In one embodiment, plantazolicin is produced from a precursor peptide having the amino acid sequence MTQIKVPTALIASVHGEGQHLFEPMAARCTCTTIISSSSTF (SEQ ID NO: 1). In another embodiment, the core region of the precursor peptide has the sequence of RCTCTTIISSSSTF (SEQ ID NO: 2).
In another embodiment, the present invention is directed to a method for producing plantazolicin by growing Bacillus amyloliquefaciens FZB42 cells in culture; collecting the Bacillus amyloliquefaciens FZB42 cells, thereby obtaining the harvested Bacillus amyloliquefaciens FZB42 cells; obtaining a crude plantazolicin extract from the harvested Bacillus amyloliquefaciens FZB42 cells; and purifying plantazolicin from the crude plantazolicin extract. In other embodiments, any other Bacillus amyloliquefaciens strain, whether mutated or not that is capable of producing PZN can be used in this method.
Using a protein BLAST search, it was discovered that thiazole/oxazole synthetase proteins (PznBCD) from B. pumilus (protein IDs: EDW22765.1, EDW22903.1, and EDW23125.1, respectively) demonstrated a significant degree of amino acid identity to those from FZB42 (PznB, 77%; PznC, 63%, and PznD, 82%). Moreover, the PZN genes from B. pumilus were found to be clustered and in identical order to that found in FZB42. Similarly to FZB42, B. pumilus is a plant saprophyte that produces an array of antibacterial and antifungal natural products. Furthermore, the PznA core peptide sequences from FZB42 and B. pumilus (unmarked, located between EDW23486.1 and EDW22932.1) were found to be 100% identical, and plantazolicin isolated from B. pumilus was identical to FZB42-isolated PZN. Hence, it is another embodiment of the present invention to provide plantazolicin isolated from Bacillus pumilus.
Accordingly, it is another embodiment of the present invention to provide a method for producing plantazolicin, the method comprising growing Bacillus pumilus cells in culture; collecting the Bacillus pumilus cells, thereby obtaining the harvested Bacillus pumilus cells; obtaining a crude plantazolicin extract from the harvested Bacillus pumilus cells; and purifying plantazolicin from the crude plantazolicin extract.
In some embodiments related to the methods for producing PZN, cells, either B. amyloliquefaciens or B. pumilus, are grown in flasks. In other embodiments, the cells are grown in biofermentors. This is especially desirable when larger quantities of plantazolicin are being produced. One of ordinary skill in the art can readily determine culture media and growth conditions necessary to produce plantazolicin in particular cells. Some of the exemplary conditions for both B. amyloliquefaciens and B. pumilus are shown in the examples.
The inventors also discovered that low and high oxygen levels used during cell growth, i.e. fermentation affected the production of PZN and its derivative metabolites. In particular, there was more PZN produced compared to metabolites during low oxygenation, whereas high oxygenation resulted in greater production of metabolites, which were either less active (dihydroPZN) or inactive (desmethylPZN) compared to PZN. Hence, in some embodiments, the step of growing cells for production of PZN is performed under low oxygen conditions. Low oxygenation refers to conditions such as regular growth of bacteria in flasks (i.e., at oxygen levels present in air), whereas high oxygenation refers to oxygen supplementation, such as by supplying air at a rate of 5 L/min, the air being saturated in oxygen at a rate of approximately 1 L/min.
Cells are next harvested using any of the methods known in the art. In some embodiments, cells are harvested by centrifugation or by any other method used in the art. One or more centrifugation steps can be performed in order to obtain most of the cells. Following the harvesting step, a crude PZN extract is obtained from the harvested cells. In some embodiments, the crude PZN extract is obtained by performing a non-lytic, methanolic extraction of the cellular surface of the harvested cells. Other solvents used for extraction can readily be determined by a skilled artisan. Exemplary conditions are shown in the examples, and a skilled artisan can readily determine other conditions suitable for crude PZN extraction.
A crude plantazolicin extract is next subjected to a purification step, which allows for separation of plantazolicin from other components in the extract. In some embodiments of the present invention, plantazolicin is purified by high performance liquid chromatography (HPLC). One particularly useful method of HPLC is reverse phase HPLC.
As shown in the examples and Table 3, plantazolicin was tested for growth inhibitory activity towards a wide range of bacteria. In total, 18 strains from 16 distinct species were assayed for susceptibility to PZN (Table 3). It was determined that PZN exhibited activity primarily towards Bacillus sp., including B. subtilis. PZN exhibited no activity against any tested Gram-negative organisms. To further define the selectivity within the Gram-positive organisms, the scope of PZN activity towards a panel of ubiquitous human pathogens was evaluated, including methicillin-resistant Staphylococcus aureus (MRSA), vancomycin-resistant Enterococcus faecalis (VRE), Listeria monocytogenes, Streptococcus pyogenes, and Bacillus anthracis strain Sterne (a surrogate for the BSL3 pathogen, which lacks the poly-D-glutamic acid capsule). Plantazolicin exhibited a potent growth inhibition of B. anthracis, whereas all other species were unaffected by PZN (with the exception of S. pyogenes, which was only inhibited by very high concentrations of PZN). The action of PZN upon B. anthracis was shown to be bactericidal, as described in the examples. Accordingly, a plantazolicin-like compound or plantazolicin can be used to inhibit growth of Bacillus species, which is useful for treating infections caused by Bacillus bacteria susceptible to PZN. By way of example and not of limitation, a plantazolicin-like compound or plantazolicin can be used to treat B. cereus infection, which causes food poisoning in humans. In particular, due to a potent bactericidal effect on B. anthracis, a plantazolicin-like compound or plantazolicin can be used as an effective, highly specific highly discriminating antibiotic against anthrax infections.
