BISPECIFIC IMMUNE CELL ENGAGERS WITH BINDING SPECIFICITY FOR HLA-G AND ANOTHER ANTIGEN

FIELD

Provided herein are bispecific immune cell engagers with binding specificity for HLA-G and an additional antigen, including pharmaceutical compositions, diagnostic compositions, and kits.

BACKGROUND

A bispecific antibody is a protein that can bind to two different antigens. Bispecific antibodies are widely used in cancer immunotherapy, where bispecific antibodies that function as immune cell engagers are engineered to simultaneously bind a cytotoxic cell and a target like a tumor cell to be killed. For example, the link between T cells and tumor cells causes T cells to exert cytotoxic activity on tumor cells by producing proteins like perforin and granzymes. These proteins enter tumor cells and initiate a cell's apoptosis process.

Bispecific antibodies can direct a host's immune system against cancer cells. For example, a bispecific antibody can be made that binds to CD3 in a T cell and a second antigen on a tumor cell. Bridging T cells and tumor cells and killing tumor cells as a result can induce dramatic regression of malignancies. This can even lead to complete remission in some cases.

Bispecific T-cell engagers (BiTEs) are a class of bispecific antibodies that are particularly useful as anti-cancer compounds. BiTEs and other bispecific immune cell engagers are usually fusion proteins consisting of two different antibodies or amino acid sequences, such as, for example, two different single-chain variable fragments (scFvs). One of the scFvs binds to an activating receptor on immune cells, for example CD3 on T cells, and the other targets a tumor cell via a specific molecule. Bispecific T-cell engagers can thus be used to eliminate target-expressing tumor cells by activated T cells.

Human leukocyte antigen-G (HLA-G) is an immune regulatory molecule that belongs to the non-classical HLA-class I family of receptors and is encoded by the HLA-G gene. HLA-G is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). There are membrane bound and soluble forms of HLA-G.

HLA-G was first identified in placenta samples. HLA-G is normally expressed at the maternal-fetal interface and other immune-privileged sites. HLA-G may play a role in immune tolerance in pregnancy, being expressed in the placenta by extravillous trophoblast cells, while the classical MHC class I genes (HLA-A and HLA-B) are not.

HLA-G has been shown to be immune-suppressive. By binding receptors expressed on various myeloid and lymphoid cells, HLA-G may directly inhibit the functions of NK cells, cytotoxic T-lymphocytes, B cells, neutrophils, monocytes, macrophages, and dendritic cells. HLA-G also inhibits T and NK cell proliferation and cytolytic activities. HLA-G suppresses phagocytosis and induces the generation or expansion of regulatory T cells.

HLA-G mediates immune function through at least three ITIM-containing inhibitory receptors, ILT2, ILT4, and KIR2DL4. On lymphoid cells, for example, HLA-G mediates function through ILT2. On myeloid cells, HLA-G mediates function through ILT2 and ILT4. On decidual NK cells, HLA-G mediates immune function through KIR2DL4 and ILT2.

HLA-G is an immune checkpoint target. HLA-G can directly inhibit immune cell function through receptor binding and/or trogocytosis and impairment of chemotaxis. HLA-G can lend tumor cells a higher invasive and metastatic potential. HLA-G promotes evasion of tumor immune surveillance and enhances metastasis and the progression of malignancies. During tumor progression, HLA-G has other effects, such as inhibition of immune cell cytolysis, induction of immune cell apoptosis, and/or the generation of regulatory cells through receptor binding and/or trogocytosis.

HLA-G is an ideal antigen for a bispecific antibody. HLA-G expression is upregulated on a broad spectrum of tumors and is associated with poor prognosis and disease progression. Serum HLA-G levels are elevated in, for example, without limitation, breast, lung, colorectal cancer (CRC), gastric, esophageal, neuroblastoma, cervical, and hematological cancers. HLA-G has also been found to be correlated with clinical parameters in advanced disease, such as tumor metastasis, poor prognosis, immune escape, and tumor invasiveness.

A bispecific antibody that binds an immune cell, such as a T cell, and HLA-G would be useful. For example, a bispecific T-cell engager that can bind both CD3 and HLA-G would be particularly useful.

SUMMARY

A first aspect provides a bispecific antigen binding construct comprising a binding domain capable of binding to an HLA-G epitope and an additional binding domain capable of binding to a second epitope. In some embodiments, the second epitope comprises or consists of a CD3ε epitope. In some embodiments, the CD3ε epitope comprises or consists of an amino acid sequence set forth in SEQ ID NO: 629.

