BACTERIAL VAGINOSIS DIAGNOSTIC

Information

  • Patent Application
  • 20210293791
  • Publication Number
    20210293791
  • Date Filed
    July 26, 2019
    7 years ago
  • Date Published
    September 23, 2021
    4 years ago
Abstract
The invention provides a sialidase enzyme activity detection kit or device comprising: (i) an indicator molecule comprising a sialylated peptide and a capture site;(ii) a capture zone comprising capture molecules; and(iii) binding molecules capable of binding to the de-sialylated derivative of the indicator molecule. Also provided are methods of using the kits or devices, as well as specific indicator molecules and specific binding molecules.
Description
FIELD OF THE INVENTION

The present invention relates to detecting cleavage activity of a sialidase enzyme and the use thereof in detecting bacterial vaginosis. In particular, the invention provides specifically-designed peptides and indicator molecules useful for detecting cleavage activity of a sialidase enzyme. Various other aspects of the invention include an enzyme detection device, kit, method and use for detecting or measuring the presence in a test sample of the activity of a sialidase enzyme capable of cleaving an indicator molecule of the invention.


BACKGROUND TO THE INVENTION

Sialidase enzymes (otherwise known as neuraminidases) are glycoside hydrolase enzymes split into two main classes that cleave exo or endo (poly-)sialic acids (EC 3.2.1.18 and EC 3.2.1.129 respectively). Sialic acids are N- or O-substituted derivatives of neuraminic acid (shown below):




embedded image


Sialic acids are generally found in nature in glycoproteins and glycolipids (in particular gangliosides). Viral, bacterial and mammalian sialidases are all known in nature. Elevated levels of bacterial sialidase activity are known to act as a diagnostic marker for bacterial vaginosis (BV; Briselden et. al., J. Clin. Microbiol., 1992, vol. 30, pages 663-666). The theory behind this is based on the bacterial imbalance that can occur in the vagina and the transition from a typical healthy environment high in lactobacilli to an anaerobic driven microbiome (Petrova et. al., Front. Physiol., 2015, 6:81). Certain anaerobes excrete sialidase enzyme and compromise the natural mucus barriers in the vagina. Nonetheless, the exact mechanism for BV is still to be fully established. Patients suffering from symptomatic BV can experience significant discomfort, vaginal discharge, an unpleasant odour and more generally a feeling of lack of control over their vaginal health (Bilardi et. al., Plos One, 2013, vol. 8, e74378). Treatment pathways typically involve topical or oral antibiotics. Topical prebiotic treatments (e.g.: VH essentials®), and pH gel (e.g. balance active BV) are also available over the counter. BV can be intractable and patients can suffer a relapse after antibiotic treatment (Bilardi et. al., Plos One, 2013, vol. 8, e74378). Some of the intractable cases are believed to be linked to the formation of biofilms in the vagina (Verstraelen & Swidsinski, Curr. Opin. Infect. Dis., 2013, 26:86-89). The risks in not picking up the presence of BV are a greater susceptibility to sexually transmitted infection (including HIV) and an associated risk of pre-term birth. The pre-term birth risk is believed to be linked to premature weakening of the cervical mucus barrier (Lewis et. al., J. Biol. Chem., 2013, vol. 288, pages 12067-12079). Currently in the clinic, the test for BV is based on a vaginal sample smear, sent for analysis in the lab. Methods of analysis include looking for clue cells, the potassium hydroxide (KOH) whiff test, or applying set criteria such as the Nugent score (Nash, Jungmann, & Gubert, BMJ Learning, 2015, 1-29). The use of a rapid test at point of care would benefit the patient by delivering a quick answer, putting them on an immediate treatment plan and speed up the overall process for delivering outcomes. Likewise there would be potential benefit to the healthcare provider, by avoiding outsourcing to a lab and the resource and time costs involved and keeping the patient time down to a single session in the first instance.


Two main types of products for diagnosing BV are currently available in the USA and Europe. One set of products is based on a colour changing swab that measures pH. The other set of products is also colourimetric and based on sialidase activity measurement. The pH-based products are available at point of care and over the counter and include VS-SENSE PRO® (sold by Common Sense) and Canestest® (sold by Canesten). The main product currently on sale based on sialidase detection is BV Blue (sold by Sekisui Diagnostics and Gryphus Diagnostics). BV Blue is a swab-based test; a sample swab is placed in an indicator solution which will change colour to indicate the presence of sialidase activity in the sample. The test takes approximately 15 minutes to run.


The pH-based tests lack accuracy since various conditions can cause a change in the local pH of the vagina (e.g. Candidiasis and Trichonomiasis as well as BV). The known tests such as BV Blue which detect sialidase activity lack sensitivity.


DESCRIPTION OF THE INVENTION

The present invention results from attempts to improve sensitivity and/or specificity of sialidase activity detection. The present inventors have now specifically designed peptides and corresponding indicator molecules useful for detecting cleavage activity of a sialidase enzyme. As described further herein, each peptide is conjugated to a sialyl group via a galactosyl group (and thus functions as a substrate for a sialidase enzyme) wherein the peptide architecture is specifically designed so that, once the sialyl group has been cleaved from the peptide by one or more sialidase enzymes present in the sample, the de-sialylated derivative of the peptide is recognised and bound by specific binding molecules (e.g. antibodies). In preferred embodiments, the peptide incorporates one or more amino acids which enhance the peptide's resistance to protease cleavage.


Accordingly, in one aspect, the invention provides a peptide comprises a sequence according to the following formula:











(Formula I)



(SEQ ID NO: 9)



X1-X2-X3[Gal-Sial]-X4-X5







wherein:
    • (i) Sial is a sialyl group;
    • (ii) X3 is a natural or non-natural amino acid comprising a glycosyl acceptor group; and
    • (iii) X1, X2, X4 and X5 are independently selected from any amino acid provided that at least one of X1, X2, X4 and X5 is a D-amino acid and/or a non-standard amino acid or a non-natural amino acid.


The peptide may consist essentially of, or consist of, a sequence of Formula I.


According to all aspects of the invention, by “sialyl group” is meant a sialic acid substituent wherein a sialic acid is an N- or O-substituted derivative of neuraminic acid (e.g. N-acetylneuraminic acid; termed ‘Neu5Ac’ or ‘NANA’).


According to all aspects of the invention, by “Gal” is meant a galactosyl substituent. In preferred embodiments, the galactosyl substituent is a radical of the following structure:




embedded image


In particular embodiments, the galactosyl substituent is a radical of β-galactose. In such embodiments, the galactosyl substituent is O-linked to the sialyl group. All possible regioisomers are encompassed by the invention. The skilled person will also appreciate that other saccharides may be used in place of a galactosyl group, such as radicals of glucose, fructose, lactose, maltose and sucrose for example. Thus, reference to a “galactosyl substituent” herein is to be interpreted accordingly.


The -Gal-Sial group is conjugated to X3 as shown above wherein X3 is a natural or non-natural amino acid comprising a glycosyl acceptor group. That is to say the side-chain of the amino acid represented by X3 comprises a nucleophilic substituent that forms a bond with the Gal substituent (i.e. a glycosyl donor). For instance, the nucleophilic substituent may be a hydroxyl or amine substituent. Thus, in particular embodiments, X3 may be selected from serine (Ser), threonine (Thr), tyrosine (Tyr), hydroxylysine (Hyl), hydroxyproline (Hyp), asparagine (Asn), arginine (Arg) and phosphoserine (SEP). In preferred embodiments, X3 is Ser.


It should be understood from Formula I that the -Gal-Sial group is bonded to X3 only (as indicated by the square brackets in Formula I). It does not bridge X3 to X4. For the avoidance of doubt, an alternative and equivalent formula (Ia) is shown below:




embedded image


Hence, the -Gal-Sial group is branched from the peptide backbone. Thus, the -Gal substituent is positioned centrally in the structure so that it is flanked by amino acids X1, X2, X4 and X5. Consequently, as described further herein, binding molecules (e.g. antibodies) can be generated with very high affinity and specificity for the de-sialylated derivative of each peptide and the generation of peripheral binding molecules (e.g. antibodies) which lack interaction with the Gal substituent is minimised.


X1, X2, X4 and X5 are independently selected from any amino acid (natural and non-natural) provided that at least one of X1, X2, X4 and X5 is a D-amino acid and/or (i) a non-standard amino acid or (ii) a non-natural amino acid. Non-standard and non-natural amino acids add to the sequence diversity and help promote an immune response in a host organism when generating binding molecules which are antibodies with high affinity for the de-sialylated derivative of the peptide. D-amino acids help to reduce susceptibility to proteases. In particular embodiments, at least two, three or all four of X1, X2, X4 and X5 are a D-amino acid and/or a non-standard amino acid or a non-natural amino acid.


The skilled person will be very familiar with the terms “natural” and “non-natural” amino acids. For the avoidance of doubt, a “natural” amino acid is one found in nature and includes both standard and non-standard amino acids. As known in the art, standard amino acids are those that are encoded directly by triplet codons in the universal genetic code. Conversely, non-standard amino acids are those which are found in nature but which are not encoded directly by triplet codons in the universal genetic code. “Non-natural” amino acids are those not found in nature but which only exist via artificial synthesis. As used herein, reference to an amino acid by name with no “D” or “L” prefix is used to mean both D and L stereoisomers. Use of a “D” or “L” prefix denotes that specific stereoisomer.


The “de-sialylated derivative” of a peptide or indicator molecule is the product produced by cleavage of a sialyl group from the peptide or indicator molecule, typically by a sialidase enzyme. Thus, the “de-sialylated derivative” of a peptide or indicator molecule typically differs from the sialylated peptide or indicator molecule only, or substantially only, with regard to the absence of the sialyl group. Any reference herein to a “de-sialylated derivative” of a peptide or indicator molecule should therefore be understood to mean the de-sialylated form of that peptide or indicator molecule.


Further increasing the diversity of the peptide sequence topology is beneficial as this has been shown to further promote the generation of binding molecules with very high affinity and specificity for the de-sialylated derivative of each peptide. This is particularly relevant for binding molecules which are antibodies. Thus, in preferred embodiments, X1, X2, X4 and X5 comprise at least two, three or four different amino acids. In some embodiments, at least one of X1, X2, X4 and X5 is a hydrophobic amino acid. For instance, at least one of X1, X2, X4 and X5 may be selected from alanine (Ala), valine (Val), isoleucine (Ile), leucine (Leu), methionine (Met), phenylalanine (Phe), tyrosine (Tyr), tryptophan (Trp), proline (Pro), D-alanine (DAla), 1-aminocyclohexane-carboxylic acid (Cyc), β-alanine (βAla), norleucine (Nle), norvaline (Nva), 2′-(aminomethyl)biphenyl-2-carboxylic acid (Bip) and cyclohexylalanine (Cha). Preferably, the L-stereoisomer of Nle, Nva and Cha is employed. In further embodiments, at least two or three of X1, X2, X4 and X5 are a hydrophobic amino acid. All four of X1, X2, X4 and X5 may be a hydrophobic amino acid provided at least one of X1, X2, X4 and X5 is a D-amino acid and/or a non-standard amino acid or a non-natural amino acid. In particular embodiments, the at least one hydrophobic amino acid is Ala. In further embodiments, X1 and X2 are both Ala. In preferred embodiments, Ala is DAla or βAla. In further embodiments, each hydrophobic amino acid is selected from DAla, βAla, Ile, Val, Pro, Nle, Nva, Cyc, Cha and Bip. Additionally or alternatively, in some embodiments at least one of X1, X2, X4 and X5 is a charged amino acid. For instance, at least one of X1, X2, X4 and X5 may be selected from arginine (Arg), histidine (His), lysine (Lys), aspartic acid (Asp), glutamic acid (Glu), ornithine (Orn) and phosphoserine (SEP). Preferably, the L-stereoisomer of Orn and the D-stereoisomer of Asp is employed. In further embodiments, at least two or three of X1, X2, X4 and X5 are a charged amino acid. All four of X1, X2, X4 and X5 may be a charged amino acid provided at least one of X1, X2, X4 and X5 is a D-amino acid and/or a non-standard amino acid or a non-natural amino acid. In particular embodiments, each charged amino acid is selected from Arg, Glu, DAsp, LOrn and SEP. Additionally or alternatively, in some embodiments at least one of X1, X2, X4 and X5 is a polar amino acid. For instance, at least one of X1, X2, X4 and X5 may be selected from serine (Ser), threonine (Thr), tyrosine (Tyr), asparagine (Asn), glutamine (Gin) and cysteine (Cys). Preferably, the D-stereoisomer of Ser is employed. In further embodiments, at least two or three of X1, X2, X4 and X5 are a polar amino acid. All four of X1, X2, X4 and X5 may be a polar amino acid provided at least one of X1, X2, X4 and X5 is a D-amino acid and/or a non-standard amino acid or a non-natural amino acid. In particular embodiments, each polar amino acid is selected from LSer, DSer and Thr. In preferred embodiments, to maximise the diversity of the peptide sequence topology, X1, X2, X4 and X5 are a combination of hydrophobic, charged and polar amino acids. Pro and βAla in particular are useful in the peptides of the invention as these function as “hinge groups” allowing additional degrees of freedom in the overall structural fold thereby further increasing the diversity of the peptide sequence topology.


In preferred embodiments, the peptide has a molecular weight of less than 5000 daltons. This facilitates stimulation of an immune response in the host organism for the generation of antibodies which bind to the de-sialylated derivative of the peptide. Thus, in particular embodiments, the peptide may be between 5-20 amino acids in length, more preferably 9-20 amino acids in length.


Thus, in a related aspect, the invention provides a peptide comprising a sequence according to the following formula:









(Formula II)


(SEQ ID NO: 10)


X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12[Gal-Sial]-X13-


X14-X15-X16-X17-X18-X19-X20







wherein:


Sial is a sialyl group


X1 is absent or Thr


X2 is absent or DAla


X3 is absent or Nle


X4 is absent or Glu


X5 is absent or DAla


X6 is absent or Arg


X7 is absent or selected from Glu, Arg, Ser, Nva, βAla


X8 is absent or selected from DSer, DAla, SEP, Cyc


X9 is absent or selected from Nva, BIP, DAla, βAla, Orn


X10 is selected from Cyc, Ser, Ile, DAla, DSer


X11 is selected from DAla, Pro, Orn, Nle


X12 is selected from Ser, Thr, Tyr, Hyl, Hyp, Asn, Arg or SEP


X13 is selected from DAla, BIP, βAla


X14 is selected from Arg, DAsp, Nle, Orn, Nva


X15 is absent or selected from Phe, BIP, Ser, Glu, DAla, DSer


X16 is absent or selected from DSer, Glu


X17 is absent or selected from Val, Ser, Thr


X18 is absent or Cha


X19 is absent or DSer


X20 is absent or Val.


It should be understood from Formula II that the -Gal-Sial group is bonded to X12 only (as indicated by the square brackets in Formula II). It does not bridge X12 to X13. For the avoidance of doubt, an alternative and equivalent formula (IIa) is shown below:




embedded image


Hence, the -Gal-Sial group is branched from the peptide backbone. Thus, the -Gal substituent is positioned so that it is flanked by amino acids X10-11 and X13-14 as well as amino acids X1-9 and X15-20 (if present). Consequently, as described further herein, binding molecules (e.g. antibodies) can be generated with very high affinity and specificity for the de-sialylated derivative of each peptide and the generation of peripheral binding molecules (e.g. antibodies) which lack interaction with the Gal substituent is minimised.