Accordingly, it is an embodiment of the present invention to provide a pharmaceutical composition comprising a plantazolicin-like compound, plantazolicin or a pharmaceutically acceptable salt or ester thereof and a pharmaceutically acceptable carrier. A plantazolicin-like compound, plantazolicin or a pharmaceutically acceptable salt or ester thereof can be formulated as a pharmaceutical composition prior to administering to an animal subject, according to techniques known in the art. Pharmaceutical compositions of the present invention are characterized as being at least sterile and pyrogen-free. Methods for preparing pharmaceutical compositions of the invention are within the skill in the art, for example as described in Remington's Pharmaceutical Science, 17th ed., Mack Publishing Company, Easton, Pa., (1985).
The present pharmaceutical formulations comprise a plantazolicin-like compound, plantazolicin or a pharmaceutically acceptable salt or ester thereof (e.g., 0.1 to 90% by weight) mixed with a pharmaceutically acceptable carrier. Suitable physiologically acceptable carriers are water, buffered water, saline solutions (e.g., normal saline or balanced saline solutions such as Hank's or Earle's balanced salt solutions), 0.4% saline, 0.3% glycine, hyaluronic acid and the like.
The pharmaceutical composition of the present invention can be administered orally, nasally, parenterally, intrasystemically, intraperitoneally, topically (as by drops or transdermal patch), bucally, sublingually or as an oral or nasal spray. In one preferred embodiment, the pharmaceutical composition of the present invention is administered orally. In another preferred embodiment, the pharmaceutical composition is given intravenously. In still another preferred embodiment, the pharmaceutical composition is given subcutaneously or intramuscularly.
A pharmaceutical composition of the present invention for parenteral injection can comprise pharmaceutically acceptable sterile aqueous or nonaqueous solutions, dispersions, suspensions or emulsions as well as sterile powders for reconstitution into sterile injectable solutions or dispersions just prior to use. Examples of suitable aqueous and nonaqueous carriers, diluents, solvents or vehicles include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), carboxymethylcellulose and suitable mixtures thereof, vegetable oils (such as olive oil), and injectable organic esters such as ethyl oleate. Proper fluidity can be maintained, for example, by the use of coating materials such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
Injectable depot forms are made by forming microencapsulated matrices of the drug in biodegradable polymers such as polylactide-polyglycolide. Depending upon the ratio of drug to polymer and the nature of the particular polymer employed, the rate of drug release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are also prepared by entrapping the drug in liposomes or microemulsions which are compatible with body tissues.
The injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium just prior to use.
In some cases, to prolong the effect of the drugs, it is desirable to slow the absorption from subcutaneous or intramuscular injection. This can be accomplished by the use of a liquid suspension of crystalline or amorphous material with poor water solubility. The rate of absorption of the drug then depends upon its rate of dissolution which, in turn, can depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally administered drug form is accomplished by dissolving or suspending the drug in an oil vehicle. Prolonged absorption of the injectable pharmaceutical form can be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
Solid dosage forms for oral administration include, but are not limited to, capsules, tablets, pills, powders, and granules. In such solid dosage forms, the active compounds are mixed with at least one pharmaceutically acceptable excipient or carrier such as sodium citrate or dicalcium phosphate and/or a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, and silicic acid, b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidone, sucrose, and acacia, c) humectants such as glycerol, d) disintegrating agents such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, e) solution retarding agents such as paraffin, f) absorption accelerators such as quaternary ammonium compounds, g) wetting agents such as, for example, acetyl alcohol and glycerol monostearate, h) absorbents such as kaolin and bentonite clay, and i) lubricants such as talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof. In the case of capsules, tablets and pills, the dosage form can also comprise buffering agents. Solid compositions of a similar type can also be employed as fillers in soft and hard filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
The solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the pharmaceutical formulating art. They can optionally contain opacifying agents. The compositions can also release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of embedding compositions which can be used include polymeric substances and waxes.
The pharmaceutical compositions of the present invention can also be in micro-encapsulated form, if appropriate, with one or more of the above-mentioned excipients.
Liquid dosage forms for oral administration include, but are not limited to, pharmaceutically acceptable emulsions, solutions, suspensions, syrups and elixirs. In addition to the active compounds, the liquid dosage forms can contain inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethyl formamide, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
Besides inert diluents, the oral compositions can also include adjuvants such as wetting agents, emulsifying agents, suspending agents, sweetening, flavoring, and perfuming agents.
Suspensions, in addition to a plantazolicin-like compound or plantazolicin, can contain suspending agents such as, for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar, and tragacanth, and mixtures thereof.
Alternatively, the composition can be pressurized and contain a compressed gas, such as nitrogen or a liquefied gas propellant. The liquefied propellant medium and indeed the total composition are preferably such that the active ingredients do not dissolve therein to any substantial extent. The pressurized composition can also contain a surface active agent. The surface active agent can be a liquid or solid non-ionic surface active agent or can be a solid anionic surface active agent. It is preferred to use the solid anionic surface active agent in the form of a sodium salt.
Pharmaceutical compositions of the invention can also comprise conventional pharmaceutical excipients and/or additives. Suitable pharmaceutical excipients include stabilizers, antioxidants, osmolality adjusting agents, buffers, and pH adjusting agents. Suitable additives include physiologically biocompatible buffers (e.g., tromethamine hydrochloride), additions of chelants (such as, for example, DTPA or DTPA-bisamide) or calcium chelate complexes (as for example calcium DTPA, CaNaDTPA-bisamide), or, optionally, additions of calcium or sodium salts (for example calcium chloride, calcium ascorbate, calcium gluconate or calcium lactate).
