Patent Application
20050181449
The present invention relates to certain protein arrays and their use in screening methods.
A multitude of cellular signalling and homeostatic processes are mediated by transmembrane proteins such as ion channels, receptors and transporters. All of these protein classes interconnect with signalling, regulatory, scaffolding and adapter proteins through protein-protein interactions involving cytoplasmic domains.
Ion channels, membrane bound receptors such as G-protein-coupled receptors and many cell surface transporters are comprised of protein subunit complexes, consisting of homomeric or heteromeric assemblies of subunits (termed herein as accessory proteins) on the cytoplasmic face of the membrane. The ability of these protein groups to form complexes in a combinatorial manner provides a mechanism for tissue specific expression of transmembrane protein complexes with the requisite biophysical properties or modulator sensitivity. Increasingly, the determinants of subunit interactions are being located to defined domains within these subunit structures. Understanding the interactions of these domains will aid elucidation of membrane protein assembly in native systems and will identify modulatory proteins important for protein function within a cell. Further, perceived wisdom within these research fields recognises that perturbing the interaction between the accessory cytoplasmic subunits and the membrane bound portion of a transmembrane protein, once it is identified, could represent a highly tissue selective and therefore specific way of regulating the activity of the membrane bound molecule. Exogenous inhibitors of accessory protein interactions and hence subunit or modulatory protein assembly, may therefore provide novel, tissue-specific therapeutic targets.
Voltage gated potassium (KV) channels and calcium (Ca2+) channels are recognised as important therapeutic targets in many disorders including those of the CNS, heart, lungs and bladder. Both channel types have a principal pore-forming, voltage-sensing α-subunit. Kv channels require assembly of four similar α-subunits, each containing six transmembrane segments, whereas calcium channels have a single α-subunit with 24 transmembrane segments, packaged into four ‘pseudosubunits’ of six transmembrane segments [1]. Both Kv and Ca2+ channels co-assemble with structurally similar cytoplasmic β-subunits via well-defined domains within the α-subunit. These can affect channel gating to various extents and can dramatically alter surface expression efficiency of α-subunits through mechanisms that may resemble or mimic the interaction of membrane proteins with authentic molecular chaperones [2]. To date, there have been six β-subunits identified for each of the two channel types. The ability of the Ca2+ channel β-subunits to assemble with the six α-subunits has been determined [3] but the interactions of the Kv channel β-subunits with the twenty or so α-subunits is less well established and it is not yet known in detail which combinations of β- and α subunits are truly biologically relevant since the methods of analysis currently available are relatively crude (see below).
Receptors, in particular G-protein coupled receptors, are recognised as an extremely important group of cell surface proteins and they perform a wide variety of functions in many systems [4]. These 7-12 transmembrane proteins are grouped into three families, A, B and C, within which are many subtypes. Each GPCR interacts with at least one G-protein at its cytoplasmic face although the nature and identity of these interactions is poorly understood and is currently impossible to predict from bioinformatics. G-proteins, as well as complexing with GPCR's also interact with K+ and Ca2+ channel subunits in a specific manner with striking results [5].
Proteins at the cell surface that allow entry of bulky molecules represent a third class of membrane proteins, transporters, that complex with multiple cytosolic protein subunits in order to function, but here again the exact nature and identity of these interactions is poorly characterised at present due to limitations in current analysis methodologies.
New methodologies which enable the highly parallel in vitro characterisation, including determination of equilibrium and kinetic binding parameters, of protein subunit binding interactions between various putative subunit partners will be tremendously useful in this field, particularly if they also allow assessment of the ability of potentially therapeutic compounds to modulate such interactionsCurrent methods for studying these interactions rely on cumbersome cell-based techniques such as electrophysiological analysis, or low throughput in vitro binding systems such as pull-down/immuno-precipitation assays. By contrast, the present invention describes an array-based method whereby the in vitro binding of soluble, functional domains of membrane-bound proteins, such as ion channels, cell surface receptors and transporters to arrays of immobilised cytoplasmic accessory proteins can be characterised in detail. The invention allows binding affinity and specificity of the protein-protein interaction to be determined and also allows the actions of inhibitors/competitors of the interaction to be explored in a highly parallel system.
The yeast two-hybrid system has been used to detect interactions between, for example, ion channel protein domains. This approach has been reasonably successful in identifying binding domains and in determining the effect of amino acid substitutions on the interaction. However, this method cannot provide quantitative information about binding affinities and cannot address the potential of exogenous substances to modulate the interactions. Alternatively, cell-based systems, for example whole-cell electrophysiology following subunit expression in Xenopus oocytes or mammalian cell lines, have been used to study ion channel assembly. This approach is technically difficult, inherently time-consuming and provides limited information about the actual binding events due to the measurement of downstream effects, ie whole-cell currents.