In preferred embodiments, X12 is Ser.


In particular embodiments, according to all aspects of the invention, the peptide comprises, consists essentially of or consists of the following sequence:









(i)


(SEQ ID NO: 11)


Cyc-DAla-Ser[Gal-Sial]-DAla-Arg





(ii)


(SEQ ID NO: 12)


Glu-DSer-Nva-Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-Phe-



DSer-Val






(iii)


(SEQ ID NO: 13)


Arg-DAla-Bip-Ser-Pro-Ser[Gal-Sial]-DAla-DAsp-Ser





(iv)


(SEQ ID NO: 14)


Ser-Ser(PO3)-DAla-Ile-Orn-Ser[Gal-Sial]-DAla-Nle-Glu





(v)


(SEQ ID NO: 15)



DAla-Arg-Nva-DSer-βAla-DAla-Nle-Ser[Gal-Sial]-Bip-



Orn-DAla-Glu-Ser;


or





(vi)


(SEQ ID NO: 16)


Thr-DAla-Nle-Glu-DAla-Arg-βAla-Cyc-Orn-DSer-Pro-Ser


[Gal-Sial]-βAla-Nva-DSer-Glu-Thr-Cha-DSer-Val;





of which


Cyc-DAla-Ser[Gal-Sial]-DAla-Arg is particularly


preferred.






These specific peptides are been found by the inventors to be particularly useful for detecting sialidase activity and are described further in the Examples section.


Preferably, Nle, Nva, Orn and/or Cha (when present) are LNle, LNva, LOrn and LCha respectively.


In some embodiments, the peptide is biased for cleavage by one or more specific sialidases by constructing the peptide accordingly so that the amino acids flanking the -Gal Sial group ensure specificity and sensitivity of cleavage. Thus, specific sialidase enzymes may have differing affinities for the peptide. This permits the invention to be utilised in order to detect specific sialidase activity in the test sample. As described herein, the peptides of the invention are particularly useful for detecting bacterial vaginosis. Thus, in preferred embodiments, the one or more specific sialidases are of bacterial origin. In particular, the one or more specific sialidases may be from Prevotella, Bacteroides and/or Mobiluncus species and/or Gardnerella vaginalis.


In a related aspect, the peptides of the invention are incorporated into an indicator molecule for use in detecting the presence in a test sample of cleavage activity of a sialidase enzyme. The indicator molecule is a core component of the enzyme detection devices, enzyme detection kits, enzyme detection compositions of matter and methods for detecting the presence in a test sample of cleavage activity of a sialidase enzyme described further herein. The indicator molecules described herein have been specifically developed by the inventors in the context of detecting sialidase activity for diagnosing BV based on the inventors' earlier disclosure of the general concept of an indicator molecule for use in detecting cleavage activity of an enzyme and binding molecules which specifically bind to the cleaved product (see PCT/GB2014/053171 which is incorporated herein by reference). Thus, the invention provides an indicator molecule for use in detecting the presence in a test sample of cleavage activity of a sialidase enzyme, the indicator molecule comprising:

    • a) a peptide of the invention as described herein; and
    • b) a capture site which remains intact following cleavage of the sialyl group from the indicator molecule by a sialidase enzyme present in the sample.


The capture site is a discrete region of the indicator molecule which mediates binding of the indicator molecule to a capture molecule present within a capture zone (as described in greater detail below). Thus, the capture site is the portion of the indicator molecule responsible for retaining or localising the indicator molecule within the capture zone. Following cleavage of the indicator molecule, the capture site may remain intact or substantially intact, such that the site is still recognised and bound by a capture molecule present within the capture zone of the device. Under these circumstances, both intact indicator molecules and the part of the indicator molecules comprising the capture site following cleavage will be bound to capture molecules within the capture zone. The capture site may comprise any suitable molecule, for example a biotin molecule or an oxime moiety. The capture site may be at the N- or C-terminus of the peptide. Key to effectiveness of the indicator molecule is immobilization via the interaction between capture site and a capture molecule at the capture zone and simultaneous binding by a binding molecule after cleavage has occurred.


Thus, the intact indicator molecule may comprise a capture site moiety linked to a peptide of the invention, which peptide comprises a first sialyl group. Cleavage of the indicator molecule by a sialidase enzyme yields a fragment comprising the capture site moiety and the de-sialylated form of the peptide. The fragment (i.e. the cleaved indicator molecule) differs structurally from the intact indicator molecule in that it lacks the first sialyl group that is present in the intact indicator molecule. This lack of the first sialyl group reveals or exposes on the fragment an epitope (a novel binding site) that is absent, hidden or inaccessible in the intact indicator molecule. The intact indicator molecule may therefore be considered to comprise a cryptic epitope. As discussed below, the binding molecules of the devices, kits, compositions of matter and methods of the invention are specific for this epitope and therefore bind only, or preferentially, to the indicator fragment compared to the intact indicator.


The peptide of the indicator molecule and the capture site may be associated by any means known to one of skill in the art. In a preferred embodiment, the peptide and capture site may be associated via a direct covalent linkage. The peptide and capture site may be immediately adjacent or may be separated by a linker or spacer, for example, a polyethylene glycol (PEG) moiety. In some embodiments, the peptide is linked to a biotin group at its N- or C-terminus via a linker comprising, consisting essentially of or consisting of a polyethylene glycol moiety. One or more additional amino acids may be present at the N- or C-terminus of the peptide to link the linker group (such as PEG) to the peptide. The one or more additional amino acids may comprise Asp in some embodiments. The PEG moiety may further comprise a functional group (e.g. an amine group, optionally an alkylamine group) at one or both ends of the PEG moiety that can react with the terminal residue of the peptide and/or the capture site (e.g. a biotin molecule) during synthesis to link the peptide and the capture site to one another. Thus, in particular embodiments, the indicator molecule comprises, consists essentially of or consists of the following structure:









(i)


Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-PEG-Biotin


(SEQ ID NO: 11-PEG-Biotin)





(ii)


Biotin-PEG-Asp-Glu-DSer-Nva-Cyc-DAla-Ser[Gal-Sial]-



DAla-Arg-Phe-DSer-Val



(Biotin-PEG-Asp-SEQ ID NO: 12)





(iii)


Biotin-PEG-Asp-Arg-DAla-BIP-Ser-Pro-Ser[Gal-Sial]-



DAla-DAsp-Ser



(Biotin-PEG-Asp-SEQ ID NO: 13)





(iv)


Biotin-PEG-Asp-Ser-SEP-DAla-Ile-Orn-Ser[Gal-Sial]-



DAla-Nle-Glu



(Biotin-PEG-Asp-SEQ ID NO: 14)





(v)


Biotin-PEG-Asp-DAla-Arg-Nva-DSer-βAla-DAla-Nle-Ser


[Gal-Sial]-BIP-Orn-DAla-Glu-Ser


(Biotin-PEG-Asp-SEQ ID NO: 15);


or





(vi)


Biotin-PEG-Asp-Thr-DAla-Nle-Glu-DAla-Arg-βAla-Cyc-


Orn-DSer-Pro-Ser[Gal-Sial]-βAla-Nva-DSer-Glu-Thr-


Cha-DSer-Val (Biotin-PEG-Asp-SEQ ID NO: 16);





of which


Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-PEG-Biotin


(SEQ ID NO: 11-PEG-Biotin) is particularly


preferred.






Within the context of the present invention the indicator molecules (via the capture site) may bind to the capture molecules in a capture zone (as described in greater detail below) with relatively high affinity. In some embodiments, the dissociation constant (kd) for the indicator molecule will be relatively low and preferably between OM and 1×10−7M (depending on the sensitivity required of the assay). In certain embodiments of the invention, the dissociation constant for the indicator molecule will be between 1×10−15M and 1×10−9M.


In certain embodiments of the invention, such a binding interaction may be achieved as a result of direct binding of the capture site of the indicator molecule to the capture molecule present in the capture zone. In this context, direct binding means binding of the indicator molecule (via the capture site) to the capture molecule without any intermediary.


In preferred embodiments of the invention, the capture site of the indicator molecule and the capture molecule present in the capture zone are two halves of a binding pair. In this context, a binding pair consists of two molecules or entities capable of binding to each other. In certain embodiments of the invention, the binding interaction is specific such that each member of the binding pair is only able to bind its respective partner, or a limited number of binding partners. Moreover, as detailed above, it is preferable for the binding pair to exhibit relatively high affinity. The binding pair may be a binding pair found in nature or an artificially generated pair of interacting molecules or entities.


In some embodiments of the invention, the capture site of the indicator molecule and the capture molecule are two halves of a binding pair wherein the binding pair is selected from the following: —an antigen and an antibody or antigen binding fragment thereof; biotin and avidin, streptavidin, neutravidin or captavidin; an immunoglobulin (or appropriate domain thereof) and protein A or G; a carbohydrate and a lectin; complementary nucleotide sequences; a ligand and a receptor molecule; a hormone and hormone binding protein; an enzyme cofactor and an enzyme; an enzyme inhibitor and an enzyme; a cellulose binding domain and cellulose fibres; immobilised aminophenyl boronic acid and cis-diol bearing molecules; and xyloglucan and cellulose fibres and analogues, derivatives and fragments thereof.


In particular embodiments of the invention, the binding pair consists of biotin and streptavidin. In a further embodiment of the invention, the capture site of the indicator molecule comprises an epitope and the capture molecule comprises an antibody, which specifically binds to the epitope present at the first capture site. In the context of the present invention, the term antibody covers native immunoglobulins from any species, chimeric antibodies, humanised antibodies, F(ab′)2 fragments, Fab fragments, Fv fragments, sFv fragments and highly related molecules such as those based upon antibody domains which retain specific binding affinity (for example, single domain antibodies). The antibodies may be monoclonal or polyclonal. Thus, in specific embodiments, the capture molecule comprises an antibody. In other embodiments, the capture site comprises a biotin molecule and the capture zone comprises a streptavidin molecule.


Another core component of the enzyme detection devices, enzyme detection kits, enzyme detection compositions of matter and methods for detecting the presence in a test sample of cleavage activity of a sialidase enzyme described further herein is the binding molecule. The binding molecule is designed to specifically bind to the de-sialylated derivative of the indicator molecule formed following cleavage of the sialyl group from the indicator molecule by sialidase activity present in the sample. Formation of the de-sialylated derivative reveals a novel binding site to which the binding molecule can specifically bind. Thus, in preferred embodiments, the binding molecule cannot bind to the indicator molecule (at any appreciable or detectable level) unless and until cleavage of the sialyl group from the indicator molecule has occurred. In alternative embodiments, the binding molecule preferentially binds to the de-sialylated derivative over the sialylated peptide or indicator molecule. Thus, the binding molecule has a higher affinity for the de-sialylated derivative when compared with the sialylated form.


Alternatively viewed, in preferred embodiments, the binding molecule is capable of specifically binding to the de-sialylated indicator molecule (fragment) and is incapable of binding to the intact (sialylated) indicator molecule (at any appreciable or detectable level).


The skilled person is well able to determine whether or not a particular binding molecule binds to the de-sialylated derivative in preference over the sialylated form. This can, for instance, be expressed in terms of the relative dissociation constants. For example, in particular embodiments, the dissociation constant for the binding interaction between the binding molecule and the de-sialylated derivative may be 2-, 3-, 4-, 5-, 10-, 20-, 30-, 40-, 50-, 100-, 200-, 500-, 1000-fold (or more) lower than the dissociation constant for the binding interaction between the binding molecule and the sialylated form.


In specific embodiments, the binding molecule comprises an antibody. For the avoidance of doubt, the term antibody covers native immunoglobulins from any species, chimeric antibodies, humanised antibodies, F(ab′)2 fragments, Fab fragments, Fv fragments, sFv fragments and highly related molecules such as those based upon antibody domains which retain specific binding affinity (for example, single domain antibodies). The antibodies may be monoclonal or polyclonal. The inventors have produced antibodies which only recognise the de-sialylated derivative of the indicator molecule and will therefore not bind to the indicator molecule (to any significant degree) unless and until cleavage of the sialyl group has occurred. Antibodies may be produced according to techniques known in the art. This may rely upon immunisation of an animal, such as a sheep, rabbit or goat, with the de-sialylated derivatives of the indicator molecules. Alternatively, the animal may be immunised with the de-sialylated peptides (i.e. without the capture site being attached). Polyclonal antibodies may be isolated from serum and affinity purified. Monoclonal antibodies may be produced using well-known and characterised hybridoma technology.


Thus, in a related aspect, the invention also provides an antibody capable of specifically binding to the de-sialylated derivative of a peptide of the invention as defined herein or an indicator molecule of the invention as defined herein. As the skilled person will appreciate based on the disclosure herein, the antibody may binds preferentially to the de-sialylated derivative over the sialylated peptide or indicator molecule. Thus, the antibody has a higher affinity for the de-sialylated derivative when compared with the sialylated form. The skilled person is well able to determine whether or not a particular antibody binds to the de-sialylated derivative in preference over the sialylated form. This can, for instance, be expressed in terms of the relative dissociation constants. For example, in particular embodiments, the dissociation constant for the binding interaction between the antibody and the de-sialylated derivative may be 2-, 3-, 4-, 5-, 10-, 20-, 30-, 40-, 50-, 100-, 200-, 500-, 1000-fold (or more) lower than the dissociation constant for the binding interaction between the antibody and the sialylated form. In particular embodiments, the antibody is incapable of binding to the sialylated peptide or indicator molecule. That is to say, it can only bind to the de-sialylated derivative after cleavage of the sialyl group has occurred.


Therefore, in a preferred embodiment, the antibody can specifically bind to the epitope: Cyc-DAla-Ser[Gal]-DAla-Arg-PEG-Biotin (de-sialylated form of SEQ ID NO: 11-PEG-Biotin); particularly to an epitope present in this molecule, more particularly an epitope present in the Gal peptide moiety of this molecule, Cyc-DAla-Ser[Gal]-DAla-Arg (de-sialylated form of SEQ ID NO: 11). Preferably, the antibody cannot bind (at any appreciable or detectable level) to the sialylated form of this molecule (Cyc-DAla-Ser[Gal-Sial]-DAla-Arg, i.e. SEQ ID NO: 11).


In another embodiment, an antibody is provided that can specifically bind to the epitope: Biotin-PEG-Asp-Glu-DSer-Nva-Cyc-DAla-Ser[Gal]-DAla-Arg-Phe-DSer-Val (de-sialylated form of Biotin-PEG-Asp-SEQ ID NO: 12); particularly to an epitope present in this molecule, more particularly an epitope present in the Gal peptide moiety of this molecule. Preferably, the antibody cannot bind (at any appreciable or detectable level) to the sialylated form of this molecule.


In a further embodiment, an antibody is provided that can specifically bind to the epitope: Biotin-PEG-Asp-Arg-DAla-BIP-Ser-Pro-Ser[Gal]-DAla-DAsp-Ser (de-sialylated form of Biotin-PEG-Asp-SEQ ID NO:13); particularly to an epitope present in this molecule, more particularly an epitope present in the Gal peptide moiety of this molecule. Preferably, the antibody cannot bind (at any appreciable or detectable level) to the sialylated form of this molecule.