One of ordinary skill in the art will appreciate that effective amounts of the agents of the invention can be determined empirically and can be employed in pure form or, where such forms exist, in pharmaceutically acceptable salt, ester or prodrug form.
The pharmaceutical composition comprising a plantazolicin-like compound or plantazolicin can be administered to a patient in order to prevent and/or treat anthrax infection. It will be understood that, when administered to a human patient, the total daily usage of the plantazolicin compound or composition of the present invention will be decided by the attending physician within the scope of sound medical judgment, and when administered to an animal, will be determined by a veterinarian. The specific therapeutically effective dose level for any particular patient will depend upon a variety of factors: the type and degree of the cellular or physiological response to be achieved; activity of the plantazolicin compound; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the agent; the duration of the treatment; drugs used in combination or coincidental with the specific agent; and like factors well known in the medical arts.
In some embodiments, a pharmaceutical composition comprising a plantazolicin compound is administered once daily. In other embodiments, plantazolicin is administered twice daily, and in still other embodiments, it is administered three times a day. In some embodiments, a pharmaceutical composition comprises a plantazolicin compound in an amount from about 100 μg to about 100 mg. In other embodiments, the pharmaceutical composition comprises a plantazolicin compound in an amount from about 1 mg to about 50 mg.
As noted above, plantazolicin is bactericidal against B. anthracis, and as such pharmaceutical compositions described herein can be used to treat anthrax. Anthrax disease is caused by the bacterium Bacillus anthracis, a gram-positive, sporulating bacillus. B. anthracis is a soil bacterium and is distributed worldwide.
The disease can take on one of four forms: (1) cutaneous, the most common, which results from contact with an infected animal or animal products; (2) inhalational, which is less common and a result of spore deposition in the lungs, (3) gastrointestinal, and (4) oropharyngeal (back of the throat), both of which are due to ingestion of infected meat.
The cutaneous disease constitutes the majority (up to 95%) of anthrax cases. Anthrax usually develops in cattle, horses, sheep, and goats, and as such, is a major veterinary concern. Animals can contract the spores while grazing. Humans can contract anthrax from inoculation of minor skin lesions with spores from infected animals, their hides, wool or other products, such as infected meat (Franz et al. (1997) J. Am. Med. Assoc. 278(5): 399-411). Anthrax in humans is rarer than in animals unless the spores are spread intentionally.
Anthrax disease occurs when spores enter the body, germinate to the bacillary form, and multiply. In cutaneous disease, spores gain entry through cuts, abrasions, or in some cases through certain species of biting flies. Germination is thought to take place in macrophages, and toxin release results in edema and tissue necrosis but little or no purulence, probably because of inhibitory effects of the toxins on leukocytes. Generally, cutaneous disease remains localized, although if untreated it may become systemic in up to 20% of cases, with dissemination via the lymphatics. In the gastrointestinal form, B. anthracis is ingested in spore-contaminated meat, and may invade anywhere in the gastrointestinal tract. Transport to mesenteric or other regional lymph nodes and replication occur, resulting in dissemination, bacteremia, and a high mortality rate. Symptoms include nausea, loss of appetite, vomiting, fever, abdominal pain, vomiting of blood and severe diarrhea. Death results in 25%-60% of cases.
In cases of inhalation of anthrax spores, after deposition in the lower respiratory tract, spores are phagocytized by tissue macrophages and transported to hilar and mediastinal lymph nodes. The spores germinate into vegetative bacilli, producing a necrotizing hemorrhagic mediastinitis (Franz et al., supra). Symptoms include fever, malaise and fatigue, which can easily be confused with the flu. The disease may progress to an abrupt onset of severe respiratory distress with dyspnea, stridor, diaphoresis and cyanosis. Death usually follows within 24 to 36 hours.
The average incubation period for anthrax is 1 to 7 days, but it can take 60 days or longer for symptoms to develop. Symptoms depend on how the infection was acquired. For humans, anthrax is a particularly fearsome biological warfare agent, not only because of its deadliness, but also because anthrax weapons are relatively easy to produce and deliver. Production of anthrax spores requires little more than basic laboratory equipment and growth media. Anthrax weapons may be comprised of an anthrax source and an industrial sprayer that can produce aerosol particles of the appropriate size for victims to inhale. Such sprayers, for instance, can be mounted on low flying airplanes or other vehicles and used to spread anthrax over a wide area. Because of the ease and relatively small expense involved in producing and delivering anthrax weapons, such weapons are potentially highly attractive weapons of mass destruction for terrorist groups. Thus, in addition to potential organized military conflicts that may give rise to the use of such weapons, terrorist organizations are a potential threat for the use of such weapons in airports, office buildings and other centers of human activity.
Currently, B. anthracis infections are treated with various broad-spectrum antibiotics. In order to completely eliminate B. anthracis, antibiotic treatment often requires over 60 days of administration. Consequently, the current method of treatment increases the dangers of multi-drug resistance. Multi-drug resistance arises from horizontal gene transfer of drug-resistant bacteria and has lead to the generation of many harmful infectious diseases including, but not limited to, Vancomycin-resistant enterococcus (VRE) and Methicillin-resistance Staphlococcus aureus (MRSA).
Most current treatments of bacterial infections kill off the human intestinal bacteria which has two negative side effects: the “healthy” bacteria serve as a reservoir for antibiotic resistance and keep other pathogens at bay. Prolonged, broad-spectrum antibiotics leave patients at risk for secondary infections that are harder to treat that the primary infection. A plantazolicin-like compound and plantazolicin, both being highly discriminating antibiotics, provides numerous advantages over the currently used antibiotics, such as high specificity and low risk of developing multi-drug resistance.