Biochemical methods have been used to isolate individual components of ion channel assemblies in native and recombinant systems. Co-immunoprecipitation experiments and affinity purification of channel subunits have been used to identify components of ion channel complexes. However, neither method provides detailed information about binding affinities or is suitable for screening potential modulators of subunit interactions. In the case of Ca2+ channels, fragments of one particular α-subunit have been immobilised on agarose beads as fusions to GST and the binding of in vitro translated β-subunits was used to more closely define the specific region of the α-subunit involved in the interaction [6]. Detailed information on binding affinities were not available in this study and it is not clear that the alpha subunit was correctly folded in this study.
Protein overlay binding examines binding interactions directly between a soluble peptide/protein and a target protein immobilised on a membrane support [7]. During this procedure proteins are initially dissociated and separated by SDS-PAGE and transferred to a nitrocellulose filter as for Western blotting. The denaturing step implicit in this method however suggests that the proteins assayed in this technique cannot be functional (i.e. folded) and therefore biologically active. Attempts can be made to renature the protein before binding of a soluble, labelled protein is investigated however the success rate here is poor.
Identification of native interactions between membrane proteins and accessory proteins, and the binding domains involved, have been investigated using various cell-based methods. For example, the native combinations of α and β Kv channel subtypes within a complex have been probed using co-purification with antibodies or subtype-specific toxins [9,10]. Yeast two-hybrid experiments have been widely used to identify protein-protein interaction domains and, for example, were used to identify the region of the N-terminal T1 domain of Kv channels that interacts with the cytoplasmic β subunits [11]. The ability of proteins to interact in a model cell has been investigated using recombinant expression techniques. Examples include co-expression of voltage-gated ion channels and functional characterisation using electrophysiology [3,11,12], and the expression of chimeric and mutant GPCRs [reviewed in 13,14]. The perceived wisdom derived from such experiments is that the α and β subunits form a stable complex in the ER which does not subsequently dissociate.
Binding interactions between domains of membrane proteins and the domains of other subunits or their cytoplasmic partners, following separate expression, have been studied using pull-down assays on a one-by-one basis. The tetramerisation domains of K+ channel transmembrane subunits have been examined in this way [15]. Intracellular domains of Ca2+ channels binding to β subunits [6] or SNARE proteins [16], the 5-HT2A GPCR binding to arrestins [17] and the CFTR transporter binding to the adapter protein AP-2 [18] have been examined by immobilising the membrane protein domain on beads. Alternatively, the cytoplasmic Homer protein has been immobilised on beads to show the interaction with metabotropic glutamate receptors expressed in a cell lysate [19]. Cross-linking experiments have been performed between CFTR and AP-2 in microtiter plates [18], but in this case proteins were not immobilised. Protein-overlay experiments allow a number of binding interactions to be identified simultaneously. This technique was used to show binding of labelled Drosophila INAD to immobilised TRP Ca2+ channels [20.] This technique allows a number of proteins to be fractionated in different lanes of an SDS-PAGE gel and then immobilised on a nitrocellulose filter to be probed for binding.
The nature of the techniques described above means that the protein analysis usually either involves co-expression of the potential interacting partner, or involves denaturation of one or more of the potential partners, prior to the binding assay. Invariably they are low throughput and do not yield detailed information on binding specificity or affinity and are not generally compatible with small molecule inhibitor studies. To overcome such problems, the Inventors have devised an array of separate, and importantly, functional, accessory proteins that were not originally co-expressed with the membrane protein components. Such an array allows, for the first time, the quantitative determination of interactions in a highly parallel manner.
Thus in a first aspect the invention provides an array comprising a surface having attached thereto at least one cytosolic accessory protein free of it's membrane protein components or other subunits with which it is normally complexed. Preferably, the cytosolic accessory proteins are cytosolic accessory proteins of membrane proteins which are members of a family of homologous membrane proteins. In one embodiment, the family of homologous membrane proteins is selected from the group consisting of ion-channels, G protein coupled receptors and transmembrane transporter proteins.
The accessory proteins on the array can be members of a family of homologous accessory proteins, for example ion-channel subunits (for example, β-subunits), receptor interacting proteins (for example, G proteins, arrestins and G protein receptor kinases) or accessory proteins for transporters (for example transporter protein interacting proteins). Particularly envisaged are arrays wherein the accessory proteins are K+-channel β-subunits, Ca2+-channel β-subunits, G protein subtypes, for example, Gα, Gβ/γ or accessory proteins for transporters. Examples include Kv β-subunits channel e.g. ,β1.1, 1.2, 1.3, 2.1, 2.2, 3.1, 3.2, 4, Calcium channel β-subunits e.g β1a, β1b, β1c, β2a, β2b, β2c, β3a, β3b, β4, G protein families e.g. Gs family (αs and αolf), Gt family, Gi family (αo, αi1-αi13, αz), Gi-0 family, Gq-11 family (αq, α11, α14, α15, α16, α12, α13) and Gα-sensory sensory family (αt-rod, αgust) and βγ family (γt, γ1, γ2, γ3 etc.), or accessory proteins to transporter proteins (for example seratonin and glycine transporter proteins).