In a further embodiment, an antibody is provided that can specifically bind to the epitope: Biotin-PEG-Asp-Ser-SEP-DAla-Ile-Orn-Ser[Gal]-DAla-Nle-Glu (de-sialylated form of Biotin-PEG-Asp-SEQ ID NO: 14); particularly to an epitope present in this molecule, more particularly an epitope present in the Gal peptide moiety of this molecule. Preferably, the antibody cannot bind (at any appreciable or detectable level) to the sialylated form of this molecule.


In a further embodiment, an antibody is provided that can specifically bind to the epitope: Biotin-PEG-Asp-DAla-Arg-Nva-DSer-βAla-DAla-Nle-Ser[Gal]-BIP-Orn-DAla-Glu-Ser (de-sialylated form of Biotin-PEG-Asp-SEQ ID NO: 15); particularly to an epitope present in this molecule, more particularly an epitope present in the Gal peptide moiety of this molecule. Preferably, the antibody cannot bind (at any appreciable or detectable level) to the sialylated form of this molecule.


In a further embodiment, an antibody is provided that can specifically bind to the epitope: Biotin-PEG-Asp-Thr-DAla-Nle-Glu-DAla-Arg-βAla-Cyc-Orn-DSer-Pro-Ser[Gal]-βAla-Nva-DSer-Glu-Thr-Cha-DSer-Val (de-sialylated form of Biotin-PEG-Asp-SEQ ID NO: 16); particularly to an epitope present in this molecule, more particularly an epitope present in the Gal peptide moiety of this molecule. Preferably, the antibody cannot bind (at any appreciable or detectable level) to the sialylated form of this molecule.


In a further embodiment, an antibody is provided that has a heavy chain with 3 CDRs and a light chain with 3 CDRs, wherein the heavy chain CDR1 has SEQ ID NO: 1; the heavy chain CDR2 has SEQ ID NO: 2; the heavy chain CDR3 has SEQ ID NO: 3; the light chain CDR1 has SEQ ID NO: 4; the light chain CDR2 has SEQ ID NO: 5; and/or the light chain CDR3 has SEQ ID NO: 6.


The antibody may have a heavy chain that has SEQ ID NO: 7 and/or a light chain that has SEQ ID NO: 8.


Preferably, the antibody can specifically bind to an epitope present in the molecule Cyc-DAla-Ser[Gal]-DAla-Arg. Preferably, the antibody does not (at any appreciable or detectable level) bind to the molecule Cyc-DAla-Ser[Gal-Sial]-DAla-Arg.


For the (de-sialidated) molecule Cyc-DAla-Ser[Gal]-DAla-Arg-PEG-Oxime (de-sialylated form of SEQ ID NO: 11-PEG-Oxime) the antibody may have a KD of less than 100 nM, preferably less than 80, 60, 50, 40, 30, 20 or 10 nM, for example about 7.9 nM. For this molecule it may have a Kon of about 54080M−1s−1; and a Koff of about 0.000427 s−1.


The binding molecule may be directly or indirectly conjugated to (i.e. labelled with) a reporter molecule to permit detection of binding of the binding molecule to the indicator molecule. The reporter molecule may be any substance or moiety suitable for detection by any means available to those skilled in the art. Thus, the reporter molecule is typically capable of signal generation or production. In certain embodiments of the invention, the reporter molecule is selected from the following: —a gold particle; a chromogen; a luminescent compound; a fluorescent molecule; a radioactive compound; a visible compound; a liposome or other vesicle containing signal producing substances; an electroactive species; or a combination of enzyme and its substrate. A suitable enzyme-substrate combination for use as a reporter moiety may be the enzyme alkaline phosphatase and the substrate nitro blue tetrazolium-5-bromo-4-chloro-3-indolyl phosphate. In a particular embodiment of the invention, the reporter molecule is a gold particle.


Indirect labelling of the binding molecule with a reporter molecule is also envisaged within the present invention. Thus, the reporter molecule may be attached to a further binding molecule which in turn binds to the binding molecule to provide the label. This indirect binding may be mediated by an adaptor capable of simultaneously binding the binding molecule and the reporter molecule. As an illustrative embodiment, where the binding molecule is an antibody, indirect labelling could be mediated by a further antibody that binds to the antibody binding molecule in specific fashion. The further antibody may be directly labelled with a reporter molecule such as a gold particle; a chromogen; a luminescent compound; a fluorescent molecule; a radioactive compound; a visible compound; a liposome or other vesicle containing signal producing substances; an electroactive species; or a combination of enzyme and its substrate. A suitable enzyme-substrate combination for use as a reporter moiety may be the enzyme alkaline phosphatase and the substrate nitro blue tetrazolium-5-bromo-4-chloro-3-indolyl phosphate. In a particular embodiment of the invention, the reporter moiety is a gold particle.


In embodiments where the reporter is a gold particle, the gold particle-binding molecule conjugate should be used an optical density of at least 4, preferably at least 5, 6 or 7, most preferably at least or about 8, 9 or 10.


In embodiments of the invention wherein the reporter molecule binds to the binding molecule by virtue of an adaptor molecule, the adaptor may be pre-complexed with the binding molecule prior to the addition of the test sample to the indicator molecule, provided that the adaptor does not prevent binding of the binding molecule to the cleaved indicator molecule.


The adaptor may be any material or molecule capable of mediating the indirect interaction of the binding molecule with the reporter molecule. In some embodiments, the adaptor is streptavidin and the binding molecule comprises a biotin molecule. The adaptor may also be an “adaptor binding pair” wherein said binding pair comprises:


(i) a first member capable of binding to the binding molecule; and


(ii) a second member capable of binding to the first member of the pair and to the reporter molecule. In certain embodiments of the invention, the detection region of the indicator molecule comprises biotin, the first member of the adaptor binding pair is avidin or streptavidin, the second member of the adaptor binding pair is biotin, and the reporter molecule comprises a moiety capable of binding biotin.


In view of the foregoing, in a complementary aspect, the de-sialylated derivatives of the peptides of the invention also form part of the invention and are used in the generation of the binding molecules, in particular antibodies. Thus, the invention provides a peptide for use in generating an antibody as defined herein wherein the peptide is a de-sialylated derivative of a peptide according to the invention and the antibody is capable of specifically binding to the de-sialylated derivative of a peptide of the invention. Thus, in particular embodiments, the peptide is:









(i)


Cyc-DAla-Ser[Gal]-DAla-Ar (de-sialylated form of


SEQ ID NO: 11)





(ii)


Asp-Glu-DSer-Nva-Cyc-DAla-Ser[Gal]-DAla-Arg-Phe-DSer-


Val


(de-sialylated form of SEQ ID NO: 12)





(iii)


Asp-Arg-DAla-BIP-Ser-Pro-Ser[Gal]-DAla-DAsp-Ser


(de-sialylated form of SEQ ID NO: 13)





(iv)


Asp-Ser-SEP-DAla-Ile-Orn-Ser[Gal]-DAla-Nle-Glu


(de-sialylated form of SEQ ID NO: 14)





(v)


Asp-DAla-Arg-Nva-DSer-βAla-DAla-Nle-Ser[Gal]-BIP-


Orn-DAla-Glu-Ser


(de-sialylated form of SEQ ID NO: 15);


or





(vi)


Asp-Thr-DAla-Nle-Glu-DAla-Arg-βAla-Cyc-Orn-DSer-


Pro-Ser[Gal]-βAla-Nva-DSer-Glu-Thr-Cha-DSer-Val


(de-sialylated form of SEQ ID NO: 16).






A peptide comprising, consisting essentially of, or consisting of the sequence Cyc-DAla-Ser[Gal]-DAla-Arg is particularly preferred.


In particular embodiments, the peptide may be conjugated to a carrier protein in order to improve immunogenicity and thus antibody production in the host organism. For instance, the peptide may be conjugated to keyhole limpet hemocyanin. The carrier protein may be at the N- or C-terminus of the peptide.


In view of the foregoing, the invention further provides enzyme detection devices, enzyme detection kits, enzyme detection compositions of matter and methods for detecting the presence in a test sample of cleavage activity of a sialidase enzyme incorporating an indicator molecule, capture molecules and binding molecules as defined above. The use of binding molecules, such as antibodies, that bind only to the de-sialylated derivative of the indicator molecule but not to the uncleaved indicator molecule, enable detection of sialidase activity at low concentrations in test samples.


Thus, in a further aspect, the invention provides an enzyme detection device, enzyme detection kit or enzyme detection composition of matter for detecting the presence in a test sample of cleavage activity of a sialidase enzyme, the device comprising:


(i) an indicator molecule as defined herein;


(ii) a capture zone to receive the test sample, wherein the capture zone comprises capture molecules as defined herein capable of binding to the capture site of the indicator molecule, irrespective of whether or not the indicator molecule has been cleaved, in order to immobilise the indicator molecule; and


(iii) binding molecules as defined herein capable of binding to the de-sialylated derivative of the indicator molecule, wherein the binding molecules are incapable of binding to the indicator molecule unless and until cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample has occurred.


The invention further provides a method for detecting the presence or absence in a test sample of cleavage activity of a sialidase enzyme, the method comprising:


(i) bringing an indicator molecule as defined herein into contact with the test sample;


(ii) adding to the test sample binding molecules as defined herein capable of binding to the de-sialylated derivative of the indicator molecule, wherein the binding molecules are incapable of binding to the indicator molecule unless and until cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample has occurred;


(iii) capturing the de-sialylated derivative of the indicator molecule at a capture zone through binding of capture molecules in the capture zone to the capture site, said capture molecules being able to bind to the capture site irrespective of whether or not the indicator molecule has been cleaved; and


(iv) detecting cleavage of the sialyl group from the indicator molecule by determining binding of the binding molecules to the de-sialylated derivative of the indicator molecule captured in the capture zone.


The devices, kits, compositions of matter and methods of the invention have been shown by the inventors to have specific application in the field of diagnosis of BV. Thus, the invention further provides a method for diagnosing bacterial vaginosis in a test sample by detecting cleavage activity of a sialidase enzyme in the sample, the method comprising:


(i) bringing an indicator molecule as defined herein into contact with the test sample;


(ii) adding to the test sample binding molecules as defined herein capable of binding to the de-sialylated derivative of the indicator molecule, wherein the binding molecules are incapable of binding to the indicator molecule unless and until cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample has occurred;


(iii) capturing the de-sialylated derivative of the indicator molecule at a capture zone through binding of capture molecules as defined herein in the capture zone to the capture site, said capture molecules being able to bind to the capture site irrespective of whether or not the indicator molecule has been cleaved; and


(iv) detecting cleavage of the sialyl group from the indicator molecule by determining binding of the binding molecules to the de-sialylated derivative of the indicator molecule captured in the capture zone wherein an increased level of cleavage compared to a control diagnoses bacterial vaginosis.


In particular embodiments, the indicator molecule may be (pre-)immobilised in the capture zone via the capture molecules (i.e. prior to contact with the test sample). Thus, the invention also provides a method for detecting the presence or absence in a test sample of cleavage activity of a sialidase enzyme, the method comprising:


(i) adding the test sample to a capture zone comprising capture molecules, said capture molecules as defined herein being bound to the capture site of an indicator molecule as defined herein wherein said capture molecules remain bound to the capture site irrespective of whether or not cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample occurs;


(ii) adding binding molecules as defined herein capable of binding to the de-sialylated derivative of the indicator molecule, wherein the binding molecules are incapable of binding to the indicator molecule unless and until cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample has occurred;


(iii) detecting cleavage of the sialyl group from the indicator molecule by determining binding of the binding molecules to the de-sialylated derivative of the indicator molecule captured in the capture zone.


Similarly, the invention also provides a method for diagnosing bacterial vaginosis in a test sample by detecting cleavage activity of a sialidase enzyme in the sample, the method comprising:


(i) adding the test sample to a capture zone comprising capture molecules as defined herein, said capture molecules being bound to the capture site of an indicator molecule as defined herein wherein said capture molecules remain bound to the capture site irrespective of whether or not cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample occurs;


(ii) adding binding molecules as defined herein capable of binding to the de-sialylated derivative of the indicator molecule, wherein the binding molecules are incapable of binding to the indicator molecule unless and until cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample has occurred;


(iii) detecting cleavage of the sialyl group from the indicator molecule by determining binding of the binding molecules to the de-sialylated derivative of the indicator molecule captured in the capture zone wherein an increased level of cleavage compared to a control diagnoses bacterial vaginosis.


Consequently, for those embodiments in which the indicator molecule is (pre-)immobilised in the capture zone via the capture molecules (i.e. prior to contact with the test sample), prior to step (i) of the method, the indicator molecule may be added to the capture zone such that the indicator molecule is bound in the capture zone via the capture molecules. Addition of the binding molecules may occur simultaneously with or after the test sample has been added to the capture zone. Thus, steps (i) and (ii) of the method may occur sequentially or simultaneously.


In the context of the methods provided herein, the step of “adding” binding molecules to the test sample should be understood to encompass any step that brings the binding molecules into contact with the test sample. Thus, this step may encompass a step of applying the test sample to a device comprising the binding molecules. The binding molecules may be in solution, or may be on a carrier. For example, the binding molecules may be dried onto or otherwise impregnated into or onto a solid support, which may be the “conjugate pad” discussed elsewhere herein. In preferred embodiments the test sample is brought into contact with a solid support onto which the binding molecules have been dried. Liquid comprised in the test sample and/or added to the carrier allows the binding molecules to resolvate.


In embodiments where the binding molecules are dried onto or otherwise impregnated into or onto a solid support, the solid support preferably comprises or consists of fibreglass, polyester fibres, or a material having similar properties. The solid support should preferably have one or more of the following properties: basis weight around 75 g/m2; caliper about 0.38-0.43 mm; wicking rate about 3-5 (s/2 cm); and/or water absorption about 63-79 mg/cm2. Thus, the conjugate pad may have these properties. Similarly, the sample pad may have these properties.


Whilst in preferred embodiments the binding molecules are incapable of binding to the indicator molecule unless and until cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample has occurred, in some embodiments, the binding molecules preferentially bind to the de-sialylated derivative of the indicator molecule over the sialylated form as described elsewhere herein. Thus, some degree of binding to the sialylated indicator molecule may occur (this may be considered background signal in some cases). However, because the binding molecules will preferentially bind to the de-sialylated derivative a much greater signal is generated in samples comprising the de-sialylated derivative relative to samples in which the sialylated indicator molecule has not been cleaved or no indicator molecule is present.


In order to take into account background levels of sialidase activity (if present), the methods typically involve comparing measured levels of cleavage in the test sample to a control. Typically, the control represents corresponding levels of sialidase activity in a healthy subject. By “healthy subject” is meant a subject not suffering from BV. The control may be in a corresponding test sample taken from a matched healthy control. Alternatively, the control may be a threshold level of sialidase activity set by determining sialidase activity in a range of healthy and diseased patients. Suitable methods for setting a threshold are well known to those skilled in the art. The threshold may be mathematically derived from a training set of patient data. The score threshold thus separates the test samples according to presence or absence of BV. The interpretation of this quantity, i.e. the cut-off threshold may be derived in a development or training phase from a set of patients with known outcome. The threshold may therefore be fixed prior to performance of the claimed methods from training data by methods known to those skilled in the art.