Accordingly, it is one embodiment of the present invention to provide a method for treating or preventing anthrax in a patient by administering to the patient any of the pharmaceutical compositions comprising a plantazolicin-like compound or plantazolicin that are described herein. In one embodiment, the patient is a human. In another embodiment, the patient is an animal. The animal is preferably selected from a dog, cat, horse, sheep, goat, or cow. Any of the anthrax infections such as cutaneous, inhalation and gastrointestinal anthrax can be treated using a plantazolicin-like compound or plantazolicin. In some embodiments, a plantazolicin-like compound or plantazolicin is used to treat or prevent anthrax is administered orally, intravenously, subcutaneously or intramuscularly. In other embodiments, the daily dosage used to treat anthrax is from about 100 μg to about 100 mg of plantazolicin or plantazolicin-like compound, and in still other embodiments, the daily dosage of PZN or PZN-like compound is from about 1 mg to about 50 mg.
As noted above, B. pumilus produced PZN identical to the one produced by Bacillus amyloliquefaciens FZB42. The search for other PZN-like proteins was performed using a protein BLAST search where each PZN gene product was used as the query sequence. B. pumilus ATCC 7061 was a top result in the sequence search after FZB42, and the additional three PZN-like biosynthetic clusters were found in the Actinobacteria phylum including Clavibacter michiganensis subsp. sepedonicus (potato pathogen), Corynebacterium urealyticum DSM 7109 (human skin-associated bacterium, causative agent of some urinary tract infections), and Brevibacterium linens BL2 (human skin-associated bacterium).
Another embodiment of the present invention is to provide a method for identifying a plantazolicin-like protein, wherein the method comprises identifying a bacterial amino acid sequence exhibiting at least 50% amino acid identity to a plantazolicin precursor peptide from Bacillus amyloliquefaciens FZB42; obtaining a post-translationally modified product of the bacterial amino acid sequence; and testing the post-translationally modified product of the bacterial amino acid sequence in a Bacillus anthracis growth inhibitory assay, wherein the ability to inhibit the growth of Bacillus anthracis indicates that the bacterial amino acid encodes a plantazolicin-like protein.
The identification of a bacterial amino acid sequence exhibiting at least 50% amino acid identity to the plantazolicin precursor peptide can be used to search for a plantazolicin-like biosynthetic gene cluster in a bacterial genome. Alternatively, any other polypeptide from Bacillus amyloliquefaciens FZB42 can be used as a reference sequence to find other plantazolicin-like gene cluster products. By way of example and not of limitation, PznE can be used to search for other plantazolicin-like leader peptidases, which can then be used to search for plantazolicin-like biosynthetic clusters.
For sequence comparison, typically one sequence, such as plantazolicin in this case acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
One example of a useful algorithm is PILEUP. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments to show relationship and percent sequence identity. It also plots a tree or dendogram showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle (1987) J. Mol. Evol. 35:351-360. The method used is similar to the method described by Higgins and Sharp (1989) CABIOS 5:151-153. The program can align up to 300 sequences, each of a maximum length of 5,000 nucleotides or amino acids. The multiple alignment procedure begins with the pairwise alignment of the two most similar sequences, producing a cluster of two aligned sequences. This cluster is then aligned to the next most related sequence or cluster of aligned sequences. Two clusters of sequences are aligned by a simple extension of the pairwise alignment of two individual sequences. The final alignment is achieved by a series of progressive, pairwise alignments. The program is run by designating specific sequences and their amino acid or nucleotide coordinates for regions of sequence comparison and by designating the program parameters. Using PILEUP, a reference sequence is compared to other test sequences to determine the percent sequence identity relationship using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps. PILEUP can be obtained from the GCG sequence analysis software package, e.g., version 7.0 (Devereaux et al. (1984) Nuc. Acids Res. 12:387-395).
Another example of an algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1977) Nuc. Acids Res. 25:3389-3402, and Altschul et al. (1990) J. Mol. Biol. 215:403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/). This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) or 10, M=5, N=−4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89:10915) alignments (B) of 50, expectation (E) of 10, M=5, N=−4, and a comparison of both strands.
The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
The protein sequence search shows sequences in order of highest to lowest sequence identity to the reference sequence. Any bacterial sequences identified in the protein sequence search as exhibiting at least 50% identity to the reference sequence can be further tested to confirm whether they are indeed plantazolicin-like sequences. One way of confirming is to test a post-translationally modified product of the bacterial amino acid sequence in a Bacillus anthracis growth inhibitory assay. In such an assay, the ability of the post-translationally modified product of the bacterial amino acid sequence to inhibit the growth of Bacillus anthracis indicates that the bacterial amino acid encodes a plantazolicin-like protein.
In an exemplary embodiment, the post-translationally modified product of the bacterial amino acid sequence can be obtained by growing bacteria containing a gene for the bacterial amino acid sequence under conditions, which allow for transcription of such gene, and for post-translational processing of a polypeptide encoded by the gene. One skilled in the art can determine such conditions without undue experimentation. Some of the parameters that can be varied include media compositions, aeration conditions, incubation times and temperatures.