The number of proteins attached to the arrays of the invention will be determined, at least to a certain extent, by the number of proteins that occur naturally or that are of sufficient experimental, commercial or clinical interest. An array carrying one or two proteins would be of use to the investigator. However in practice and in order to take advantage of the suitability of such arrays for high throughput assays, it is envisaged that 1 to 10000, 1 to 1000, 1 to 500, 1 to 400, 1 to 300, 1 to 200, 1 to 100, 1 to 75, 1 to 50, 1 to 25, 1 to 10 or 1 to 5 such proteins are present on an array.
In a second aspect, the invention provides a method for determining which cytosolic accessory proteins interact with a given membrane protein or vice versa, said method comprising the steps of:
In a third aspect the invention provides a method for screening compounds or peptides or proteins for the ability to interact selectively with a cytosolic accessory protein, said method comprising the steps of:
This method optionally comprises the additional step (iv) of quantitating the interaction of the interacting partners.
Also provided is a method for screening compounds or peptides or proteins for the ability to selectively modulate the interaction between a cytosolic accessory protein and a membrane protein, said method comprising the steps of
This method optionally comprises the additional step (iv) of quantitating the degree of modulation of the interaction.
The invention also provides the use of an array of cytosolic accessory proteins of the invention to measure the relative catalytic activity of different members of a family of accessory proteins.
The invention also provides the use of an array of cytosolic accessory proteins of the invention as an affinity surface on which to select antibodies from a library of phenotype-genotype-linked antibodies (e.g. phage displayed antibodies).
The invention also provides the use of an array of cytosolic accessory proteins of the invention for determining the effect of post-translational modifications on the interactions of accessory proteins with membrane proteins and/or the properties of said membrane proteins or accessory proteins.
Subunit arrays according to the invention can comprise tagged protein constructs that are each expressed and immobilised in a functional manner in a spatially defined format. The tagged protein constructs can be drawn from groups of accessory protein subunits such as the cytoplasmic auxiliary β-subunits of voltage-gated K+ or Ca2+ ion-channels, G-proteins, or globular accessory proteins that interact with bulk transporters. Binding of a labelled probe, which can be another channel subunit, associating protein, interaction domain, peptide or other potential ligand can be investigated using technically simple protocols in a high throughput manner. Binding of complex mixtures or labelled or unlabelled proteins from recombinant systems or cell lysates can also be examined. An array of identical subunits is suited to screening large numbers of potential binding partners and obtaining detailed binding information. Alternatively, an array of different proteins, representing subunits of different subtypes and species is most suited to examining the specificity of ligand binding.
Such arrays can be used to study ion channels, including the ligand-gated ion channel class of receptors, which exist as multi-subunit complexes, consisting of channel-forming subunits, modulatory proteins and proteins involved in subcellular location of the channel. Interactions between channel subunits may be mediated by defined intracellular domains. Voltage gated K+ and Ca2+ channels co-assemble with structurally similar cytoplasmic (β-subunits via well-defined domains within the α-subunit [7,21,22]. These can affect channel gating to various extents and can dramatically alter surface expression efficiency of α-subunits through mechanisms that may resemble or mimic the interaction of membrane proteins with authentic molecular chaperones [2].
Another application of the arrays of the invention is in the study of receptors, for example, G-protein-coupled receptors (GPCRs). These constitute the largest family of cell surface molecules involved in signal transmission, with over 1000 heptahelical proteins identified in the human genome. GPCRs transduce extracellular signals by activating a subset of trimeric G-proteins. Binding sites can be determined for specific GPCR-G-protein partners, such as rhodopsin and the retinal G-protein transducin [23]. However, the binding determinants of the GPCRs do not form discrete domains and it is difficult to predict the subset of G-proteins a receptor will bind to [24]. An array based method for determining such interactions with the large number of orphan GPCRs currently under investigation would be highly advantageous. The effects of GPCRs are modulated for example, by interactions and binding with G-protein-coupled receptor Idnases (GRKs) and arrestins, which lead to receptor desensitisation and internalisation [25]. It has been demonstrated that the interaction with arrestin is robust enough to be detected by coimmunoprecipitation [17] and can be inhibited by synthetic peptides [26). As such, it is a potential target for investigation using an in vitro binding method.