For example, a cube reader may be used, for example the Optricon reader from OpTricon GmbH (Chembio Diagnostic systems) of Schwarzschildstrasse 1, D-12489 Berlin, Germany), as demonstrated in the Examples. By way of example, in the assays used in the examples a cube reading of less than 10 correlates with the absence of a visual signal and is considered to be a negative result and therefore indicative of the absence of bacterial vaginosis; and a cube reading of at least 30 units correlates with a strong visual signal and is considered to be a positive result and therefore indicative of the presence of bacterial vaginosis.


A cube reading of 10-20 units correlates with a faint visual signal and is considered to be a result that may be indicative of the absence of established bacterial vaginosis, but may be indicative of a low level of infection, for example the early-stage of bacterial vaginosis.


In particular embodiments, the sialidase enzyme to be detected originates from Prevotella, Bacteroides and/or Mobiluncus species and/or Gardnerella vaginalis.


The enzyme detection devices and compositions of matter of the invention may be supplied in a format ready for immediate use. Alternatively, the essential components may be provided as a kit of parts, optionally together with suitable reagents and/or instructions for assembly of the enzyme detection device. Accordingly, in another aspect, the invention provides an enzyme detection kit for detecting the presence in a test sample of cleavage activity of a sialidase enzyme, the kit comprising:


(i) an indicator molecule as defined herein for adding to the test sample;


(ii) capture molecules as defined herein capable of binding to the capture site of the indicator molecule, irrespective of whether or not the indicator molecule has been cleaved;


(iii) a solid support to which the capture molecules can be attached to form a capture zone to receive the test sample; and


(iv) binding molecules as defined herein capable of binding to the de-sialylated derivative of the indicator molecule, wherein the binding molecules are incapable of binding to the indicator molecule unless and until cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample has occurred.


In related aspects, the invention also provides for use of an enzyme detection device or composition of matter as described and defined herein for diagnosing BV in a test sample. Similarly, the invention also provides for use of a method as described and defined herein for diagnosing BV in a test sample. The invention further provides for use of an enzyme detection kit as described and defined herein for diagnosing BV in a test sample.


The invention may be performed in lateral flow or vertical flow devices in certain embodiments. Generally, therefore, the invention relies upon some form of solid support. The solid support may define a liquid flow path for the sample. In specific embodiments, the solid support comprises a chromatographic medium or a capillary flow device. The invention may be provided in a test strip format in some embodiments.


In specific embodiments of the invention, the capture zone is formed on a solid support. Any support to which the capture molecules may be attached to form a capture zone is intended to be encompassed. The solid support may take the form of a bead (e.g. a sepharose or agarose bead) or a well (e.g. in a microplate) for example. Thus, in certain embodiments the device comprises a solid support to which the capture molecules are attached to form the capture zone. In the case of the kits of the invention, the solid support may be provided without the capture molecules attached. In those embodiments, the user of the kit may immobilize the capture molecules on the solid support to form the capture zone prior to use of the device with a test sample. The kit may, therefore, also comprise means for immobilizing the capture molecules on the solid support. The immobilizing means may comprise any suitable reagents to permit the capture zone to be formed. The solid support may be pre-formed with suitable immobilizing means. For example, the solid support may comprise biotin molecules arranged to interact with avidin (e.g. streptavidin) molecules that form (part of) the capture molecules. Of course, other binding pair interactions may be used to immobilize the capture molecules on the solid support to form a capture zone, as discussed herein and as would be readily understood by one skilled in the art.


The capture zone may be defined by the immobilization therein or thereon of capture molecules capable of binding to the capture site of indicator molecules. Immobilization of capture molecules may be achieved by any suitable means. Wherein the device is a flow device comprising a chromatographic medium, the capture molecules may be immobilized by directly binding to the medium or immobilized indirectly via binding to a carrier molecule, such as a protein, associated with, or bound to, the medium.


In further embodiments, the solid support further comprises a sample application zone to which the sample is applied. The sample application zone may be pre-loaded with the indicator molecule, such that when the test sample is applied any enzyme in the sample acts upon the cleavage site of the indicator molecule within the sample application zone. The sample application zone may contain a barrier, which holds the sample in the sample application zone for a pre-determined period of time. This permits the sample to interact with the indicator molecule for a sufficient period to achieve measurable levels of cleavage. This may be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 60 minutes or more depending upon the sialidase enzyme to be detected, as would be readily understood by one skilled in the art. About 5-15 minutes, 5-10 minutes or about 5 minutes is preferred. The barrier may be degraded by the sample, or otherwise removed, after this period of time thus allowing the sample to continue to flow through the device. Alternatively, the test sample and indicator molecule may be pre-mixed or pre-incubated prior to adding the mixture to the device, such as to the sample application zone. However, where the test sample and indicator molecule may be pre-mixed or pre-incubated it is possible to omit the sample application zone. Here, it may be possible to add the mixture directly to the capture zone to permit immobilization of the indicator molecules through interaction with the capture molecules. In some embodiments, the test sample may be applied to the chromatographic medium at a site upstream from the capture zone such that it is drawn, for example by capillary action, through the capture zone. The chromatographic medium may be made from any material through which a fluid is capable of passing, such as a fluidic channel or porous membrane. In certain embodiments of the invention, the chromatographic medium comprises a strip or membrane, for example a nitrocellulose strip or membrane.


The indicator molecule may be present on a carrier, which should be an inert material and preferably porous. It may be a suitable polymer, such as Polytetrafluoroethylene. For example, the carrier may be an inert porous membrane disc. The indicator molecule may, for example, have been freeze-dried onto the carrier. In preferred embodiments, the test sample and indicator molecule may be pre-mixed or pre-incubated prior to adding the mixture to the device. This may involve contacting the sample with a carrier comprising the indicator molecule, preferably in freeze-dried form. This may, for example, be done in a container such as a tube. Preferably, the sample and indicator molecule are incubated for at least 3, 4 or 5 minutes and no more than 30 minutes, preferably for about 5-15 minutes, 5-10 minutes or about 5 minutes, for example 3-7 or 4-6 minutes.


The skilled person will be able to determine suitable amounts and concentrations of the various components, but by way of example for a single assay or in a single kit the indicator molecule is preferably present in an amount of at least 30, 40, 50, 60, 70, 80, 90 or 100 ng, more preferably at least or about 110, 120, 130, 140, 150, 160, 170, 180 or 190 ng.


The binding molecules must be provided in the device in a manner that permits interaction with the indicator molecule, if the sialyl group is cleaved from the indicator molecule by sialidase enzyme present in the sample. The binding molecules may, therefore, be pre-mixed with the indicator molecules prior to application to the device. This may be before or after the indicator molecules have been mixed with the test sample. It is preferably after to avoid any effect the binding molecules may have on enzyme activity (in the test sample) at the cleavage site of the indicator molecule. The binding molecules can preferably be provided on or in the device at any point upstream of the capture zone, such that the binding molecules encounter the test sample and indicator molecules before the indicator molecules are immobilised (via interaction between the capture site of the indicator molecule and capture molecules defining the capture zone). Alternatively, the binding molecule may be added to the capture zone after the test sample and indicator molecules have been added to the capture zone. This ensures that any indicator molecule will already be immobilized at the capture zone, providing (in the case of cleaved (i.e. de-sialylated) indicator molecule) a binding site for the binding molecules to produce a signal.


The solid support may further comprise a control zone, downstream of the capture zone in relation to sample flow, and the sample application zone if present, containing further binding molecules, referred to herein as “control detection binders” which bind to the binding molecules to indicate successful completion of an assay using the device. Alternatively, the further binding molecules (control detection binders) may bind to a further molecule, referred to herein as “control detection molecules” added to the sample or to the device and which flows with the sample through the device. The further molecule (control detection molecule) may be labelled, either directly or indirectly, with a reporter molecule as defined herein. Preferably, the reporter molecule is the same reporter molecule as attached to the binding molecules, for ease of detection, although it may be different.


The control zone is spatially separated from the capture zone, for example to produce two separate test lines if the reporter is bound or immobilized in each respective zone. This control zone is used to confirm that the test sample, including the binding molecules, has passed through the entire device and confirms that the device is operating correctly. A positive signal is expected at the control zone independent of whether sialidase activity is present in the sample or not. The further binding molecules are selected based upon the nature of the binding molecules which bind to the cleavage site of the indicator molecules or on the nature of the further molecule added to the sample. The binding molecules and further binding molecules or further molecules and further binding molecules may form a binding pair as defined herein. For example, if the binding molecule is a species specific antibody (e.g. a sheep antibody), the further binding molecule may be an anti-species antibody (e.g. an anti-sheep antibody). For example, the control detection molecule may be a chicken IgY antibody and the control detection binder may be an anti-chicken IgY antibody, or vice versa. Alternatively, if the further molecule is an antibody from a different species, e.g. a chicken or a goat, the further binding molecule may be an appropriate anti-species antibody. This permits immobilization of the binding molecule or further molecule at the control zone by virtue of a specific interaction. The further binding molecules may be immobilized in the control zone by any suitable means, for example by a covalent or non-covalent interaction.


According to all aspects of the invention, the test sample may be a vaginal sample, optionally a vaginal swab. The test sample may be collected by any suitable means and presented in any form suitable for use with the present invention. Typically, the sample is collected using a sterile swab. Moreover, as part of obtaining the test sample from its original source, the sample may undergo one or more processing or pre-treatment steps prior to testing using the invention. In one embodiment, a sample may be processed so as to produce a solution or suspension for testing. Moreover, in certain embodiments, the test sample may be stored, for example frozen at around −20° C., as a means of preserving the sample for any given length of time prior to testing using the invention.


It should be noted that the invention is typically performed in vitro based upon isolated samples. The methods of the invention may include steps of obtaining a sample for testing in some embodiments, e.g. using a sterile swab.


In view of the above, the invention may be further defined by the following numbered clauses:


1. A peptide comprising the following sequence:

    • X1-X2-X3[Gal-Sial]-X4-X5

      wherein:
    • (i) Sial is a sialyl group;
    • (ii) X3 is a natural or non-natural amino acid comprising a glycosyl acceptor group; and
    • (iii) X1, X2, X4 and X5 are independently selected from any amino acid provided that at least one of X1, X2, X4 and X5 is a D-amino acid and/or a non-standard amino acid or a non-natural amino acid.


      2. The peptide of clause 1 wherein X3 is selected from Ser, Thr, Tyr, Hyl, Hyp, Asn, Arg or phosphoserine (SEP).


      3. The peptide of clause 2 wherein X3 is Ser.


      4. The peptide of any one of clauses 1-3 wherein at least two, three or all four of X1, X2, X4 and X5 are a D-amino acid and/or a non-standard amino acid or a non-natural amino acid.


      5. The peptide of any one of clauses 1-4 wherein X1, X2, X4 and X5 comprise at least two, three or four different amino acids.


      6. The peptide according to any one of clauses 1-5 wherein at least one of X1, X2, X4 and X5 is a hydrophobic amino acid.


      7. The peptide of any one of clauses 1-6 wherein at least one of X1, X2, X4 and X5 is Ala.


      8. The peptide of any one of clauses 1-7 wherein X1 and X2 are both Ala.


      9. The peptide of clause 7 or 8 wherein Ala is DAla or βAla.


      10. The peptide of any one of clauses 1-9 wherein at least one of X1, X2, X4 and X5 is a charged amino acid.


      11. The peptide of clause 10 wherein each charged amino acid is selected from Arg, DAsp and LOrn.


      12. The peptide of any one of clauses 1-11 wherein at least one of X1, X2, X4 and X5 is a polar amino acid.


      13. The peptide of clause 12 wherein each polar amino acid is selected from LSer, DSer and Thr.


      14. A peptide comprising the following sequence:
    • X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12[Gal-Sial]-X13-X14-X15-X16-X17-X18-X19-X20

      wherein: Sial is a sialyl group; X1 is absent or Thr; X2 is absent or DAla; X3 is absent or Nle X4 is absent or Glu; X5 is absent or DAla; X6 is absent or Arg; X7 is absent or selected from Glu, Arg, Ser, Nva, βAla; X8 is absent or selected from DSer, DAla, SEP, Cyc;


      X9 is absent or selected from Nva, BIP, DAla, βAla, Orn;


      X10 is selected from Cyc, Ser, Ile, DAla, DSer; X11 is selected from DAla, Pro, Orn, Nle;


      X12 is selected from Ser, Thr, Tyr, Hyl, Hyp, Asn, Arg or SEP;


      X13 is selected from DAla, BIP, βAla; X14 is selected from Arg, DAsp, Nle, Orn, Nva;


      X15 is absent or selected from Phe, BIP, Ser, Glu, DAla, DSer;


      X16 is absent or selected from DSer, Glu;


      X17 is absent or selected from Val, Ser, Thr; X18 is absent or Cha;


      X19 is absent or DSer; X20 is absent or Val.


      15. The peptide of clause 14 wherein X12 is Ser.


      16. The peptide of any one of clauses 1-15 wherein the peptide comprises the following sequence:
    • (i) Cyc-DAla-Ser[Gal-Sial]-DAla-Arg
    • (ii) Glu-DSer-Nva-Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-Phe-DSer-Val
    • (iii) Arg-DAla-BIP-Ser-Pro-Ser[Gal-Sial]DAla-DAsp-Ser
    • (iv) Ser-SEP-DAla-Ile-Orn-Ser[Gal-Sial]DAla-Nle-Glu
    • (v) DAla-Arg-Nva-DSer-βAla-DAla-Nle-Ser[Gal-Sial]-BIP-Orn-DAla-Glu-Ser; or
    • (vi) Thr-DAla-Nle-Glu-DAla-Arg-βAla-Cyc-Orn-DSer-Pro-Ser[Gal-Sial]-βAla-Nva-DSer-Glu-Thr-Cha-DSer-Val


      17. The peptide of any one of clauses 15 or 16 wherein Nle, Nva, Orn and/or Cha are LNle, LNva, LOrn and LCha respectively.


      18. The peptide of any one of clauses 1-17 wherein the peptide is biased for cleavage by one or more specific sialidases.


      19. The peptide according to clause 18 wherein the one or more specific sialidases are of bacterial origin.


      20. The peptide according to clause 19 wherein the bacteria are Prevotella, Bacteroides and/or Mobiluncus species and/or Gardnerella vaginalis.

      21. An indicator molecule for use in detecting the presence in a test sample of cleavage activity of a sialidase enzyme, the indicator molecule comprising:
    • a) a peptide as defined in any one of clauses 1-20; and
    • b) a capture site which remains intact following cleavage of the sialyl group from the indicator molecule by a sialidase enzyme present in the sample.


      22. The indicator molecule of clause 21 wherein the capture site comprises a biotin molecule or an oxime moiety.


      23. The indicator molecule of clause 21 or 22 wherein the capture site is at the N- or C-terminus of the peptide.


      24. The indicator molecule of any one of clauses 21-23 wherein the capture site is attached to the peptide by a linker.


      25. The indicator molecule according to clause 24 wherein the linker comprises a polyethylene glycol (PEG) moiety.


      26. The indicator molecule of clause 25 wherein the peptide is linked to a biotin group at its N- or C-terminus via a linker comprising, consisting essentially of or consisting of a polyethylene glycol moiety.