Molecular biological techniques, biochemical techniques, and microorganism techniques as used herein are well known in the art and commonly used, and are described in, for example, Sambrook J. et al. (1989), Molecular Cloning: A Laboratory Manual, Cold Spring Harbor and its 3rd Ed. (2001); Ausubel, F. M. (1987), Current Protocols in Molecular Biology, Greene Pub. Associates and Wiley-interscience; Ausubel, F. M. (1989), Short Protocols in Molecular Biology: A Compendium of Methods from Current Protocols in Molecular Biology, Greene Pub. Associates and Wiley-interscience; Innis, M. A. (1990), PCR Protocols: A Guide to Methods and Applications, Academic Press; Ausubel, F. M. (1992), Short Protocols in Molecular Biology: A Compendium of Methods from Current Protocols in Molecular Biology, Greene Pub. Associates; Ausubel, F. M. (1995), Short Protocols in Molecular Biology: A Compendium of Methods from Current Protocols in Molecular Biology, Greene Pub. Associates; Innis, M. A. et al. (1995), PCR Strategies, Academic Press; Ausubel, F. M. (1999), Short Protocols in Molecular Biology: A Compendium of Methods from Current Protocols in Molecular Biology, Wiley, and annual updates; Sninsky, J. J. et al. (1999), PCR Applications: Protocols for Functional Genomics, Academic Press; and the like. Relevant portions (or possibly the entirety) of each of these publications are herein incorporated by reference.
Having described the invention in detail, it will be apparent that modifications and variations are possible without departing from the scope of the invention defined in the appended claims.
The following non-limiting examples are provided to further illustrate the present invention.
Strain Construction.
The B. amyloliquefaciens strains and plasmids used in this study are summarized in Table 1.
Bacillus subtilis
Bacillus megaterium
Bacillus amyloliquefaciens
amyloliquefaciens
Bacillus and indicator strains were cultivated routinely on Luria-Bertani broth (LB) medium solidified with 1.5% agar. For production of PZN, a medium containing: 40 g soy peptone, 40 g dextrin 10, 1.8 g KH2PO4, 4.5 g K2HPO4, 0.3 g MgSO4×7H2O, and 0.2 ml KellyT trace metal solution per L was used. KellyT trace metal solution: 25 mg EDTA disodium salt dihydrate, 0.5 g ZnSO4×7H2O, 3.67 g CaCl2×2H2O, 1.25 g MnCl2×4H2O, 0.25 g CoCl2×6H2O, 0.25 g ammonium molybdate, 2.5 g FeSO4×7H2O, 0.1 g CuSO4×5H2O; adjust to pH 6 with NaOH, 500 ml H2O.
The media and buffers used for DNA transformation of Bacillus cells were prepared according to Kunst and Rapoport (J. Bacteriol. 177:2403-2407, 1995). Competent cells were prepared as previously described (Koumoutsi et al., 2004. J. Bacteriol. 186:1084-96). Mutants were obtained after transformation of the FZB42 derivatives with linearized, integrative plasmids containing resistance cassettes flanked by DNA regions homologous to the FZB42 chromosome. The oligonucleotides used for strain construction are listed in Table 2.
Spectinomycin (90 μg/ml) was used for selecting transformants. Gene interruption strains were obtained as follows: PznB RS26: A 2.7 kb PCR fragment was amplified from FZB42 chromosomal DNA using primers pznB-fw and pznB-rv. The fragment was then cloned into pGEM-T, yielding plasmid pRS26a. Plasmid pRS26b was obtained by insertion of a spectinomycin resistance cassette, which was subcloned by PCR using the spc-fw and spc-rv primers and the pIC333 plasmid as a template. The cassette was placed into the central region of the insert and digested with BglII and BamHI. PznC RS31: With primers pznC-fw and pznC-rv, a 2.6 kb fragment containing pznC was amplified by PCR and cloned into vector pGEM-T-Easy yielding plasmid pRS31a. A central fragment of the insert was removed by digestion with Eco105I and replaced with the spectinomycin resistance cassette, yielding pRS31b. PznA RS32: With primers 007400cst-fw and 007400cst-rv, a 2.3 kb fragment encoding the unannotated precursor peptide, pznA, was amplified by PCR and cloned into vector pGEM-T-Easy, yielding plasmid pRS32a. The precursor peptide gene was cleaved by Bsp14071 and interrupted by insertion of a spectinomycin resistance cassette, yielding pRS32b.
The mutants RS27, RS28, RS29 and RS33 were generated by gene splicing using the overlapping extension (SOE) method (Horton et al, 1990, Biotechniques 8:528-35). This method assists in avoiding possible polar effects caused by interrupted reading frames. SOE PCR fusion products were generated using the primers listed in Table 2 and the spectinomycin gene of pIC333. A-tailing of the Pfu-PCR product was performed according to the Promega pGEM-T protocol and ligated into pGEM-T yielding pRS27, pRS28 and pRS29. For mutant RS33, the PCR product was used directly for transformation.
Mutant RSpMarA2 was isolated from a mariner-based (pMarA) transposon library prepared in strain CH5 according to Breton et al. (Appl Environ Microbiol 72:327-33, 2006). In this transposon mutant, pMarA was integrated into the degU gene, which is a global transcriptional regulator that activates the bacillomycin D promoter.
Bioassay.
LB-Agar (20 ml) was mixed with 0.5 ml of the indicator strain (OD600˜1.0). 10 μl of purified PZN suspended in water was spotted on the agar and incubated for 16 h at 22° C. The growth suppression activity of PZN was observed as clear zone.
Purification of Plantazolicin.
A cell surface extract from a 250 ml culture of strain RSpMarA2 was collected using the previous method. During concentration under reduced pressure, plantazolicin precipitated. The precipitate was washed 3 times with deionized water, resulting in crude, desalted plantazolicin. Pure plantazolicin was obtained using RP-HPLC (Grom-Sil ODS-5 ST, 20×250 mm, Alltech-Grom, Rottenburg-Hailfingen) with a linear gradient elution of 40-70% aqueous acetonitrile with 0.1% v/v formic acid over 40 min at a flow rate of 15 ml/min.
RT-PCR.