A further application of the arrays of the invention is in the study of transmembrane transporter proteins. These proteins control the selective uptake of nutrients and export of metabolic products, regulate the balance of ions and solutes between the exterior and interior of the cell and modulate synaptic transmission by the removal of neurotransmitters from the synaptic cleft. A major regulatory mechanism for these proteins involves translocation to and from cell membranes. However, evidence is emerging that regulation by protein-protein interaction with transporters located in the cell membrane also occurs. e.g. Phosphorylation-dependent in vitro binding between the membrane bound E. coli transporter enzyme IICBGlc and the global repressor Mlc has indicated a mechanism of transcriptional control [27]. Binding of a C-terminal domain of the glucose transporter GLUT-1 to a transmembrane regulatory protein, stomatin, has also been demonstrated by affinity column chromatography [28].
The term “array” as defined herein refers to a spatially defined arrangement of one or more protein moieties in a pattern on a surface. Preferably the protein moieties are attached to the surface either directly or indirectly. The attachment can be non-specific (e.g. by physical absorption onto the surface or by formation of a non-specific covalent interaction). In a preferred embodiment the protein moieties are attached to the surface through a common marker moiety linked to each protein, for example as described in WO 01/57198.
Thus, for example, each position in the pattern can contain one or more copies of:
The surface which supports the array can be coated/derivatised by chemical treatment, for instance. Examples of suitable surfaces include glass slides, polypropylene or polystyrene, silica, gold or metal support or membranes made of, for example, nitrocellulose, PVDF, nylon or phosphocellulose. The format of the array can be that of a microwell plate or a microarray.
The use of a protein array format according to the invention has many advantages. For example, an array of components of a membrane protein assembly such as auxiliary subunits, associated proteins and channel subunit domains, permits interactions with binding partners in the solution phase to be examined. Binding parameters can be accurately determined and the effects of modulators or inhibitors of binding can be studied in a highly parallel manner.
A number of recent publications [for example reference 8] have shown that arrays of functional proteins allow the individual members of an array to be screened simultaneously under identical conditions. This allows highly parallel and rapid experiments compared with other techniques, leading to directly comparable results across many proteins. These qualities set protein arrays apart from other assays for protein function, such as Y2H and immunoprecipitations/pull-downs, where the cellular compartmentalisation that is implicit in these other methods effectively divides each protein collection into individual proteins and thus individual assays.
Protein arrays according to the invention can preserve the functional activity of proteins when they are specifically immobilised, allowing biological activity to be directly measured. In addition they provide a direct method for determining the effect of a potential inhibitor entities on on the interactions observed which is not possible in a comparable manner using immunoprecipitations and pull-down assays.
Protein arrays according to the invention can be used to quantitate binding constants (Kd) for observed interactions and also allow the concentration of a compound required to inhibit a given interaction to be measured through determination of IC50 values.
Results obtained from interrogation of arrays of the invention can be quantitative (e.g. measuring binding or catalytic constants KD & KM), semi-quantitative (e.g. normalising amount bound against protein quantity) or qualitative (e.g. functional vs. non-functional). By quantifying the signals for replicate arrays where the ligand is added at several (for example, two or more) concentrations, both the binding affinities and the active concentrations of protein in the spot can be determined. For example, quantitative results, KD and Bmax, which describe the affinity of the interaction between ligand and protein and the number of binding sites for that ligand respectively, can be derived from protein array data. Briefly, either quantified or relative amounts of ligand bound to each individual protein spot can be measured at different concentrations of ligand in the assay solution. Assuming a linear relationship between the amount of protein and bound ligand, the (relative) amount of ligand bound to each spot over a range of ligand concentrations used in the assay can be fitted to equation 1, rearrangements or derivations.
Bound ligand=Bmax/((KD/[L])+1) (Equation 1)
The inventors have produced a functional array of membrane protein accessory proteins to provide a tool for the rapid investigation of binding parameters and specificity of ligands. The ligands can be other proteins, such as binding domains of other membrane protein subunits, peptides or potential therapeutic compounds to modulate complex assembly. The methodology provides for the determination of accurate binding constants in a highly parallel format.
The invention will now be further described by way of the following example which refers to the following figures in which:
Voltage gated potassium (KV) channels are recognised as therapeutic targets in many disorders including those of the CNS, heart, lungs and bladder. They are therefore important therapeutic and commercial targets. They consist of a tetrameric assembly of α-subunits which have six trnnsmembrane spanning domains and are coupled to an assembly of cytoplasmic regulatory β-subunits.
To date, molecular cloning has identified at least 23 different gene products encoding Kv channel α subunits. Further diversification resulting from alternative splicing has also been demonstrated for a number of β subunits. Four families of channel-forming Kv subunits, Kv1 to Kv4, are derived from the Drosophila potassium channels, Shaker, Shab, Shaw and Shal, respectively. Bach of these channel types has multiple subfamily members. A further four families of Kv channels, Kv5, Kv6, Kv8 and Kv9, have been identified that do not form functional channels alone. They can, however, combine with the channel-forming subunits to form functional channels with altered biophysical properties. At least two of these families of auxiliary α subunits (Kv6 and Kv9) have multiple subfamily members.