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises or consists of a heavy chain variable region (VH) and a light chain variable region (VL), with VH and/or VL comprising 1, 2, 3, 4, 5, or 6 of the following:

- a) a VHCDR1 having the sequence set forth in any one of SEQ ID NOS: 346-349 or 354-357,
- b) a VHCDR2 having the sequence set forth in any one of SEQ ID NOS: 362-365 or 371-375,
- c) a VHCDR3 having the sequence set forth in any one of SEQ ID NOS: 379-382,
- d) a VLCDR1 having the sequence set forth in any one of SEQ ID NOS: 388-392,
- e) a VLCDR2 having the sequence set forth in any one of SEQ ID NOS: 396-400, and
- f) a VLCDR3 having the sequence set forth in any one of SEQ ID NOS: 404-408.

In some embodiments, the additional binding domain comprises or consists of an NK cell engager, dendritic cell engager, monocyte, or macrophage engager. In some embodiments, the NK cell engager comprises or consists an antibody for a CD16 epitope. In some embodiments, the NK cell engager comprises or consists of an antibody for NKp46. In some embodiments, the NK cell engager comprises or consists of an antibody for NKp30. In some embodiments, the monocyte or macrophage engager comprises or consists of an antibody for a CD16 epitope.

In some embodiments, the HLA-G epitope comprises or consists of an amino acid sequence set forth in SEQ ID NO: 342. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises or consists of a heavy chain variable region (VH) and a light chain variable region (VL), with VH and/or VL comprising 1, 2, 3, 4, 5, or 6 of the following:

- a) a VHCDR1 having the sequence set forth in any one of SEQ ID NOS: 1-14 or 18-34,
- b) a VHCDR2 having the sequence set forth in any one of SEQ ID NOS: 38-50 or 54-71,
- c) a VHCDR3 having the sequence set forth in any one of SEQ ID NOS: 76-101,
- d) a VLCDR1 having the sequence set forth in any one of SEQ ID NOS: 105-124,
- e) a VLCDR2 having the sequence set forth in any one of SEQ ID NOS: 128-145, and
- f) a VLCDR3 having the sequence set forth in any one of SEQ ID NOS: 149-166.

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a heavy chain variable region (VH) and a light chain variable region (VL), with VH comprising, consisting of, or consisting essentially of a VH having the sequence set forth in SEQ ID NOS: 170-200 and with the VL comprising, consisting of, or consisting essentially of a VL having the sequence set forth in SEQ ID NO: 204-228 and the additional binding domain capable of binding to a CD3ε epitope comprises a heavy chain variable region (VH) and a light chain variable region (VL), with VH comprising, consisting of, or consisting essentially of a VH having the sequence set forth in SEQ ID NOS: 413-418 and with the VL comprising, consisting of, or consisting essentially of a VL having the sequence set forth in SEQ ID NOS: 422-427.

Some embodiments provide a pharmaceutical composition comprising or consisting of any of the bispecific antigen binding constructs provided herein. In some embodiments, the pharmaceutical composition further comprises an effective amount of one or more of:

- a) an anti-PD-L1 antibody or small molecule inhibitor;
- b) an anti-PD-1 antibody or small molecule inhibitor;
- c) an anti-CD38 antibody or small molecule inhibitor;
- d) an anti-CD39 antibody or small molecule inhibitor;
- e) an anti-CD73 antibody or small molecule inhibitor;
- f) an anti-A2A receptor antibody or small molecule inhibitor;
- g) an anti-A2B receptor antibody or small molecule inhibitor;
- h) an anti-A2A/A2B dual receptor antibody or small molecule inhibitor;
- i) an anti-CD47 antibody or small molecule inhibitor;
- j) an anti-CTLA-4 antibody or small molecule inhibitor;
- k) an anti-LAG-3 antibody or small molecule inhibitor;
- l) an anti-TIM-3 antibody or small molecule inhibitor;
- m) an anti-TIGIT antibody or small molecule inhibitor;
- n) an anti-VISTA antibody or small molecule inhibitor;
- o) an anti-CD94 antibody or small molecule inhibitor;
- p) a small molecule inhibitor;
- q) an oncolytic virus;
- r) a chemotherapy;
- s) ADCC capable therapies using effector competent antibodies such as anti-CD19, anti-CD20, anti-EGFR, anti-Her2, anti-SLAMF7, anti-CD52, anti-BCMA, anti-GD2, and/or anti-CCR4.
  