Total RNA was isolated with the Qiagen RNeasy Mini Kit. Cells (1.0 OD600) were harvested from M9 minimal media supplemented with BME vitamin mix (Cat. No. B6891) and ATCC trace mineral solution (Cat. No. MD-TMS) and treated with the Qiagen RNAprotect Bacteria Reagent. Harvested cells were resuspended in 250 μl of 10 mM tris (pH 8.5) with 15 mg/ml lysozyme and 5 μl proteinase K (20 mg/ml) and digested for 1 h at 22° C. with gentle agitation. A DNase I digestion was performed for pznE and pznL using the Qiagen RNase Free DNase set. DNase I (7 μl) and RDD DNA digest buffer (7 μl) were used to hydrolyze contaminating DNA for 20 min at 22° C. The RNA isolation protocol was then followed to manufacturer's instructions. To minimize background, a DNase I digestion (5 μl) was executed to the RNA samples and placed at 37° C. for 20 min. It should be noted that this was the second DNase I digest for pznE and pznL. Samples were column purified using the RNA cleanup protocol in the RNeasy Mini Handbook (Qiagen). Digestion and cleanup were repeated for all RNA samples, excluding those used to analyze pznE and pznF. cDNA was prepared with commercially available RT-PCR kits using 1 μg of RNA and the primers listed in Table 2.
Reverse Transcriptase-PCR.
Transcription of all 12 pzn genes in M9 minimal media was confirmed by RT-PCR. All amplicons migrated with their expected sizes (Table 2). In addition to confirming transcription, the intergenic regions of the PZN biosynthetic cluster were assessed to determine if the mRNA was polycistronic. Using the appropriate primers from adjacent genes, it was determined that the biosynthetic genes were transcribed into two polycistronic mRNAs (pznFKGHI and pznJCDBEL) and a monocistronic mRNA for pznA. Amplification of the region between pznE and pznL resulted in a band that was visible only under extreme contrast (data not shown).
Plantazolicin was tested for its ability to inhibit the growth of Gram-positive bacteria. In the agar bioassays, where growth inhibition is indicated by a clear zone, plantazolicin was shown to be growth inhibitory towards most of the gram-positive Bacilli surveyed, especially B. megaterium and B. subtilis HB0042 (Table 3).
Bacillus brevis ATCC8246
Bacillus subtilis 168
Bacillus cereus ATCC14579
Bacillus licheniformis ATCC9789
Micrococcus luteus
Bacillus pumilus
Bacillus subtilis CU1065
Bacillus subtilis HB0042
Bacillus sphaericus
Paenibacillus polymyxa
Paenibacillus granivorans
Bacillus megaterium 7A1
Arthrobacter sp.
Staphylococcus aureus
E. coli K12
Klebsiella terrigena
Pseudomonas sp.
Erwinia caratovora
aDegree of inhibition in a bioassay: ++: inhibition; +: weak inhibition; −: no inhibition
bATCC: American Type Culture Collection
Production and Purification of PZN.
Overnight cultures (4×20 mL) of B. amyloliquefaciens FZB42 strain RSpMarA2 (Δsfp, yczE, degU) were used to inoculate 4×6 L flasks with 2 L of Luria Burtani (LB) broth supplemented with chloramphenicol (7 μg/mL) and kanamycin (7 μg/mL). Cultures were grown with shaking for 48 h at 37° C. Cells were harvested by centrifugation (4,000×g), washed with Tris-buffered saline (pH 8.0), and harvested a second time. Crude PZN was obtained by a non-lytic, methanolic extraction of the cellular surface. Cells were resuspended in MeOH (10% culture volume) and anhydrous Na2SO4 (5 g/L culture). The cell mixture was agitated by vortex (45 s) and equilibrated for 15 min at 22° C. The supernatant was retained after centrifugation (4,000×g), vacuum filtered with Whatman filter paper, and rotary evaporated to dryness to yield about 100 mg/L of a yellowish-brown solid. This crude material was dissolved in 80% aqueous MeCN (10 mL for 8 L culture), where the sample separated into two layers. The top organic layer was retained and concentrated for injection onto an Agilent 1200 series liquid chromatograph that was fitted inline to an Agilent 6100 Series Quadrupole LC/MS. For preparative purposes, PZN was reverse phase purified using a Thermo BETASIL C18 column (250 mm×10 mm; pore size: 100 Å; particle size: 5 μm) at a flow rate of 4 mL/min. A gradient of 65-85% MeOH with 0.1% formic acid over 32 min was used. The fractions containing PZN (as monitored by A266 and MS) were collected into 20 mL borosilicate vials and the solvent removed in vacuo. The isolated yield for PZN following this procedure was routinely 150-200 μg/L culture. Mutant RS33 (Asfp, bac, pznL) was prepared similarly, with the only exceptions being a 24 h fermentation, substitution of spectinomycin (90 μg/mL) for kanamycin, and elimination of the TBS wash.
Production of PZN (Elevated Oxygen).
Increased aeration of B. amyloliquefaciens FZB42 strains RSpMarA2 and RS33 was achieved using a New Brunswick Scientific BioFlo 110 Fermenter system. RSpMarA2 and RS33 (9 L) were cultured at 37° C. with 250 rpm stirring for 24 h. Air was supplied at 5 L/min (saturated in oxygen, ˜1 L/min).
Determination of Minimum Inhibitory Concentration (MIC).