In addition to the molecular diversity afforded by homomeric and heteromeric tetramerisation of Kv channel α subunits, cytoplasmic β subunits can bind to the channel complex and modulate channel kinetics or cell surface expression. Three families, Kvβ1 to Kvβ3, have been identified to date, with 3 splice variants observed from the Kvβ1 gene. The β-subunit complex binds to a region of the N-terminus of the α-subunit known as the T1 domain and the presence of the subunit increases cell-surface expression of the functional ion channel. An additional role for Kvβ1 subunits in modulating channel gating kinetics has also been established.
Kv β Subunit Array
Materials and Methods for Construction of Kv β Subunit Array
Cloning of His and Biotin Tagged Kyβ Subunit cDNAs
The Rat and Human Kv β1, β2 and β3 subunit core domains cDNA were ligated into an E.coli expression vector downstream of sequence coding for a poly Histidine-tag and the BCCP domain from the E.coli AccB gene. The ligation mix was transformed into chemically competent XL10-Gold cells (Stratagene) according to the manufacturer's instructions. The Kyβ subunit cDNA sequence was checked by sequencing and found to correspond to the expected protein sequence—see Appendix.
Expression of Kyβ Subunits in E.coli
Colonies of XL10-Gold cells containing Kyβ subunit plasmids were inoculated into 5 ml of LB medium containing ampicillin in 20 ml tubes and grown overnight at 37° C. in a shaking incubator. 2 ml of overnight culture was used to inoculate another 200 ml of LB/ampicillin in 500 ml flasks and grown at 37° C. until an OD600 of ˜1.0 was reached. IPTG and biotin was then added to final concentrations of 1 mM and 50 μM respectively and induction continued at 23° C. for 4 hours. Cells were then harvested by centrifugation, cell pellets were washed in PBS×3 and stored in aliquots at −80° C.
Lysis of E.coli Containing Kyβ Subunits
Cell pellets were thawed on ice and 400 μl of lysis buffer (PBS containing 0.1% Tween 20, 1 mg/ml lysozyme and 1 μg/ml DNAse I) was added and the cells were resuspended by pipetting. Lysis was aided by incubation on a rocker at room temperature for 30 min before cell debris was collected by centrifugation at 13000 rpm for 10 min at 4° C. The cleared supernatant of soluble protein was removed and used immediately.
Purification of Kyβ Subunits
Kyβ subunits were purified by use of the hexahistidine tag. Cleared lysates diluted in PBS containing 50 mM imidazole were added to a column containing Talon Cobalt affinity resin (Clontech). The column was washed with 10 column volumes of buffer and protein was eluted in 2 column volumes of PBS containing 300 mM imidazole.
SDS Page
Protein samples were boiled in SDS containing buffer for 5 min prior to loading on 4-20% Tris-Glycine gels (NOVEX) and run at 200V for 45 min. Gels were then used for Westeen blotting or protein was stained directly with Coomassie brilliant blue dye.
Western Blotting
Protein was transferred onto PVDF membrane (Hybond-P, Amersham) and probed for the presence of various epitopes using standard techniques. For detection of the histidine-tag, membranes were blocked in 5% Marvel/PBST and anti-RGSHis antibody (QIAGEN) was used as the primary antibody at 1/1000 dilution. For detection of the biotin tag, membranes were blocked in Superblock/TBS (Pierce) and probed with StreptavidiniHRP conjugate (Amersham) at 1/2000 dilution in Superblock/TBS/0.1% Tween20. The secondary antibody for the RGSHis antibody was anti-mouse IgG (Fc specific) HRP conjugate (Sigma) used at 1/2000 dilution in Marvel/PBST. After extensive washing, bound HRP conjugates were detected using either ECLPlus (Amersham) and Hyperfllm ECL (Amersham) or by DAB staining (Pierce).
Spectra
UV-Vis Spectra (250-500 nm) of purified Kyβ subunits were recorded using a Thermo spectronic scanning spectrophotometer. Proteins were diluted in elution buffer and elution buffer alone was used to take the baseline which is subtracted from all samples.
α Subunit T1 Domain Interaction Assay
The cDNA for the α subunit T1 domain (amino acids 33-135) was cloned downstream of sequences coding for a His-tag and a FLAG-tag in an E.coli expression vector. Plasmids were checked by sequencing for correct sequence and induction of E.coli cultures showed expression of a His and FLAG tagged soluble protein of the expected size. To test for interaction between α subunit T1 domain and Kyβ subunits, binding reactions were assembled containing 10 μl Kyβ subunit cleared lysates, 10 μl anti-FLAG agarose in the presence and absence of 10 μl α subunit T1 domain cleared lysate, in 500 μl phosphate buffered saline containing 300 mM NaCl, 0.1% Tween20 and 1% (w/v) bovine serum albumin. Reactions were incubated on a rocker at room temperature for 1 hour and FLAG bound complexes harvested by centrifugation at 5000 rpm for 2 min. After extensive washing in PBST, FLAG bound complexes were denatured in SDS sample buffer and Western blotted. Presence of biotinylated Kyβ subunits were detected by StreptavidiniHR conjugate.