  In some embodiments, the pharmaceutical composition further comprises one or both of:
- a) an antibody to an immune inhibitory receptor or ligand and/or
- b) an antibody to an immune stimulatory receptor or ligand.

A second aspect provides one or more nucleic acids encoding any of the bispecific antigen binding constructs provided herein. In some embodiments, the one or more nucleic acids comprises one or more vectors. Some embodiments provide a host transformed with the one or more vectors.

Some embodiments provide a method for the production of one or more bispecific antigen binding construct comprising the steps of expressing any of the one or more nucleic acids provided herein in a prokaryotic or eukaryotic host cell and recovering the one or more bispecific antigen binding construct from the cell or the cell culture supernatant.

A third aspect provides a method for treating a subject with cancer comprising administering a therapeutically effective amount of any of the bispecific antigen binding constructs or pharmaceutical compositions provided herein to the subject.

In some embodiments, the cancer is a solid cancer. In some embodiments, the cancer is a hematological cancer. In some embodiments, the cancer is selected from the group consisting of a hematopeietic cancer, hepatocellular carcinoma, leukemia, colorectal cancer (CRC), breast cancer, gastric cancer, esophageal cancer, endometrial cancer, prostate cancer, bladder cancer, thyroid cancer, liver cancer, pancreatic cancer, triple negative breast cancer, cervical cancer, ovarian cancer, uterine cancer, vaginal cancer, vulvar cancer, lung cancer, head and neck cancer, melanoma, renal cell carcinoma, cutaneous squamous cell carcinoma, Hodgkin's lymphoma, a metastasis of the brain, a metastasis of the lung, a metastasis of the liver, and/or a metastasis of the bone, or an unresectable or metastatic solid tumor with DNA mismatch repair deficiencies or a microsatellite instability-high state. In some embodiments, the cancer is a cancer that expresses HLA-G.

In some embodiments, the method further comprises one or more of the following:

- a) administering chemotherapy to the subject;
- b) administering radiation therapy to the subject; and/or
- c) administering one or more additional therapeutic agents to the subject.
  
  In some embodiments, the one or more additional therapeutic agents comprise one or more immunomodulatory agents. For example, these agents could be ones that antagonize or block inhibitory signals and interactions. The agents could provide activation signals or costimulation to immune cells.

In some embodiments, the one or more immunomodulatory agents comprise an antagonist to an inhibitory receptor of an immune cell. In some embodiments, the inhibitory receptor is at least one of LILRB1, LILRB2, LILRB4, KIR2DL4, CTLA-4, PD-1, PD-L1, PD-L2, LAG-3, Tim3, TIGIT, B7-H3, B7-H4, neuritin, BTLA, CECAM-1, CECAM-5, VISTA, LAIR1, CD160, 2B4, TGF-B receptor, NKG2A, and/or a Killer-cell immunoglobulin-like receptor (KIR). In some embodiments, the one or more immunomodulatory agents comprise an agonist of a co-stimulatory receptor of an immune cell. In some embodiments, the co-stimulatory receptor is at least one of OX40, CD2, CD27, ICAM-1, LFA-1, ICOS (CD278), 4-1BB (CD137), GITR, CD28, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp30, NKp46, NKp80, CD160, and/or CD83.

In some embodiments, the one or more immunomodulatory agents is one or more cytokines. In some embodiments, the one or more cytokines is at least one of G-CSF, GM-CSF, IFN-alpha, IFN-beta, IFN-gamma, FLt3 ligand, IL-1, IL-2, IL-5, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and/or IL-27.

In some embodiments, the one or more immunomodulatory agents is one or more oncolytic viruses. In some embodiments, the one or more oncolytic viruses is a Herpes simplex virus, a Vesicular stomatitis virus, an adenovirus, a Newcastle disease virus, a vaccinia virus, and/or a maraba virus.

BRIEF DESCRIPTION OF THE DRAWINGS

FIG. 1 shows evaluation of an HLA-G×CD3 bispecific antibody binding to cancer cell lines with engineered (FIG. 1A) or endogenous (FIG. 1B) HLA-G expression. The parental anti-HLA-G monoclonal antibody was included for comparison. Control cell lines lacking HLA-G expression are depicted in grey.