      27. The indicator molecule of clauses 21-26 wherein the indicator molecule comprises the following structure:


      (i) Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-PEG-Biotin


      (ii) Biotin-PEG-Asp-Glu-DSer-Nva-Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-Phe-DSer-Val


      (iii) Biotin-PEG-Asp-Arg-DAla-BIP-Ser-Pro-Ser[Gal-Sial]DAla-DAsp-Ser


      (iv) Biotin-PEG-Asp-Ser-Ser(PO3)-DAla-Ile-Orn-Ser[Gal-Sial]-DAla-Nle-Glu


      (v) Biotin-PEG-Asp-DAla-Arg-Nva-DSer-βAla-DAla-Nle-Ser[Gal-Sial]-BIP-Orn-DAla-Glu-Ser; or


      (vi) Biotin-PEG-Asp-Thr-DAla-Nle-Glu-DAla-Arg-βAla-Cyc-Orn-DSer-Pro-Ser[Gal-Sial]-βAla-Nva-DSer-Glu-Thr-Cha-DSer-Val


      28a. An antibody capable of specifically binding to the de-sialylated derivative of a peptide according to any one of clauses 1-20 or an indicator molecule according to any one of clauses 21-27, wherein the antibody binds preferentially to the de-sialylated derivative over the sialylated peptide or indicator molecule.


      28b. An antibody having a heavy chain with 3 CDRs and a light chain with 3 CDRs, wherein the heavy chain CDR1 has SEQ ID NO: 1; the heavy chain CDR2 has SEQ ID NO: 2; the heavy chain CDR3 has SEQ ID NO: 3; the light chain CDR1 has SEQ ID NO: 4; the light chain CDR2 has SEQ ID NO: 5; and/or the light chain CDR3 has SEQ ID NO: 6.


      28c. An antibody having a heavy chain that has SEQ ID NO: 7 and/or a light chain that has SEQ ID NO: 8.


Any reference to “clause 28” should be understood to encompass clause 28a, clause 28b, and clause 28c.


29. The antibody of clause 28 wherein the antibody can specifically bind to the epitope: Cyc-DAla-Ser[Gal]-DAla-Arg-PEG-Biotin, more particularly the epitope Cyc-DAla-Ser[Gal]-DAla-Arg.


30. The antibody according to clause 28 or 29 wherein the antibody is conjugated to a reporter molecule.


31. The antibody according to clause 30 wherein the reporter molecule is a gold particle.


32. A peptide for use in generating an antibody according to clause 28 wherein the peptide is a de-sialylated derivative of the peptide as defined in any one of clauses 1-20.


33. The peptide for use of clause 32 wherein the peptide is conjugated to a carrier protein in order to improve immunogenicity.


34. The peptide for use of clause 33 wherein the peptide is conjugated to keyhole limpet hemocyanin.


35. An enzyme detection device, enzyme detection kit or enzyme detection composition of matter for detecting the presence in a test sample of cleavage activity of a sialidase enzyme, the device comprising:


(i) an indicator molecule as defined in any one of clauses 21-27;


(ii) a capture zone to receive the test sample, wherein the capture zone comprises capture molecules capable of binding to the capture site of the indicator molecule, irrespective of whether or not the indicator molecule has been cleaved, in order to immobilise the indicator molecule; and


(iii) binding molecules capable of binding to the de-sialylated derivative of the indicator molecule, wherein the binding molecules are incapable of binding to the indicator molecule unless and until cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample has occurred.


36. The enzyme detection device, enzyme detection kit or enzyme detection composition of matter according to clause 35 wherein the device, kit or composition of matter comprises a solid support to which the capture molecules are attached to form the capture zone.


37. The enzyme detection device, enzyme detection kit or enzyme detection composition of matter according to clause 36 wherein the solid support further comprises a sample application zone to which the sample is applied.


38. The enzyme detection device, enzyme detection kit or enzyme detection composition of matter according to any one of clauses 36-37 wherein the solid support further comprises a control zone, downstream of the capture zone in relation to the sample application zone, containing further binding molecules which bind to the binding molecules to indicate successful completion of an assay using the device, kit or composition of matter.


39. The enzyme detection device, enzyme detection kit or enzyme detection composition of matter according to any one of clauses 36-38 wherein the solid support comprises a chromatographic medium.


40. The enzyme detection device, enzyme detection kit or enzyme detection composition of matter according to any one of clauses 35-39 wherein the indicator molecule is immobilised in the capture zone via the capture site being bound to the capture molecules.


41. A method for detecting the presence or absence in a test sample of cleavage activity of a sialidase enzyme, the method comprising:


(i) bringing an indicator molecule as defined in any one of clauses 21-27 into contact with the test sample;


(ii) adding to the test sample binding molecules capable of binding to the de-sialylated derivative of the indicator molecule, wherein the binding molecules are incapable of binding to the indicator molecule unless and until cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample has occurred;


(iii) capturing the de-sialylated derivative of the indicator molecule at a capture zone through binding of capture molecules in the capture zone to the capture site, said capture molecules being able to bind to the capture site irrespective of whether or not the indicator molecule has been cleaved; and


(iv) detecting cleavage of the sialyl group from the indicator molecule by determining binding of the binding molecules to the de-sialylated derivative of the indicator molecule captured in the capture zone.


42. A method for detecting the presence or absence in a test sample of cleavage activity of a sialidase enzyme, the method comprising:


(i) adding the test sample to a capture zone comprising capture molecules, said capture molecules being bound to the capture site of an indicator molecule as defined in any one of clauses 21-27 wherein said capture molecules remain bound to the capture site irrespective of whether or not cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample occurs;


(ii) adding binding molecules capable of binding to the de-sialylated derivative of the indicator molecule, wherein the binding molecules are incapable of binding to the indicator molecule unless and until cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample has occurred;


(iii) detecting cleavage of the sialyl group from the indicator molecule by determining binding of the binding molecules to the de-sialylated derivative of the indicator molecule captured in the capture zone.


43. The method of clause 42 wherein, prior to step (i), the indicator molecule is added to the capture zone such that the indicator molecule is bound in the capture zone via the capture molecules.


44. A method for diagnosing bacterial vaginosis in a test sample by detecting cleavage activity of a sialidase enzyme in the sample, the method comprising:


(i) bringing an indicator molecule as defined in any one of clauses 21-27 into contact with the test sample;


(ii) adding to the test sample binding molecules capable of binding to the de-sialylated derivative of the indicator molecule, wherein the binding molecules are incapable of binding to the indicator molecule unless and until cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample has occurred;


(iii) capturing the de-sialylated derivative of the indicator molecule at a capture zone through binding of capture molecules in the capture zone to the capture site, said capture molecules being able to bind to the capture site irrespective of whether or not the indicator molecule has been cleaved; and


(iv) detecting cleavage of the sialyl group from the indicator molecule by determining binding of the binding molecules to the de-sialylated derivative of the indicator molecule captured in the capture zone wherein an increased level of cleavage compared to a control diagnoses bacterial vaginosis.


45. A method for diagnosing bacterial vaginosis in a test sample by detecting cleavage activity of a sialidase enzyme in the sample, the method comprising:


(i) adding the test sample to a capture zone comprising capture molecules, said capture molecules being bound to the capture site of an indicator molecule as defined in any one of clauses 21-27 wherein said capture molecules remain bound to the capture site irrespective of whether or not cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample occurs;


(ii) adding binding molecules capable of binding to the de-sialylated derivative of the indicator molecule, wherein the binding molecules are incapable of binding to the indicator molecule unless and until cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample has occurred;


(iii) detecting cleavage of the sialyl group from the indicator molecule by determining binding of the binding molecules to the de-sialylated derivative of the indicator molecule captured in the capture zone wherein an increased level of cleavage compared to a control diagnoses bacterial vaginosis.


46. The method of clause 45 wherein, prior to step (i), the indicator molecule is added to the capture zone such that the indicator molecule is bound in the capture zone via the capture molecules.


47. The method of any one of clauses 41-46 wherein the sialidase enzyme originates from Prevotella, Bacteroides and/or Mobiluncus species and/or Gardnerella vaginalis.

48. The method of any one of clauses 41-47 wherein the method is performed using a device, kit or composition of matter as claimed in any one of clauses 35-40.


49. The method of any one of clauses 41, 44 or 47 wherein the method is performed using a device, kit or composition of matter as claimed in any one of clauses 35-39, further wherein the test sample and indicator molecule are mixed prior to bringing the test sample into contact with the device, kit or composition of matter.


50. An enzyme detection kit for detecting the presence in a test sample of cleavage activity of a sialidase enzyme, the kit comprising:


(i) an indicator molecule as defined in any one of clauses 21-27 for adding to the test sample;


(ii) capture molecules capable of binding to the capture site of the indicator molecule, irrespective of whether or not the indicator molecule has been cleaved;


(iii) a solid support to which the capture molecules can be attached to form a capture zone to receive the test sample; and


(iv) binding molecules capable of binding to the de-sialylated derivative of the indicator molecule, wherein the binding molecules are incapable of binding to the indicator molecule unless and until cleavage of the sialyl group from the indicator molecule by sialidase enzyme present in the sample has occurred.


51. The enzyme detection kit of clause 50 wherein the kit further comprises further binding molecules (control detection binders) capable of binding to the binding molecules.


52. The enzyme detection kit according to clause 51 wherein the solid support further comprises a control zone, downstream of the capture zone in relation to the sample application zone, to which the further binding molecules (control detection binders) can be attached.


53. The enzyme detection device, enzyme detection kit or enzyme detection composition of matter of any one of clauses 35-40, method of any one of clauses 41-49 or the enzyme detection kit of any one of clauses 50-52 wherein the binding molecule comprises an antibody as defined in any one of clauses 28-31.


54. The enzyme detection device, enzyme detection kit or enzyme detection composition of matter of any one of clauses 35-40 or 53, method of any one of clauses 41-49 or 53 or the enzyme detection kit of any one of clauses 50-53 wherein the capture site comprises a biotin molecule and the capture zone comprises a streptavidin molecule.


55. Use of an enzyme detection device, enzyme detection kit or enzyme detection composition of matter according to any one of clauses 35-40 53 or 54, method according to any one of clauses 41-49, 53 or 54 or the enzyme detection kit according to any one of clauses 50-54 for diagnosing bacterial vaginosis in a test sample.


56. The indicator molecule according to any one of clauses 21-27, enzyme detection device, enzyme detection kit or enzyme detection composition of matter according to any one of clauses 35-40, 53 or 54, method according to any one of clauses 41-49, 53 or 54, the enzyme detection kit according to any one of clauses 50-54 or use of clause 55 wherein the test sample is a vaginal sample, optionally a vaginal swab.





BRIEF DESCRIPTION OF THE DRAWINGS

The invention will now be described by way of example with respect to the accompanying drawings in which:



FIG. 1 is a schematic view of one format of the assay in accordance with the invention. The format relies upon the following basic components: a solid support (1); a capture molecule (2); an indicator molecule comprising a capture site (3) and a peptide of the invention, the peptide comprising a Gal-Sial cleavage site (4); and a binding molecule (5) that binds to the indicator molecule only after cleavage (6) has occurred. The indicator molecule Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-PEG-Biotin (SEQ ID NO: 11-PEG-Biotin; also termed “MOL600c” herein) is shown by way of example.



FIG. 2 is a schematic view of an enzyme detection device in accordance with the present invention and shows operation of the device in the absence (FIG. 2A) or presence (FIG. 2B) of sialidase activity.



FIG. 3 shows the visual read-out of the assay (shown in FIG. 2) as levels of sialidase activity in the test sample are increased.



FIG. 4 is a schematic view of an enzyme detection device in accordance with the present invention. The figure specifies the exact longitudinal dimensions and position of each of the card components.



FIG. 5 is a schematic view of the two conjugation chemistries used to couple peptides of the invention to Keyhole Limpet Hemocyanin (KLH): (A) cysteine/maleimide coupling; (B) hydrazine/benzaldehyde coupling.



FIG. 6 shows some of the non-standard and non-natural amino acids employed during the design of the peptides of the invention.



FIG. 7 is a schematic view summarising the synthetic approach used to produce peptides of the invention.



FIG. 8 shows the production of a sialylated peptide of the invention via an enzymatic route using transialidase and fetuin (a sialic acid donor).



FIG. 9 shows various peptides and peptide-protein conjugates synthesised as part of the invention. (A) Tabular summary of the peptides and peptide-protein conjugates synthesised. (B) Schematic overview of the peptides and peptide-protein conjugates synthesised.



FIG. 10 shows the initial ELISA results following immunisation of sheep with KLH-peptide conjugates of the invention. (A) a schematic of the detection method; (B)-(D) the results from the first bleeds, indicating that all sheep responded to the immunisations. Numbers 1056, 1057, 1058, 1059, 1062, 1063, 1064, 1065, 1066 and 1067 designate antisera from a specific immunised sheep respectively.



FIG. 11A-C shows ELISA results from a second bleed of the sheep described in FIG. 10. Antisera showed an increase in response in the second bleeds compared to the first bleeds



FIG. 12A-B shows all three bleeds compared for sheep CF1062-1067.



FIG. 13 shows ELISA results when antisera CF1064 was evaluated against MOL136 and MOL136c. (A) a schematic of the detection method; (B) ELISA results showing significant specificity to the galactosyl (i.e. de-sialylated) peptide MOL136 in preference to the sialylated peptide MOL136c.



FIG. 14 shows detection of the de-sialylated peptide MOL136 using gold-labelled CF1064 via lateral flow assay with little/no signal observed in relation to the sialylated peptide MOL136c nor the negative control (in which no peptide was included in the sample).



FIG. 15 shows detection of the de-sialylated peptide MOL136 using gold-labelled CF1064 and CF1065 via lateral flow assay with little/no signal observed in relation to the sialylated peptide MOL136c nor the negative control (in which no peptide was included in the sample).



FIG. 16 shows a lateral flow assay comparing MOL136 and MOL136c binding of gold-labelled CF1064 in the presence of healthy vaginal swab extracts.



FIG. 17 shows a lateral flow assay of MOL136c in the presence of 25 U/ml sialidase.



FIG. 18 shows lateral flow data showing a comparison between different affinity purified antisera fractions. (A) Graphical representation of line intensities; (B) lateral flow test strips as observed: (1)—Gold-sensitised affinity purified polyclonal antibody, (2)—Gold-sensitised affinity purified polyclonal antibody with cross-reactive antibodies removed, (3) Gold-sensitised cross-reactive antibodies from affinity purification.



FIG. 19 shows (A) a comparison of MOL136, MOL136c, MOL600 and MOL600c binding by ELISA and (B) lateral flow experiments showing marked improvement of performance as compared with MOL136/136c (refer to FIG. 18).



FIG. 20 shows stability data for heat dried MOL600c in polypropylene tubes at different storage temperatures and with two different heat drying methods: a speed vac and a heat block method. The measurement in ELISA are normalised to percentage desialylation as this would result in recognition by the antibody and increase in signal.



FIG. 21 shows typical data for MOL600c batches. (A) an analytical HPLC trace; (B) positive ion electrospray MS confirmation.



FIG. 22 is a schematic showing the column methods used for antibody purification with different sepharose matrices. The orange tags shown in respect of MOL600 and MPL600c represent biotin. The purple tag shown in respect of MOL615 represents an oxime group.



FIG. 23 shows stability data of lateral flow cassettes in storage over 12 weeks at 37° C.



FIG. 24 shows a lateral flow standard curve of sialidase concentration incubated for 5 minutes with peptide MOL600c. The test lines were quantified by using the Cube Reader.