Kyβ Subunit Microtitre Plate Array Fabrication
To 96 well streptavidin coated microtitre plates 100 μl of optmised concentrations of Kyβ subunit cleared lysates (typically 1 in 16 dilutions in PBS-Tween) were added to each well. Plates were incubated at room temperature with shaking for 45 mins before washing each well 3 times with 300 μl of PBS-Tween. After which the plates were used in assays or stored at −20° C. in the presence of 50% (v/v) glycerol in PBS-Tween.
Kyβ Subunit Array Peptide Binding Assay
Kyβ subunit interacting peptide (SPL2) based on a portion of the α subunit domain was designed, synthesized and fluorescein labeled. SPL2 peptide appropriately diluted in PBS-Tween containing 0.1% w/v BSA was added at 100 μl/well to the Kyβ subunit coated microtitre plate. The peptide was incubated for 1 h at roomtemperature with shaking before unbound peptide was removed by washing 3 timed in 300 μl of PBS-Tween. 100 μl of 6M Guanidine HCl was added to each well before evaluation of Fluorescein labelled SPL2 peptide concentration in each well. The fluorescence of each well of a 96 well microtitre plates were read in a Packard fusion microtitre plate reader equipped with 485 and 520 nm excitation and emission filters respectively.
Kyβ Subunit Array Kv α Subunit T1 Domain Interaction
Kv α subunit T1 domain cleared lysate was diluted 1 in 10 in PBS-Tween containing 0.1% w/v BSA was added at 100 μl/well to the Kyβ subunit coated microtitre plate. The peptide was incubated for 1 h at room temperature with shaking before unbound α subunit T1 domain was removed by washing 3 timed in 300 μl of PBS-Tween. Bound α subunit T1 domain was estimated by using appropriately diluted mouse anti FLAG antibody and anti mouse IgG secondary antibody HRP conjugate using standard ELISA procedures. HRP was detected by addition of colourmetric HRP substrate 2,2′-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid) and microtitre plates were read in a Packard fusion microtitre plate reader equipped with a 405 nm absorbance filter.
Kyβ Subunit Microarray Fabrication
Cleared lysates of Kyβ subunit were loaded into a 384 well plate and printed onto glass microscope slides with a neutravidin immobilized on dextran coating (Xantec) using a Qarray microarraying robot (Genetix, UK) with a 4 pin microarraying head. Each lysate was spotted 16 times onto each array. After printing, arrays were incubated in a humid chamber at 4° C. for 1 h before washing in PBS-Tween. After washing arrays were ready for assay.
Antibody Detection of Microarrayed Kyβ Subunits
Cy3 labelled anti His antibody was diluted to 1 μg/ml in PBS-Tween+0.1% (w/v) BSA and approximately 500 μl was pipetted onto the slide. The slide was incubated at room temperature with very slight shaking for 1 h before washing 2×2 mins in a large volume of PBS-Tween. Slides were centrifuged briefly at 2000 g to remove liquid before scanning in a mnicroarray scanner (Affymetrix 428 array scanner) equipped with excitation laser and emission filters appropriate for Cy3 fluorophore detection.
Kv α Subunit T1 Domain Binding to Microarrayed Kyβ Subunits
Kv α subunit T1 domain cleared lysate was diluted 1 in 50 in PBS-Tween containing 1% w/v BSA and approximately 500 μl was pipetted onto the slide. The slide was incubated at room temperature with very slight shaking for 1 h before washing 2×2 mins in a large volume of PBS-Tween. Appropriately diluted Anti FLAG Antibody was then pipetted onto the array and incubated and washed as above before addition of Cy3 labelled anti mouse IgG. The slides were incubated and washed as above before centrifuging briefly at 2000 g to remove liquid before scanning in a microarray scanner (Affymetrix 428 array scanner) equipped with excitation laser and emission filters appropriate for Cy3 fluorophore detection.
Results
Expression of Kyβ Subunits in E.coli
The Kyβ subunit core domains were cloned downstream of the tac promoter in vector pQE80 into which the BCCP domain from the E.coli gene ACCB had already been cloned. The resultant protein would then be His and biotin tagged at its N-terminus.
Although His and biotin tags have been used in this array, other affinity tags (e.g. FLAG, myc, VSV) could be used to enable purification, detection and immobilization of the cloned proteins. Also an expression host other than E. coli may be used (e.g. yeast, insect cells, mammalian cells) if required.