B. anthracis strain Sterne was grown to stationary phase in a 10 mL LB culture at 37° C. The culture was adjusted to OD600 of 0.01 in LB broth and added to 96-well plates. 2-fold dilutions of PZN (5 mg/mL in 80% MeCN) were added to the cultures (0.5-128 μg/mL). Kanamycin was added similarly to control samples, with dilutions from 1-32 μg/mL. Covered plates were incubated at 37° C. for 12 h. The minimum inhibitory concentration that suppressed the growth of at least 99% of the bacteria (MIC99) was established based on culture turbidity. Additional pathogens were grown and prepared similarly as above, with the exception of optimizing the growth media to match an organism's nutritional requirements (Streptococcus pyogenes, Todd Hewitt broth; Listeria monocytogenes, Enterococcus faecalis st. U503 [VRE], and Staphylococcus aureus st. NRS384/USA300 [MRSA], brain heart infusion). Positive controls: S. pyogenes and L. monocytogenes, kanamycin; E. faecalis, tetracycline; S. aureus, vancomycin). Bactericidal activity was determined by diluting 1 μL of B. anthracis strain Sterne grown with 8 μg/mL PZN into 99 μL of media. The sample was then streaked onto LB agar plates and incubated for 24 h for counting colony-forming units.
Agar Diffusion Bioassay.
B. anthracis strain Sterne was grown as described previously and diluted to OD600 of 0.13. The diluted culture (100 μL) was inoculated onto an LB plate and allowed to dry. HPLC-purified PZN (50-200 μg) was added to a paper disk, dried, and added to the plate. Cultures were then incubated at 37° C. for 12 h. Kanamycin (8-25 μg) was used as a positive control, and 80% MeCN was the negative (solvent) control.
Microscopy.
Differential interference contrast (DIC) microscopy images were obtained by preparing live cell images of B. anthracis cultures. Samples were pretreated with or without PZN at 4 μg/mL (MIC99), and morphology was assessed using a Zeiss LSM 700 microscope. The objective used was a Plan-Apochromat 63×/1.40 Oil DIC M27. The analysis software used was Program Zen 2009 Light Edition.
On-Line RPLC-FTMS.
All reverse phase liquid chromatography (RPLC)-Fourier-transform mass spectrometry (FTMS) was conducted using an Agilent 1200 high performance LC(HPLC) system with an autosampler coupled directly to a ThermoFisher Scientific LTQ-FT hybrid linear ion trap-FTMS system operating at 11 tesla. The MS was calibrated weekly using the calibration mixture and instructions specified by the manufacturer. All instrument parameters were tuned according to the manufacturer's instructions (employing bovine ubiquitin for tuning purposes). For all analyses of PZN, a 1 mm×150 mm Jupiter C18 column (Phenomenex, 300 Å, 5 μm) was connected in-line with the electrospray ionization source (operated at ˜5 kV with a capillary temperature of 200-250° C.) for the MS system. A typical sample was loaded onto the column using the autosampler and separated using a linear gradient of H2O/MeCN and 0.1% formic acid with the analytes eluted directly into the MS. All ionized species were subjected to an MS method with five MS and MS/MS events: 1) full scan measurement of all intact peptides (all ions detected in the FTMS in profile mode; resolution: 100,000; m/z range detected: 400-2000), 2-5) data-dependent MS/MS on the first, second, third, and fourth most abundant ions from scan (1) using collision induced dissociation (CID) (all ions detected in the FTMS in profile mode; minimum target signal counts: 5,000; resolution: 50,000; m/z range detected: dependent on target m/z, default charge state: 2, isolation width: 5 m/z, normalized collision energy (NCE): 35; activation q value: 0.40; activation time: 30 ms). During all analyses, dynamic exclusion was enabled with the following settings: repeat count—2, repeat duration—30 s, exclusion list size—300, exclusion duration—60 s.
Direct Infusion FTMS.
After lyophilization for at least 24 h, HPLC purified samples were dissolved in 80% MeOH (to ˜0.5 mg/mL) and then further diluted 10-fold into 50% MeOH supplemented with 0.1% formic acid. The diluted samples were directly infused using an Advion Nanomate 100. The singly charged ions were targeted for CID using identical settings as above, except that the resolution was set to 100,000.
N-Terminal Labeling.
Purified PZN and desmethylPZN were dissolved in 80% MeCN, 10 mM MOPS (pH 8.0) to a final concentration of 1.5 mM. An aliquot (5 μL) was transferred to a microfuge tube containing 5 μL of 80% MeCN, 10 mM MOPS (pH 8.0) supplemented with 20 mM EZ-Link® sulfo-NHS-biotin. Control reactions lacked the NHS-biotin reagent. The samples were allowed to react for 3 h at 23° C. prior to analysis on an Applied Biosystems Voyager DE-STR MALDI-TOF-MS.
NMR.
PZN was produced from low oxygenation cultures and purified as described above. PZN (700 μg) was dissolved in 200 μL of DMSO-d6 and placed into an Advanced Shigemi 5 mm NMR tube matched to DMSO-d6. NMR experiments were conducted on a Varian Unity Inova 500 NB (1H-1H-gCOSY) and a Varian Unity Inova 600 spectrometer (1H, 1H-1H-TOCSY and 1H-13C-gHMBC) using a 5 mm Varian 1H{13C/15N} PFG Z probe and 5 mm Varian 1H{13C/15N} XYZ PFG triple resonance probe, respectively. The 1H-NMR, TOCSY and gHMBC experiments were conducted at 25° C. and utilized water suppression. A mixing time of 150 ms was used for the TOCSY. For the gHMBC, 1J and nJ were set to 140 and 8 Hz, respectively. Chemical shifts were referenced using DMSO (δH=2.50 and δC=39.51), and the spectra were processed and analyzed using MestReC. Stereochemical configuration was assumed to be identical to the ribosomally produced precursor peptide.
Production of PZN from Bacillus pumilus ATCC 7061.