FIG. 25 shows lateral flow testing of a healthy volunteer vaginal sample on a flock swab. The sample was extracted in 1 ml of sample buffer and split five ways. (A) sample but no peptide; (B) sample with MOL600c; (C) sample with MOL600c and sialidase at 500 U/ml for 5 minutes; (D) sample with MOL600c spun down; (E) sample with MOL600c and the same sialidase incubation spun down.



FIG. 26 shows the chemical formula of MOL616.



FIG. 27 shows results of Example 13 showing the specificity of antibody 125.1 for MOL600 compared to the sialylated form, MOL600c.



FIG. 28 shows a comparison of assays A and B using a range of different sialidase concentrations. For each sialidase concentration, the left bar represents the cube reading for assay B and the right bar represents the cube reading for assay A.



FIG. 29 shows a comparison of assays A and B using a range of different sialidase concentrations and read times. For each sialidase concentration, the bar represent from left to right (i) the cube reading for assay A after 5 minute read time; (ii) the cube reading for assay A after 10 minute read time; (iii) the cube reading for assay B after 5 minute read time; and (iv) the cube reading for assay B after 10 minute read time.



FIG. 30 shows a comparison of assays A, A′, B and B′ using a range of different sialidase concentrations, indicator concentrations and read times. For each sialidase concentration, the bar represent from left to right (i) the cube reading for assay B with 1 μg/ml indicator molecule per disc and 5 minutes read time; (ii) the cube reading for assay B with 3 μg/ml indicator molecule per disc and 5 minutes read time; (iii) the cube reading for assay A with 1 μg/ml indicator molecule per disc and 10 minutes read time; and (iv) the cube reading for assay A with 3 μg/ml indicator molecule per disc and 10 minutes read time.



FIG. 31 shows the sequences of antibody 125.1 indicating the CDR and framework regions.





DESCRIPTION OF PREFERRED EMBODIMENTS


FIG. 1 is a schematic view of one format of the assay in accordance with the invention. The format relies upon the following basic components: a solid support (1); a capture molecule (2); an indicator molecule comprising a capture site (3) and a peptide of the invention, the peptide comprising a Gal-Sial cleavage site (4); and a binding molecule (5) that binds to the indicator molecule only after cleavage (6) has occurred. The indicator molecule Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-PEG-Biotin (also termed “MOL600c” herein) is shown by way of example.


In the format shown, the capture molecule (2) is streptavidin. Here, the capture molecule (2) binds to a biotin capture site (3) within the indicator molecule.


As shown in FIG. 1A, once the indicator molecule of the invention is added to a test sample, sialidase enzyme present in the sample specifically recognises the Gal-Sial cleavage site (4) and cleaves the sialyl group from the indicator molecule (6).


As shown in FIG. 1B, this cleavage event (6) produces a binding site for the specific antibody binding molecule (5). The binding molecule (5) is unable to bind to the indicator molecule until cleavage (6) has occurred. Thus, the antibody binding molecule (5) binds to the amino acid sequence Cyc-DAla-Ser[Gal]-DAla-Arg produced as a result of cleavage of the sialyl group. The antibody binding molecule (5) does not bind to the Cyc-DAla-Ser[Gal-Sial]-DAla-Arg sequence prior to cleavage (not shown).



FIG. 2 is a schematic view of an enzyme detection device in accordance with the present invention and shows operation of the device in the absence (FIG. 2A) or presence (FIG. 2B) of sialidase activity. The test strip includes an adhesive liner (1) upon which the other components of the device are assembled. From right to left, the sample application zone (2) is in the form of an absorbent pad. This is laid partially overlapping the conjugate pad (3), which is impregnated with the labelled binding molecules (7). In alternative embodiments, the labelled binding molecules may be impregnated in the sample application zone and this removes the need for a separate conjugate pad. The conjugate pad (3) is in fluid connection with a nitrocellulose membrane (4). The nitrocellulose membrane (4) contains immobilized streptavidin molecules (5) which define a capture zone. The membrane (4) further contains immobilized further binding molecules (6) downstream of the capture zone which bind to further labelled molecules (11) which pass through the device with the sample and form a separate control zone. Alternatively, the immobilised further binding molecules may bind to labelled binding molecules (7). The device optionally further comprises an absorbent pad (8) to absorb any test sample and reagents reaching the end of the device.


In use, the indicator molecule (9) is added to the test sample prior to bringing the test sample into contact with the sample application zone (8) of the device. As shown in FIG. 2A, in the absence of sialidase activity in the test sample, the sialyl group is not cleaved from the indicator molecule (9). Upon sample flow into the conjugate pad (3), the binding molecules (7) are unable to bind to the indicator molecule (9) because cleavage of the sialyl group has not occurred. The indicator molecules become bound at the capture zone via the interaction between streptavidin (5) and the biotin capture site (10) of the indicator molecule (9). The labelled binding molecules (7) are not immobilized at the capture zone because they cannot bind to the indicator molecules (9). Accordingly, the labelled binding molecules flow through to the control zone and beyond. Further labelled molecules (11) also pass through the device to the control zone where they are immobilized by binding to the immobilized further binding molecules (6). Thus, absence of sialidase activity is displayed as a signal only at the control zone, but not at the capture zone. Excess sample, potentially containing labelled binding molecules (7), flows into the absorbent pad (8).


As shown in FIG. 2B, in the presence of sialidase activity in the test sample, the sialyl group is cleaved from the indicator molecule (9). Upon sample flow into the conjugate pad (3), the binding molecules (7) are able to bind to the indicator molecule (9) because cleavage of the sialyl group has occurred. The indicator molecules become bound at the capture zone via the interaction between streptavidin (5) and the biotin capture site (10) of the indicator molecule (9). The labelled binding molecules (7) are immobilized at the capture zone due to binding to the de-sialylated indicator molecules (9) at the cleavage site. Due to the relative excess of labelled binding molecule (7) to binding sites at the capture zone some labelled binding molecules (7) still flow through to the control zone and beyond. Further labelled molecules (11) also pass through the device to the control zone where they are immobilized by binding to the immobilized further binding molecules (6). Thus, presence of sialidase activity is displayed as a signal both at the capture zone and the control zone. Excess sample flows into the absorbent pad (8).


It should be noted that the control zone is optional. The presence or absence of sialidase activity in the sample can be monitored solely based upon the presence or absence of a corresponding signal at the capture zone.



FIG. 3 shows the visual read-out of the assay (shown in FIG. 2) as levels of sialidase activity in the test sample are increased. As can readily be seen, the signal at the control zone (1) is constant as sialidase amounts increase. In contrast, as sialidase amounts increase, the signal at the capture zone (2) also increases. This is due to cleavage of the sialyl group from the indicator molecule at the cleavage site by sialidase activity. This reveals a binding site, enabling binding of the binding molecules which is detected at the capture zone (2) via interaction between capture molecules defining the capture zone and the capture site of the indicator molecules.



FIG. 4 is a schematic view of one specific enzyme detection device in accordance with the present invention. The table below provides a legend for the figure and specifies the exact longitudinal dimensions and position of each of the card components in this particular embodiment. Of course, the dimensions and positions may be varied as would be readily understood by one skilled in the art.



















Position from



Component
Size
Datum point









Backing card (1)
60 mm
0 mm



Nitrocellulose Membrane (2)
25 mm
20 mm 



Conjugate Pad (3)
17 mm
5 mm



Sample Pad (4)
10 mm
0 mm



Absorbent Pad (5)
22 mm
38 mm 










The invention will be further understood with reference to the following experimental examples.


EXAMPLES
Example 1: Assay Chemistry Principle and Experimental Design

In summary, the principle works on the basis of antibody recognition of the chemical product of the sialidase reaction, where the chemical substrate is a peptide designed specifically to react with sialidase and the product of the reaction is then recognised by the antibody raised to that synthetic product. As shown in FIGS. 1 and 2, a glycopeptide containing sialic acid and with a biotin tag is provided. When contacted with a test sample containing sialidase activity, the sialyl group is cleaved from the glycopeptide by sialidase to expose the pendant galactosyl group on the peptide. An antibody raised against the de-sialylated product then specifically binds the cleaved product. By using an antibody-gold conjugate and a lateral flow strip with a streptavidin test line the presence of the de-sialylated product can be detected as a red line and a direct measure of the sialidase activity in a sample.


Five peptides were originally designed and the subsequent antibodies raised were evaluated and profiled as to their performance in a lateral flow assay. It was shown that under optimised conditions that some of the antibodies outperformed others in terms of their cross reactivity to the substrate peptide and their overall signal levels in the assay. In evaluations described below for the feasibility phase of the project the peptides were re-evaluated and the peptide/antibody combination with best performance was taken forward into further development.


Example 2: Peptide Design

In the design of the candidate peptide sequences a number of factors were taken into account:


Size

As a general rule, molecules with molecular weight (MW) less than 5000 daltons are unlikely to stimulate a good immune response in a host organism. The peptides were planned as relatively short sequences with the intention of conjugating to KLH (Keyhole Limpet Hemocyanin) which results in a much more effective immunogen. A range of different lengths (9-20 amino acids) were proposed to cover any potential variation in performance.


Conjugation Chemistry

Two different conjugation chemistries were used. For two of the peptides a cysteine label was incorporated into the structure so that it could be conjugated to carrier proteins using a standard maleimide based chemistry. For the other three peptides a relatively new hydrazine based chemistry was used which is a more controllable process than cysteine chemistry as there is less risk of oxidation of the peptide prior to coupling and the extent of coupling can be easily monitored by UV absorbance. An overview of these conjugation chemistries is shown in FIG. 5.


Position of the Galactose Sugar

The aim was to obtain antibodies with very high affinity to the galactose sugar and surrounding regions of the peptide. With this in mind it was decided to position the sugar centrally in the structure so that it was well flanked by other distinctive peptide features. This approach would hopefully minimise peripheral binding antibodies which lacked interaction with the sugar moiety.


Structural Diversity

A range of amino acids were used in constructing the various peptide sequences. By combining charged, hydrophilic and hydrophobic groups along the sequence diverse topologies would be promoted. “Hinge groups” such as β-Alanine were also employed to allow additional degrees of freedom in the overall structural fold. In addition to this unnatural amino acids were employed to add to the sequence diversity and to promote an immune response. To reduce susceptibility to proteases some D-amino acids were also incorporated. Some of the non-standard and non-natural amino acids employed are shown in FIG. 6.


After consideration of these factors the following peptide sequences were chosen as putative epitopes.













Peptide sequence
Designated name







---Arg-DAla-Bip-Ser-Pro-Ser(β-Gal)-DAla-DAsp-Ser----
MOL133



(Desialylated SEQ ID NO: 13)





---Ser-SEP-DAla-Ile-Orn-Ser(β-Gal)-DAla-Nle-Glu----
MOL134



(Desialylated SEQ ID NO: 14)





---DAla-Arg-Nva-DSer-βAla-DAla-Nle-Ser(β-Gal)-Bip-Orn-DAla-
MOL135


Glu-Ser----
(Desialylated SEQ ID NO: 15)





---Glu-DSer-Nva-Cyc-DAla-Ser(β-Gal)-DAla-Arg-Phe-DSer-Val---
MOL136



(Desialylated SEQ ID NO: 12)





---Thr-DAla-Nle-Glu-DAla-Arg-βAla-Cyc-Orn-DSer-Pro-Ser
MOL137


(β-Gal)-βAla-Nva-DSer-Glu-Thr-Cha-DSer-Val----
(Desialylated SEQ ID NO: 16)









Spacers, conjugation groups and biotin labels were added to the C or N termini.


Example 3: Peptide Synthesis

Galactose-labelled peptides were synthesised using solid phase chemistry methods on an automated microwave synthesiser. All peptides were purified using reverse phase HPLC and characterised by Electrospray LCMS. To label the galactose moiety with sialic acid an enzymatic route was employed using recombinant transialidase from T. cruzi (TcTS) and fetuin as a sialic acid donor. FIGS. 7 and 8 summarise the synthetic approach used.


As well as the relevant peptide immunogens for conjugation to carrier proteins, two biotinylated derivatives of each sequence were also synthesised, one labelled with sialic acid. These biotinylated derivatives would form the basis for the lateral flow assay format. FIG. 9 shows the peptides synthesised for this work according to the various immunisations. Peptides labelled with sialic acid are designated with a ‘c’; e.g. MOL136c. Peptides which lack the sialyl group lack this designation (e.g. MOL136).


Example 4A: Antibody Generation
Immunisations

All five peptide immunogens were coupled to KLH and BSA using the appropriate coupling chemistries (see FIG. 9). The KLH conjugates were submitted to Micropharm Ltd for immunisation into ten sheep (two per peptide). The program was initiated with a dose of 1 mg of KLH-peptide in PBS. Three further boosters of 0.5 mg were given over a period of three months. Three separate bleeds were taken during this period (one sample and two production bleeds) and supplied to Mologic. BSA conjugates were retained to carry out the screening of the various bleeds.


Initial ELISA Screens

Polystyrene high binding multi-well plates were sensitized with the appropriate BSA conjugate and non-conjugated BSA as a control. Sera samples were incubated in the BSA blocked wells at various dilutions and further bound with a secondary anti-sheep antibody conjugated to alkaline phosphatase (AP). Incubations with para-Nitrophenylphosphate (pNPP) AP substrate indicated the presence of any binding. In all cases buffer, BSA and pre-bleed controls resulted in no background binding to the plate. FIG. 10A shows a schematic of the detection method. FIGS. 10B-10D show the results from the first bleeds, indicating that all sheep responded to the immunisations. Sera dilutions at 1/1000 gave high signal whilst controls of BSA were negative, confirming peptide specific response. Pre-bleed controls were also negative.


As further bleeds became available, these were also analysed by ELISA showing an enhancement of response over time. FIG. 11 illustrates the relationship between the first two bleeds for all the sheep while FIG. 12 shows all three bleeds compared for sheep CF1062-1067. Interestingly the third bleeds appear plateaued or even reduced in terms of their overall response to antigen. Nevertheless in some cases a binding response was detected at 1/1000000 dilution suggesting a polyclonal response highly sensitive to the peptide. Despite the slightly lower response in the third bleeds, these were preferred for affinity purifications as they were the most likely to contain a sub-population of highly specific antibodies.


Example 4B: Antisera CF1064 and CF1065 and Detection of MOL136 and MOL136c
Immunogen: KLH-MOL123A

Biotinylated Peptides: MOL136 (galactosyl); MOL136c (sialyl)


Both sheep responded well to immunisation with KLH-MOL123A with CF1064 giving a slightly stronger response overall (see FIG. 11B). In ELISA format (a schematic of which is shown in FIG. 13A), binding of CF1064 was evaluated against MOL136 and MOL136c, showing significant specificity to the galactosyl (i.e. de-sialylated) peptide MOL136 in preference to the sialylated peptide MOL136c (FIG. 13B). Thus, excellent discrimination of the two peptides by antisera CF1064 is demonstrated.


Similar properties were observed in lateral flow format. CF1064 was conjugated to gold particles in optimised conditions (15 μg/ml loading in 10 mM sodium borate buffer; pH 8.0) and assayed against MOL136 and MOL136c at a final concentration of 1.3 ng/ml (38 μg per strip). Thus, a capture zone was first formed on each lateral flow test strip using 1.5 mg/ml streptavidin. Then, 3 μl of each peptide (12.5 ng/ml peptide in PBST) was mixed with 10 μl of gold-labelled CF1064 and 15 μl of running buffer (0.5 M Tris at pH 7.5+3% BSA+0.5% Triton X-100) before each sample was run along a separate lateral flow test strip. A negative control in which no peptide was added was also run as a negative control. 15 μl of running buffer wash was then run along each lateral flow test strip. De-sialylated peptide MOL136 was clearly detected in the capture zone, observed as a visible line on the test strip. Conversely, little/no signal was observed in relation to the sialylated peptide MOL136c nor the negative control (see FIG. 14).