Purification of Kyβ Subunits
Proteins can be purified before arraying by using an affinity tag. Here we have made use of the his tag by purifying the protein on Talon resin.
UV-Vis Absorbance Spectra
UV-Vis spectra were acquired for all Human and Rat Kv β subunits.
α Subunit T1 Domain Interaction Assay
To confirm that the expressed Kv β subunits have retained native function an assay was devised where the Kv β subunits would be precipitated by binding to α subunit T1 domain coated beads. To anti FLAG beads FLAG tagged Kv α subunit T1 domain lysates were added. These were then mixed with lysates containing the Kv β subunits.
Kyβ Subunit Microtitre Plate Array Fabrication
To confirm that streptavidin coated microtitre plates can be coated with Kv β subunits, lysates were serially diluted and added to wells of plates.
Kyβ Subunit Array α Subunit T1 Domain Interaction Assay
Kyβ Subunit Array Peptide Binding Assay
SPL2 peptide was added to a Kyβ subunit microtitre plate array at a range of concentrations from 100 to 1600 μM. After incubation for 1 h the wells were washed to remove unbound peptide. The remaining peptide was quantifies fluorometrically. The results (shown in
Table 1. Estimates of Kd and Bmax for each of the Kyβ subunits. The data in
Inhibition of Peptide Binding to Kyβ Subunit Array by Kv α Subunit T1 Domain
Binding of SPL2 peptide to Kyβ subunit array was inhibited in the presence of Kv α subunit T1 domain. In
Antibody Detection of Microarrayed Kyβ Subunits
Microarrayed Kyβ subunits are shown to be specifically immobilised on streptayidin coated glass microscope slides. In
Kv α Subunit T1 Domain Binding to Microarrayed Kyβ Subunits
Kv β subunits immobilised on an array are still capable of binding Kv α subunit T1 domain.
1. Jan L Y and Jan Y N (1997) Receptor-regulated ion channels. Curr Opin Cell Biol 9(2):155-60
2. Trimmer, J. S. (1998) Regulation of ion channel expression by cytoplasmic subunits. Curr. Opin. Neurobiol. 8, 370-374.
3. Perez-Garcia, M T et al, (1995) Functional properties of cardiac L-type calcium channels transiently expressed in HEK293 cells. Roles of alpha 1 and beta subunits. J. Gen. Physiol. 105, 289-305.
4. Brady A E, Limbird L. E. (2002) G protein-coupled receptor interacting proteins: Emerging roles in localization and signal transduction. Cell Signal 14(4):297-309
5. Ruiz-Velasco V, Ikeda S R, Puhl H L. (2002) Cloning, tissue distribution, and functional expression of the human G protein {beta}4-subunit. Physiol Genomics 8(1):41-50
6. Walker, D et al. (1998) A β4 isoform-specific interaction site in the carboxyl-terminal region of the voltage-dependent Ca2+ channel α1A subunit J. Biol. Chem., 273, 2361-2367.
7. Xu and Li, (1998) Auxiliary Subunits of Shaker-type potassium channels. Trends. Cardiovasc. Med., 8, 229-234.
8. Zhu H. Klemic J F, Chang S, Bertone P, Casamayor A, Klemic K G, Smith D, Gerstein M, Reed M A, Snyder M. Analysis of yeast protein kinases using protein chips. Nat Genet (2000) 26(3):283-9
9. Dolly, J O and Parcej, D N (1996) Molecular properties of voltage-gated K+ channels. J. Bioenerg. Biomembr., 28, 231-253.
10. Scott, V E et al., (1990) Alpha-dendrotoxin acceptor from bovine brain is a K+ channel protein. Evidence from the N-terminal sequence of its larger subunit. J. Biol. Chem., 265, 20094-20097.
11. Wang, Z et al., (1996) Comparison of Binding and Block Produced by Alternatively Spliced Kvβ1 Subunits. J. Biol. Chem., 271, 28311-28317.
12. Restituito, S et al., (2001) Ca2+ Channel Inactivation Heterogeneity Reveals Physiological Unbinding of Auxiliary Subunits. Biophys. J. 81, 89-96.
13. Strader, C D et al. (1994) Structure and function of G-protein-coupled receptors. Annu. Rev. Biochem., 63, 101-132.
14. Strader, C D et al. (1995) The family of G-protein-coupled receptors. FASEB J., 9, 745-754.
15. Tucker, S. J. and Asheroft, F. M. (1999) Mapping of the physical interaction between the intracellular domains of an inwardly rectifying potassium channel, Kir 6.2. J. Biol. Chem., 274, 33393-33397.
16. Yokoyama, C T et al. (1997) Phosphorylation of the synaptic protein interaction site on N-type calcium channels inhibits interactions with SNARE proteins. J. Neurosci., 17, 6929-6938.