Cultures were prepared as described above for Bacillus amyloliquefaciens FZB42 cells, with the exception that no antibiotics were added. The method employed for metabolite extraction and HPLC purification were identical to samples from B. amyloliquefaciens. Purified fractions were analyzed on a Bruker Daltonics ultrafleXtreme MALDI-TOF/TOF instrument operating in reflector/positive mode. Sinapic acid was used as the matrix.
Results.
Mass spectrometry (MS) was used as the main spectroscopic tool in elucidating plantazolicin structure. Through the use of high-resolution, linear ion trap Fourier Transform hybrid MS (LTQ-FT) operating at 11 tesla, the mass of the protonated form of PZN was measured to be 1336.4783 Da (
Collision induced dissociation (CID) was then used to localize the site(s) of dimethylation and the azoline heterocycle. Analysis of the doubly charged PZN ion using in-line HPLC-FTMS resulted in a spectrum that was featureless from m/z ˜700-1100 as a result of contiguous heterocycle formation (
Cleavage between Thr13-Phe14 led to the formation of several decomposition products that permitted the localization of the (methyl)oxazoline to Thr13. From the apparently unstable parent ion, a formal loss of allene from methyloxazoline (C3H4, 40.0313 Da) to yield a C-terminal amide was frequently observed (
Upon in-depth FTMS analysis of singly charged PZN, which was introduced by direct infusion, much larger ions relative to doubly charged PZN parent ions were routinely observed including the ones consistent with the loss of guanidine (−59.0483 Da, m/z 1277.4299; error, 0.16 ppm) (
HPLC-purified PZN and desmethylPZN (from the pznL methyltransferase deletion strain) were reacted with the amine-specific reagent, N-hydroxysuccinimide (NHS)-biotin (Sholz et al., supra). As observed by MALDI-MS, labeling was only successful in the desmethylPZN reaction, indicating the presence of a free amine in this compound, but not in PZN (
From the apparent hydrolysis of PZN following SDS-PAGE, it was shown that PZN contained an azoline. Such heterocycles are prone to both acid- and base-catalyzed hydrolysis (Frump, J. A. (1971) Chemical Reviews 71, 483; Martin et al., Journal of the American Chemical Society 83, 4835-4838). Mild acid treatment of PZN yielded m/z 1354 (+18), which was shown by CID studies to be from the reconstitution of the Thr13 residue of the precursor peptide (
To corroborate the proposed structure elucidated by MS, a series of two-dimensional NMR experiments was performed, including 1H-1H-gCOSY, 1H-1H-TOCSY, and 1H-13C-gHMBC on a 600 MHz instrument (
During the course of optimizing the production of PZN for detailed spectroscopic analysis, it was noticed that the level of culture oxygenation had an impact on the production of PZN and derivative metabolites. Under low oxygen fermentation, PZN (m/z 1336) was the majority species present after a non-lytic, cell surface extraction procedure, as demonstrated by the UV trace, total ion chromatogram (TIC), and the extracted ion chromatogram (EIC,
Under oxygen saturated cultivation, UV and TIC monitoring revealed an additional, highly abundant species at 14.7 min (
The production of additional PZN-related species was also observed for desmethylPZN when oxygenation levels were increased during cultivation of the pznL methyltransferase deletion strain (
It was determined that PZN exhibited activity primarily towards Bacillus sp., including B. subtilis. PZN exhibited no activity against any tested Gram-negative organisms. To further define the selectivity within the Gram-positive organisms, the scope of PZN activity was evaluated towards a panel of ubiquitous human pathogens, including methicillin-resistant Staphylococcus aureus (MRSA), vancomycin-resistant Enterococcus faecalis (VRE), Listeria monocytogenes, Streptococcus pyogenes, and Bacillus anthracis strain Sterne (a surrogate for the BSL3 pathogen, which lacks the poly-D-glutamic acid capsule). Using a microbroth dilution bioassay, potent growth inhibition of B. anthracis was observed (
The specificity for PZN against B. anthracis was recapitulated in an agar diffusion bioassay (
Dimethylation of the α-amino group was apparently important for PZN's antibiotic activity, as desmethylPZN was devoid of activity against B. anthracis in both bioassays (
A targeted bioinformatics survey using the thiazole/oxazole synthetase proteins (cyclodehydratase, dehydrogenase, and docking protein) of PZN yielded four highly related biosynthetic gene clusters (
Based on the identical amino acid sequence of the core regions of the precursor peptides from FZB42 and B. pumilus, it would have been expected that these species produced identical compounds (
Sequence alignment of all five PZN precursor peptides showed that there has been evolutionary pressure to maintain a nearly invariant chemotype giving rise to the PZN structure (from N- to C-terminus): leader peptide cleavage site and N-terminal Arg (FEPxAA*R), five cyclizable residues with position 2 and 4 always Cys and position 6 always Thr, two hydrophobic residues, five cyclizable residues, and a more variable C-terminus that ends with Phe, Trp-Gly, or Gly-Gly (
When introducing elements of the present invention or the preferred embodiments(s) thereof, the articles “a”, “an”, “the” and “said” are intended to mean that there are one or more of the elements. The terms “comprising”, “including” and “having” are intended to be inclusive and mean that there may be additional elements other than the listed elements.
In view of the above, it will be seen that the several objects of the invention are achieved and other advantageous results attained.
As various changes could be made in the above products and methods without departing from the scope of the invention, it is intended that all matter contained in the above description and shown in the accompanying drawings shall be interpreted as illustrative and not in a limiting sense.
| Filing Document | Filing Date | Country | Kind | 371c Date |
|---|---|---|---|---|
| PCT/US2011/057333 | 10/21/2011 | WO | 00 | 4/23/2014 |
| Number | Date | Country | |
|---|---|---|---|
| 61501412 | Jun 2011 | US |