Similar results were observed using gold-labelled CF1065, with a higher signal level observed for CF1065 relative to CF1064 (see FIG. 15).


Example 5: Detection of MOL136 and MOL136c Using CF1064 in the Presence of Healthy Vaginal Swab Extracts

The procedure described in Example 4B was repeated in the presence of healthy vaginal swab extracts. Although the signal levels were slightly lower, the specificity to MOL136 was retained without any interference of the swab matrix (see FIG. 16).


Example 6: Detection of Sialidase Activity Using MOL136c and CF1064

The procedure described in Example 4B was repeated in the presence of 25 U/ml sialidase. A sample in which sialidase was absent was used as a negative control. A further negative control was run in which no peptide and no sialidase was included in the sample. As a positive control, MOL136 was used in place of MOL136c in the presence of 25 U/ml sialidase. A clear positive signal was observed in respect of MOL136c incubated in the presence of 25 U/ml sialidase in PBST for 5 minutes. The level of signal was similar in intensity to that of the positive control which shows the putative maximum signal. As expected, little/no signal was observed in respect of the negative controls (see FIG. 17).


Overall both CF1064 and CF1065 showed good specificity for the galactosyl (i.e. de-sialylated) peptide MOL136 and are both potential candidates for monoclonal screening.


Example 7: Peptide Development

After an evaluation of the peptides and antisera, it was shown that sera CF1064 and peptides MOL136 and MOL136c provided the most feasible combination for the test. Sheep CF1064 was immunised with the same peptide sequence as MOL136 but as a KLH conjugate using cysteine-maleimide chemistry in place of the biotin.


MOL136: biotin-PEG-Asp-Glu-DSer-Nva-Cyc-DAla-Ser[Gal]-DAla-Arg-Phe-DSer-Val-OH


MOL136c: biotin-PEG-Asp-Glu-DSer-Nva-Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-Phe-DSer-Val-OH


To purify the antisera, a method was devised using a streptavidin column to capture MOL136 and MOL136c. Antibody was then bound and eluted from the MOL136 column and absorbed to the MOL136c column to remove any peripheral binders picking up common epitopes between the two structures. By evaluating the purified antibody in lateral flow, the overall specificity to the original galactosyl peptide antigen and the degree of cross-reactivity to the sialylated peptide was measured (FIG. 18). This is important because it represents the amount of non-specific binding observed in a negative result in the prototype and, without an optical reader in use, would need to be reduced significantly so that the naked eye would not pick it up.


Purified and absorbed fraction performed best in the assay when compared to non-absorbed materials. Despite the significantly lower background signal, further method development was required to improve the performance by truncating the peptide structure.


To refine the peptide design and remove peripheral interactions of antibodies not binding the galactose moiety in the peptide, the original sequence MOL136 was truncated to a shorter sequence MOL600:


MOL600: NH2—Cyc-DAla-Ser[Gal]-DAla-Arg-PEG-Biotin


MOL600c: NH2—Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-PEG-Biotin


MOL600 and MOL600c were then assayed by ELISA and lateral showing a significant improvement in performance (see FIG. 19).


Example 8: MOL600c Formulation/Stability Studies and Scale-Up Production

For evaluation of how the MOL600c peptide could be formulated, a study was set up to look at drying conditions. The peptide was formulated in a drying buffer, air dried and stored at room temperature prior to use in the prototype format. Data is shown in FIG. 20 demonstrating the stability of peptide MOL600c stored in polypropylene tubes at different temperatures and with different drying methods. The peptides retained their functionality up to week 4 overall, however performance appears to decline at 8 weeks.


For manufacture, the peptide synthesis has been shown to be scalable and can be ramped up to manufacturing batches. The peptide is produced by solid phase synthesis on an automated system and then purified by HPLC. Two further chemical steps are required and a further final purification by HPLC to a specification of >95% purity. The product is confirmed by electrospray mass spectrometry. As only 12 ng of peptide is required per test, 1-2 mg batches of peptide are of adequate size. FIG. 21 shows typical analytical data of a completed batch of MOL600c.


Example 9: Antibody Purification Development

The purification process used with antisera CF1064 along with the optimised truncated peptide system was developed initially to work on streptavidin columns charged with MOL600 and an absorption column charged with MOL600c. Whilst this process produces effective antibody with good cross reactivity features, further improvements were required to improve consistency and reduce the number of manual steps for automation.


To explore a more refined method using a single pass, other column formats were tried and were shown to be feasible and with potential to be automated (FIG. 22). Two different columns types have been used and processes have varied from a single pass method to a post-absorption method where unwanted interactions are mopped up to reduce non-specific binding in the assay. The best option for manufacture is a single pass process and this can be achieved using the peptide MOL615 conjugated to carrier BSA and then derivatised on to an NHS sepharose column.


MOL615: NH2—Cyc-DAla-Ser[Gal]-DAla-Arg-PEG-Oxime


The antibody component in the prototype is formulated as a gold conjugate dried into a conjugate pad within the lateral flow assembly. Conditions have been established for gold conjugate stabilisation and further optimised. The amount of antibody calculated to be required per test is estimated at 85 ng which is sufficient to generate the required validation batches achieve CE Marking. In the long term additional polyclonal reagent will have to be developed and—as more permanent solution—a monoclonal. New immunisations have been started and strong antibody titres have already been identified to the peptide target (FIG. 10). Several options will be utilised for monoclonal generation, including commercial hybridoma technology and also in house Phage panning and fab generation (Mologic York and Scotia Biologics).


Example 10: Sample Buffer

Extraction of sample from the swab, dissolving of peptide and optimal digest conditions for sialidase are the principle requirements of the sample buffer. The following formulation was used:


100 mM sodium acetate, 2 mM calcium chloride, pH 6.0 containing 0.1% BSA, 0.125% Tween-20 and 0.375% Triton X-100


The buffer has been used successfully to run devices in dry and also extract real samples in spiked recovery.


Example 11: Lateral Flow Device

A lateral flow device was constructed per FIG. 4.


A batch of lateral flow devices were evaluated for stability at 37° C. over 12 weeks. After 6 weeks, signals enhanced in value over earlier measurements however the shape of the curves and dynamic range appeared relatively consistent (see FIG. 23).


Example 12: Assay Optimisation

To satisfy a feasible performance, specification factors such as length of assay time, sensitivity of response to the marker, line signal strength and quality of standard curve were evaluated.


The assay has been shown to work with an incubation time of 5 minutes. This would keep the total time of the assay within 15 minutes from swab sample collection to the reading of the result. In the in-vitro diagnostic industry, 15 minutes is generally the norm as an upper limit for a point of care rapid test.


The full relevant range of the marker (sialidase) is believed to be from 4 U/ml to 250 U/ml. This is based on the literature by estimating the spread of sample data sets in relation to a fluorescent sialidase reference assay (Marconi et. al., European Journal of Obstetrics and Gynaecology and Reproductive Biology, 2013, vol. 167, pages 205-209). There are assumptions made in this approach as in the BV condition a number of different phenotypes (bacterial sialidases) will be present in the sample as about 20 different bacterial species have been associated with the condition. The assay has been tested across this range of sialidase in buffer and a standard curve representing this range has been achieved in lateral flow (FIG. 24).


The assay has also been tested on real healthy samples and signal has been recovered by spiking in sialidase. Whether a sample is spun down or not has been shown not to make a difference. The appearance of the test line was not adversely affected by the presence of sample matrix (FIG. 25). For the sample to be of sufficient mobility, 0.5 ml of diluent sample buffer was found to be too concentrated as the samples retained too much viscosity. Currently 1 ml is considered the appropriate amount of buffer to use.


Example 13 Further Antibody Generation

The following peptide, designated MOL616, was chosen to generate further antibodies: Dpr(AOA)-dSer-Nva-Cyc-dAla-Ser(Gal)-dAla-Arg-Phe-dSer-Val-NH2.


The chemical formula of MOL616 is shown in FIG. 26.


The peptide was coupled to KLH, yielding an immunogen denoted KLH-MOL616. Rabbits (Oryctolagus cuniculus) were immunised with KLH-MOL616 and splenocytes were captured and screened with a truncated version of this peptide (MOL615, conjugated to BSA). Counter screens were carried out with the sialylated form of peptide MOL615, MOL615c. The screening process involved a multi-clone screen followed by a subclone screen to yield an antibody specific for the de-sialylated form.


This process led to the generation of a monoclonal antibody denoted antibody 125.1. This antibody is specific for an epitope present in the de-sialidated molecule Cyc-DAla-Ser[Gal]-DAla-Arg-PEG-Oxime, more particularly for an epitope present in the de-sialidated peptide Cyc-DAla-Ser[Gal]-DAla-Arg.


MOL615 was biotinylated to yield MOL600 (sequence provided in Example 7) and antibody binding affinity and kinetics was measured using bio-inferometry. Briefly, MOL600 or MOL600c was immobilised on a biosensor by streptavidin/biotin interaction. Binding of the antibody was detected by a shift in the reflected light interference.


Using different concentrations of antibody 125.1 (1, 2, 4, 8 or 16 nM respectively) the following binding affinity and kinetics were determined for antibody 125.1: KD=7.9 nM; Kon=54080M−1s−1, Koff=0.000427 s−1


The binding was clearly specific for MOL600 compared to the sialylated form, MOL600c, as shown in FIG. 27.


The antibody was sequenced and determined to have a Gamma Heavy chain and a Kappa Light chain. The sequences of this antibody are shown in FIG. 31 and listed below.









Antibody-Heavy-Chain


(SEQ ID NO: 7)


QSVEESGGRLVTPGTPLTLTCTVSGFSLSSYSMDWVRQAPGKGLEWVGGI





TTTLHTFYATWAKGRFTISKTSSTTVDLKMTSLTTDDAATYFCARGGSSV





IWGPGTLVTVSSGQPKAPSVFPLAPCCGDTPSSTVTLGCLVKGYLPEPVT





VTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATN





TKVDKTVAPSTCSKPTCPPPELLGGPSVFIFPPKPKDTLMISRTPEVTCV





VVDVSEDDPEVQFTWYINNEQVRTARPPLREQQFNSTIRWSTLPIAHEDW





LRGKEFKCKVHNKALPAPIEKTISKARGQPLEPKVYTMGPPREELSSRSV





SLTCMINGFYPSDISVEWEKNGKAEDNYKTTPAVLDSDGSYFLYSKLSVP





TSEWQRGDVFTCSVMHEALHNHYTQKSISRSPG





Antibody-Light-Chain


(SEQ ID NO: 8)


ALVMTQTPSPVSAAVGGTVTISCQSSQSVYGNNHLNWHQQKRGQPPKQLI





GSASRLASGVPSRFKGSGSGTQFTLTISGVQCDDAATYYCQGSYYNGAWY





VAFGGGTELEIKRDPVAPSVLLFPPSKEELTTGTATIVCVANKFYPSDIT





VTWKVDGTTQQSGIENSKTPQSPEDNTYSLSSTLSLTSAQYNSHSVYTCE





VVQGSASPIVQSFNRGDC





Heavy Chain CDR sequences


CDR1


(SEQ ID NO: 1)


GFSLSSY





CDR2


(SEQ ID NO: 2)


TTTLH





CDR3


(SEQ ID NO: 3)


GGSSVI





Light Chain CDR sequences


CDR1


(SEQ ID NO: 4)


QSSQSVYGNNHLN





CRD2


(SEQ ID NO: 5)


SASRLAS





CDR3


(SEQ ID NO: 6)


QGSYYNGAWYVA






Notable Observations:

An additional O-linked glycosylation site was detected in the heavy chain constant region between positions 213 and 216. From the gel image, the form that is glycosylated at this site is similar in abundance to the unglycosylated form.


N-linked glycosylation was detected on heavy chain constant region N@285.


Pyro-Glu(Q) modification observed at N-terminal of heavy chain.


Elimination of C-terminal lysine from regular constant region sequence observed on heavy chain.


Example 14 Further Assay Optimisations

For further optimization, two different sialidase activity assays (A and B, see below) were compared. The assay set up was essentially as described in connection with FIG. 2.


Test antibodies were conjugated to gold and dried onto a carrier, referred to herein as a “conjugate pad”. The test antibody in assay A was “1064 purified Mol615 antibody”, i.e. a polyclonal antibody purified from serum 1064 using Mol615. The test antibody in assay B was a monoclonal antibody denoted “125.1” (see Example 13).


A control antibody was also conjugated to gold and dried onto the conjugate pad. For assay B, this was Chicken IgY, supplied by Lampire, product code 7401403.


Capture molecules (polystreptavidin) were immobilised on a nitrocellulose membrane to form a capture line. A separate control capture line was formed. For assay B, this was Anti-Chicken IgY antibodies (supplied by Lampire, product code 7455207).


The conjugate pad was laminated onto the nitrocellulose as shown in FIG. 2.


The test indicator molecule, NH2—Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-PEG-Biotin (MOL600c), was prepared and 1 μg/ml or 3 μg/ml was freeze dried onto an inert porous material (a Porex disc) to yield an indicator substrate disc comprising 36 ng indicator molecule per disc or 108 ng indicator molecule per disc respectively.


Sialidase was tested at the following concentrations: 50, 12.5 and 1.56 U/ml. A negative standard using peptide disk and assay buffer was also run. Responses were measured against cube readings and a visual scale.


The following basic protocol was used: Ensure all solutions are at room temperature and mixed well.


Test each of the desired conditions with the 50, 12.5 and 1.56 U/ml sialidase buffer standards solutions.


Test all standards and the sialidase buffer in triplicate.


Add 1000 μl of sialidase standard to an extraction tube, together with an indicator substrate disc. Seal the tube by folding the lid and cap into place. Gently agitate the tube and allow to incubate for 5 minutes with the indicator substrate disc.


Add 4 drops from the extraction tube to the device to the sample pad.


Read at 5 or 10 minutes using the cube reader (Optricon reader from opTricon GmbH (Chembio Diagnostic systems) of Schwarzschildstrasse 1, D-12489 Berlin, Germany) and record test and control line signals.


Features of the test assays are shown below.















Assay A
Assay B







Conjugate Pad
Millipore GFDX
Ahlstrom 8951


Control Line Antibody
Anti-sheep Antibody
Anti-Chicken IgY




Antibody


Gold conjugate
Test Only
Test and Control


Test gold conjugate
1064 purified MoI615
125.1 Monoclonal


antibody
Polyclonal Antibody
Antibody


Peptide Concentration
1 μg/ml (36 ng per
3 μg/ml (108 ng per



disc)
disc)


Device Read Time
10 minutes
5 minutes


Gold OD
5
4


Sample Pad
MDI FR1
MDI FR1









(I) Comparison of Read Times


The desirable output is to have a 10-minute test, with a 5-minute incubation and then a 5-minute read time. Results were read at 5 and 10 minutes to investigate the effect of read time on results. Results are shown in FIG. 28. As can be seen, assay A requires a 10-minute read time to meet the correct response for the bottom standard where assay B only requires a 5-minute read time. Assay B does not seem to benefit significantly from a 10-minute read time; it meets the desirable output of a 10-minute test with a 5-minute read.