17. Gelber, E et al., (1999) Structure and function of the third intracellular loop of the 5-HT2A receptor: The third intracellular loop is α-helical and binds purified arrestins.
18. Weixel, K M and Bradbury, N A (2001) μ2 Binding directs the cystic fibrosis transmembrane conductance regulator to the clathrin-mediated endocytic pathway. J. Biol. Chem., 49, 46251-46259.
19. Tu, J C et al. (1998) Homer binds a novel proline-rich motif and links group 1 metabotropic glutamate receptors with IP3 receptors. Neuron, 21, 717-726.
20. Shieh, B-H and Zhu, M-Y (1996) Regulation of the TRP Ca+ channel by INAD in Drosophila photoreceptors. Neuron, 16, 991-998.
21. Pongs, O., Leicher, T., Berger, M. et al. (1999) Functional and molecular aspects of voltage-gated K+ channel β subunits.
22. Walker, D. and Waard, M: (1998) Subunit interaction sites in voltage-dependent Ca2+ channels: role in channel function.
23. Onrust, R, Herzmark, P et al. (1997) Receptor and βγ binding sites in the α subunit of the retinal G-protein transcducin. Science, 275, 381-384
24. Boume, H R (1997) How receptors talk to trimeric G proteins. Curr. Opin. Cell. Biol., 9, 134-142.
25. Ferguson, S S G (2001) Evolving concepts in G protein-coupled receptor endocytosis: The role in receptor desensitization and signaling. Pharmacol. Rev., 53, 1-24.
26. Krupnick, J G et al., (1994) Arrestin-rhodopsin interaction. Multi-site binding delineated by peptide inhibition. J. Biol. Chem. 269, 3226-3232.
27. Nam, T-W et al., (2001) The Escherichia coli glucose tramsorter enzyme IICBGIC recruits the global repressor Mlc. EMBO J., 20, 491-498.
28. Zhang, J-Z et al., (2001) Overexpression of stomatin depresses GLUT-1 glucose transporter activity. Am. J. Physiol. Cell. Physiol., 280, C1277-C1283.
Protein Sequence Human Kv β1 subunit core domain (residues 87-419): GTGMKYRNLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESG VNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETE RGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVI NQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQRE KVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQ WLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSS VLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS
Protein Sequence Human Kv β2 subunit core domain (residues 36-364): GLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEQLMTLAYDNGI NLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETER GLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHIN QGMAMYWGTSRWSSMEIMEAYSVARQFNLTPPICEQAEYHMFQREK VEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQW LKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVL LGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKPYSKKDYRS
Protein Sequence Human Kv β3 subunit core domain (residues 75-404): GTGMKYRNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHG VNLFDTAEVYAAGKAERTLGNILKSKGWRRSSYVITTKIFWGGQAETE RGLSRKHIIEGLRGSLERLQLGYVDIVFANRSDPNCPMEEIVRAMTYVI NQGLALYWGTSRWGAAEIMEAYSMARQFNLIPPVCEQAEHHLFQREK VEMQLPELYHKIGVGSVTWYPLACGLITSKYDGRVPDTCRASIKGYQW LKDKVQSEDGKKQQAKVMDLLPVAHQLGCTIVAQLAIAWCLRSEGVSS VLLGVSSAEQLIEHLGALQVLSQLTPQTVMEIDGLLGNKPHSKK
Protein Sequence Rat Kv β1 subunit core domain: GTGMKYRNLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESG VNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETE RGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVI NQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQRE KVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQ WLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSS VLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS
Protein Sequence Rat Kv β2 subunit core domain: GLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGI NLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETER GLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVIN QGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKV EVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWL KDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLL GASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYSKKDYRS
Protein Sequence Rat Kv β3 subunit core domain (residues 75-404): GTGMKYRNLGKSGLRVSCLGLGTWVTFGSQISDETAEDLLTVAYEHG VNLFDTAEVYAAGKAERTLGNILKSKGWRRSSYVITTKIWGGQAETE RGLSRKHIIEGLQGSLDRLQLEYVDIVFANRSDPSSPMEEIVRAMTYVIN QGLALYWGTSRWSAAEIMEAYSMARQFNLIPPVCEQAENHFFQREKV EMQLPELYHKIGVGSVTWSPLACSLITSKYDGQVPDACKATVKGYQW LKEKVQSEDGKKQQARVTDLLPIAHQLGCTVAQLAIAWCLRSEGVSSV LLGVSSAEQLMEHLGSLQVLGQLTPQTVMEIDALLGNKSHSKK
| Number | Date | Country | Kind |
|---|---|---|---|
| 0205910.3 | Mar 2002 | GB | national |
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/GB03/01049 | 3/13/2003 | WO |