(ii) Comparison of Sensitivity


The results of assay B were read after 5 minutes and the results of assay A were read after 10 minutes. Results are shown in FIG. 29.


Assay B shows higher cube readings compared to assay A across the 50 U/ml, 12.5 U/ml and 1.56 U/ml standards and has lower cube readings for the 0 U/ml standard. Both A and B are giving the correct response for each of the standards and the % CV are within specification. Assay B is giving cube readings for the standards after a shorter device development time and with lower cube readings for the 0 standards. Thus, assay B is superior to assay A.


(iii) Effect of Peptide Concentration


Assays A and B were compared to each other and to variants with different peptide concentrations. Assay A′ corresponded to assay A, but with a peptide concentration of 3 μg/ml (108 ng per disc); Assay B′ corresponded to assay B, but with a peptide concentration of 1 μg/ml (108 ng per disc).


The results of assay B and B′ were read after 5 minutes and the results of assay A and A′ were read after 10 minutes. Results are shown in FIG. 30. Higher peptide concentrations gave better results and a peptide concentration of >1 μg/ml (>108 ng per disc) is preferred.


Conclusions:

The assay B has improved performance to the assay A in a shorter time because of the changes made to the antibody and the increase of the peptide concentration.


Example 15—Additional Assay Optimisations
Gold Optical Density

The effect of increasing the gold conjugate spraying concentration from OD4 to OD6 or OD8 was investigated, and it was found that while OD6 gold gave a slight increase in test line signal compared to OD4, OD8 gave double the test line signal of OD4 at 3.125 U/mL sialidase. Thus, using gold conjugation at an OD of about or at least 8 is advantageous.


Sample/Conjugate Pad

In a lateral flow assay device, such as the type schematically represented in FIG. 2, the sample pad should allow the sample to flow along the device to allow the sample to come into contact with the conjugate pad containing the binding molecules and subsequently come into contact with the capture molecules. Depending on the viscosity of the sample, some sample pad materials may be advantageous.


In order to assess the different sample pads, a synthetic vaginal fluid substitute was prepared using guar gum and bovine mucin (0.25% guar gum, 0.125% mucin, 5% blue latex (Polysciences Inc., 15709, 2.6%, dissolved in water). The synthetic vaginal fluid was allowed to run through all of the sample pads. The time taken for the sample to run the length of the test strip was recorded (see Table below)















Time to start
Time to run


Sample Pad
of window
length of window







1. FR1 10 mm blood separator
01:20
02:20


2. GF-142
01:16
02:06


3. 8964, Ahlstrom
01:17
02:07


4. 6613, Ahlstrom
01:45
01:20


5. 6615, Ahlstrom
02:20
01:30









Ahlstrom are glass fibre pads of different densities (8964, 6613 and 6615 respectively).


For further comparison, materials were made using two sample pads (FR1 and Ahlstrom 8964). Devices were run using a 4 point standard curve (0, 3.125, 12.5 and 50 U/mL sialidase in aqueous buffer solution), in order to determine whether the alternative sample pad had any effect on either specific or nonspecific signal. Samples run using the 8964 sample pad gave higher specific signal compared to the FR1, with no non-specific binding (NSB).


Using a set of clinical samples spiked with 6.25 U/ml sialidase it was determined that a fibreglass-type pad such as the Ahlstrom 8964 sample pad allows very reliable sample flow and enzyme detection.


Example 16—Diagnosis of Bacterial Vaginosis

Clinical samples were obtained and analysed for criteria such as clue cells to determine a Nugent score, on the basis of which the samples were classed as positive or negative for bacterial vaginosis. The samples were analysed using assay A or assay B (see Example 14).


The results are shown below, wherein se stands for sensitivity; sp stands for specificity; ppv stands for positive predicted value; and nvp stands for negative predicted value.


Assay A


















Nugent
Nugent





POS
NEG
TOTAL







Assay A
POS
25
 0
25


Assay A
NEG
 2
25
27



TOTAL
27
25
52
























se
sp
ppv
npv







estimate:
0.93
1
1
0.93


95% Cl:
[0.76; 0.99]
[0.86; 1]
[0.86; 1]
[0.76; 0.99]


p-value:
5.65E−06
5.96E−08
5.96E−08
5.65E−06









Assay B

















NUGENT SCORE














POS
NEG
TOTAL





Assay B
POS
27
 0
27


Assay B
NEG
 0
25
25



TOTAL
27
25
52
























se
sp
ppv
npv







estimate:
1
1
1
1


95% Cl:
[0.87; 1]
[0.86; 1]
[0.87; 1]
[0.86; 1]


p-value:
1.49E−08
5.96E−08
1.49E−08
5.96E−08









Thus, both assays performed well at distinguishing between clinical samples that are positive or negative for bacterial vaginosis. Assay B was superior to assay A.


The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description and accompanying figures. Such modifications are intended to fall within the scope of the appended claims. Moreover, all aspects and embodiments of the invention described herein are considered to be broadly applicable and combinable with any and all other consistent embodiments, including those taken from other aspects of the invention (including in isolation) as appropriate. Various publications are cited herein, the disclosures of which are incorporated by reference in their entireties.

Claims
  • 1. An enzyme detection device or enzyme detection kit for detecting the presence in a test sample of cleavage activity of a sialidase enzyme, the device or kit comprising: (i) an indicator molecule comprising (a) a peptide comprising the following sequence:
  • 2. The device or kit of claim 1 wherein at least one of X1, X2, X4 and X5 is Ala, preferably wherein X1 and X2 are both Ala, and/or preferably wherein Ala is DAla or βAla.
  • 3. The device or kit of claim 1, wherein at least one of X1, X2, X4 and X5 is a charged amino acid, optionally wherein each charged amino acid is selected from Arg, DAsp and LOrn.
  • 4. The device or kit of claim 1, wherein at least one of X1, X2, X4 and X5 is a polar amino acid, optionally wherein each polar amino acid is selected from LSer, DSer and Thr.
  • 5. The device or kit of claim 1, wherein the peptide comprises the following sequence:
  • 6. The device or kit of claim 1, wherein the peptide comprises the following sequences:
  • 7. The device or kit of claim 1, wherein the peptide is biased for cleavage by one or more specific sialidases, optionally wherein the one or more specific sialidases are of bacterial origin, optionally wherein the bacteria are Prevotella, Bacteroides and/or Mobiluncus species and/or Gardnerella vaginalis.
  • 8. The device or kit of claim 1, wherein the binding molecule is specific for the de-sialylated form of the peptide comprising SEQ ID NO: 11, 12, 13, 14, 15, or 16, preferably is specific for an epitope that is present in the peptide motif Cyc-DAla-Ser[Gal]-DAla-Arg and that is absent or cryptic in the corresponding sialylated peptide motif Cyc-DAla-Ser[Gal-Sial]-DAla-Arg.
  • 9. The device or kit of claim 1, wherein the binding molecule is an antibody having a heavy chain with 3 CDRs and a light chain with 3 CDRs, wherein the heavy chain CDR1 has SEQ ID NO:1; the heavy chain CDR2 has SEQ ID NO:2; the heavy chain CDR3 has SEQ ID NO:3; the light chain CDR1 has SEQ ID NO: 4; the light chain CDR2 has SEQ ID NO: 5; and the light chain CDR3 has SEQ ID NO: 6, preferably wherein the heavy chain has SEQ ID NO: 7 and/or the light chain has SEQ ID NO: 8.
  • 10. The device or kit of claim 1, wherein the binding molecule is labelled with a reporter molecule, preferably a gold particle.
  • 11. The device or kit of claim 1, wherein the capture site of the indicator molecule comprises a biotin molecule or an oxime moiety; and/or is at the N- or C-terminus of the peptide.
  • 12. The device or kit of claim 1, wherein the capture site of the indicator molecule is attached to the peptide by a linker, optionally wherein the linker comprises a polyethylene glycol (PEG) moiety, optionally wherein the peptide is linked to a biotin group at its N- or C-terminus via a linker comprising a polyethylene glycol moiety.
  • 13. The device or kit of claim 1, wherein the indicator molecule comprises the following structure: (i) Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-PEG-Biotin(ii) Biotin-PEG-Asp-Glu-DSer-Nva-Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-Phe-DSer-Val(iii) Biotin-PEG-Asp-Arg-DAla-BIP-Ser-Pro-Ser[Gal-Sial]-DAla-DAsp-Ser(iv) Biotin-PEG-Asp-Ser-Ser(PO3)-DAla-Ile-Orn-Ser[Gal-Sial]-DAla-Nle-Glu(v) Biotin-PEG-Asp-DAla-Arg-Nva-DSer-βAla-DAla-Nle-Ser[Gal-Sial]-BIP-Orn-DAla-Glu-Ser; or(vi) Biotin-PEG-Asp-Thr-DAla-Nle-Glu-DAla-Arg-βAla-Cyc-Orn-DSer-Pro-Ser[Gal-Sial]-βAla-Nva-DSer-Glu-Thr-Cha-DSer-Val.
  • 14. The device or kit of claim 1, wherein the indicator molecule comprises (i) a peptide comprising the sequence Cyc-DAla-Ser[Gal-Sial]-DAla-Arg; and (ii) a capture site that comprises a biotin molecule or an oxime moiety which is optionally linked to the N- or C-terminus of the peptide via a linker comprising a polyethylene glycol moiety; and wherein the binding molecule is: (a) an antibody specific for the de-sialylated form of the peptide comprising SEQ ID NO: 11, 12, 13, 14, 15, or 16, preferably is specific for an epitope that is present in the peptide motif Cyc-DAla-Ser[Gal]-DAla-Arg and that is absent or cryptic in the corresponding sialylated peptide motif Cyc-DAla-Ser[Gal-Sial]-DAla-Arg; or(b) an antibody having a heavy chain with 3 CDRs and a light chain with 3 CDRs, wherein the heavy chain CDR1 has SEQ ID NO:1; the heavy chain CDR2 has SEQ ID NO:2; the heavy chain CDR3 has SEQ ID NO:3; the light chain CDR1 has SEQ ID NO: 4; the light chain CDR2 has SEQ ID NO: 5; and the light chain CDR3 has SEQ ID NO: 6, preferably wherein the heavy chain has SEQ ID NO: 7 and/or the light chain has SEQ ID NO: 8;
  • 15. A composition comprising: (a) an antibody specific for the de-sialylated form of the peptide comprising SEQ ID NO: 11, 12, 13, 14, 15, or 16, preferably specific for an epitope that is present in the peptide motif Cyc-DAla-Ser[Gal]-DAla-Arg and that is absent or cryptic in the corresponding sialylated peptide motif Cyc-DAla-Ser[Gal-Sial]-DAla-Arg; or(b) an antibody having a heavy chain with 3 CDRs and a light chain with 3 CDRs, wherein the heavy chain CDR1 has SEQ ID NO:1; the heavy chain CDR2 has SEQ ID NO:2; the heavy chain CDR3 has SEQ ID NO:3; the light chain CDR1 has SEQ ID NO: 4; the light chain CDR2 has SEQ ID NO: 5; and the light chain CDR3 has SEQ ID NO: 6, preferably wherein the heavy chain has SEQ ID NO: 7 and/or the light chain has SEQ ID NO: 8; or(c) an indicator molecule suitable for use in detecting the presence in a test sample of cleavage activity of a sialidase enzyme, the indicator molecule comprising a capture site and a peptide comprising: (i) Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-PEG-Biotin;(ii) Biotin-PEG-Asp-Glu-DSer-Nva-Cyc-DAla-Ser[Gal-Sial]-DAla-Arg-Phe-DSer-Val;(iii) Biotin-PEG-Asp-Arg-DAla-BIP-Ser-Pro-Ser[Gal-Sial]-DAla-DAsp-Ser;(iv) Biotin-PEG-Asp-Ser-Ser(PO3)-DAla-Ile-Orn-Ser[Gal-Sial]-DAla-Nle-Glu;(v) Biotin-PEG-Asp-DAla-Arg-Nva-DSer-βAla-DAla-Nle-Ser[Gal-Sial]-BIP-Orn-DAla-Glu-Ser; or(vi) Biotin-PEG-Asp-Thr-DAla-Nle-Glu-DAla-Arg-βAla-Cyc-Orn-DSer-Pro-Ser[Gal-Sial]-βAla-Nva-DSer-Glu-Thr-Cha-DSer-Val; or(d) an indicator molecule suitable for use in detecting the presence in a test sample of cleavage activity of a sialidase enzyme, the indicator molecule comprising a capture site and a peptide comprising: X1-X2-X3[Gal-Sial]-X4-X5  wherein: Sial is a sialyl group; X3 is an amino acid comprising a glycosyl acceptor group and is selected from Ser, Thr, Tyr, Hyl, Hyp, Asn, Arg or phosphoserine (SEP), preferably wherein X3 is Ser; and X1, X2, X4 and X5 are independently selected from any amino acid provided that at least one, preferably at least 2 or 3, of X1, X2, X4 and X5 is a D-amino acid and/or a non-standard amino acid or a non-natural amino acid; or(e) a peptide comprising SEQ ID NO: 11, 12, 13, 14, 15 or 16.
  • 16.-21. (canceled)
  • 22. A method for detecting the presence or absence in a test sample of cleavage activity of a sialidase enzyme, the method comprising: (i) bringing an indicator molecule into contact with the test sample, wherein the indicator molecule comprises (a) a peptide comprising the following sequence:
  • 23.-26. (canceled)
  • 27. The method of claim 22, wherein the binding molecule is selected from: (a) an antibody specific for the de-sialylated form of the peptide comprising SEQ ID NO: 11, 12, 13, 14, 15, or 16, preferably specific for an epitope that is present in the peptide motif Cyc-DAla-Ser[Gal]-DAla-Arg and that is absent or cryptic in the corresponding sialylated peptide motif Cyc-DAla-Ser[Gal-Sial]-DAla-Arg; or(b) an antibody having a heavy chain with 3 CDRs and a light chain with 3 CDRs, wherein the heavy chain CDR1 has SEQ ID NO:1; the heavy chain CDR2 has SEQ ID NO:2; the heavy chain CDR3 has SEQ ID NO:3; the light chain CDR1 has SEQ ID NO: 4; the light chain CDR2 has SEQ ID NO: 5; and the light chain CDR3 has SEQ ID NO: 6, preferably wherein the heavy chain has SEQ ID NO: 7 and/or the light chain has SEQ ID NO: 8.
  • 28. The composition of claim 15 comprising an antibody, wherein the antibody comprises a reporter molecule.
  • 29. The composition of claim 28, wherein the reporter molecule comprises a gold particle.
  • 30. The composition of claim 15 comprising an indicator molecule, wherein the indicator molecule comprises Cyc-DAla-Ser[Gal-Sial]-DAla-Arg.
  • 31. A method for detecting the presence or absence in a test sample of cleavage activity of a sialidase enzyme using the detection device or the enzyme detection kit of claim 1, the method comprising: (i) bringing an indicator molecule into contact with the test sample, wherein the indicator molecule comprises (a) a peptide comprising the following sequence:
Priority Claims (1)
Number Date Country Kind
1812331.5 Jul 2018 GB national
PCT Information
Filing Document Filing Date Country Kind
PCT/GB2019/052101 7/26/2019 WO 00