FIG. 2 provides the binding profiles for an HLA-G×CD3 bispecific antibody and the parental anti-CD3 monoclonal antibody to CD4⁺ and CD8⁺ T cells from isolated human peripheral blood mononuclear cells. Representative binding profiles from two individual donors are shown. Isotype controls are depicted with open symbols.

FIG. 3 shows the activity of an HLA-G×CD3 bispecific antibody to induce T cell-dependent cellular cytotoxicity of cancer cell lines with engineered (FIG. 3A) or endogenous (FIG. 3B) HLA-G expression.

DETAILED DESCRIPTION

Provided herein are bispecific immune cell engagers with binding specificity for HLA-G and another antigen, including pharmaceutical compositions, diagnostic compositions, and kits. In particular, heteromultimeric antibodies e.g., full length antibodies or antigen binding fragments thereof, that specifically bind to HLA-G and another antigen, such as CD3, are provided. Compositions comprising such heteromultimeric antibodies, methods for producing and purifying such heterodimeric antibodies, and their use in diagnostics and therapeutics are also provided.

I. Definitions

Unless otherwise defined, all terms of art, notations and other scientific terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a difference over what is generally understood in the art. The techniques and procedures described or referenced herein are generally well understood and commonly employed using conventional methodologies by those skilled in the art, such as, for example, the widely utilized molecular cloning methodologies described in Sambrook et al., Molecular Cloning: A Laboratory Manual 2nd ed. (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. As appropriate, procedures involving the use of commercially available kits and reagents are generally carried out in accordance with manufacturer defined protocols and/or parameters unless otherwise noted.

As used herein, the singular forms “a,” “an,” and “the” include the plural referents unless the context clearly indicates otherwise.

The term “about” indicates and encompasses an indicated value and a range above and below that value. In certain embodiments, the term “about” indicates the designated value ±10%, ±5%, or ±1%. In certain embodiments, the term “about” indicates the designated value ±one standard deviation of that value.

The term “combinations thereof” includes every possible combination of elements to which the term refers.

The terms “HLA-G,” “MHC-G,” and “major histocompatibility complex, class I, G” as well as any terms known to one skilled in the art are used interchangeably herein. HLA-G belongs to the HLA class I heavy chain paralogues. The class I HLA-G molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail.

Unless specified otherwise, the terms include any variants, isoforms, and species homologs of human HLA-G that are naturally expressed by cells, or that are expressed by cells transfected with an HLA-G gene.

The terms “CD3” or “cluster of differentiation 3” as well as any terms known to one skilled in the art are used interchangeably herein. Unless specified otherwise, the terms include any variants, isoforms, and species homologs of human CD3 that are naturally expressed by cells, or that are expressed by cells transfected with a CD3 gene. In some embodiments, CD3 proteins include murine CD3. In some embodiments, CD3 proteins include cynomolgus CD3.

The terms “CD16,” “cluster of differentiation 16,” and “FcγRIII” as well as any terms known to one skilled in the art are used interchangeably herein. Unless specified otherwise, the terms include any variants, isoforms, and species homologs of human CD16 that are naturally expressed by cells, or that are expressed by cells transfected with a CD16 gene. In some embodiments, CD16 proteins include murine CD16. In some embodiments, CD16 proteins include cynomolgus CD16.

The terms “NKp46,” “NCR1,” “natural cytotoxicity triggering receptor 1,” “CD335,” “NKP46,” “NK-p46,” and “LY94” as well as any terms known to one skilled in the art are used interchangeably herein. Unless specified otherwise, the terms include any variants, isoforms, and species homologs of human NKp46 that are naturally expressed by cells, or that are expressed by cells transfected with a NCR1 gene. In some embodiments, NKp46 proteins include murine NKp46. In some embodiments, NKp46 proteins include cynomolgus NKp46.

The terms “NKp30,” “natural cytotoxicity triggering receptor 3,” “CD337,” “cluster of differentiation 337,” as w ell as any terms known to one skilled in the art are used interchangably herein. Unless specified otherwise, the terms include any variants, isoforms, and species homologs of human NKp30 that are naturally expressed by cells, or that are expressed by cells transfected with a NCR1 gene. In some embodiments, NKp30 proteins include murine NKp30. In some embodiments, NKp30 proteins include cynomolgus NKp30.

The term “immunoglobulin” refers to a class of structurally related proteins generally comprising two pairs of polypeptide chains: one pair of light (L) chains and one pair of heavy (H) chains. In an “intact immunoglobulin,” all four of these chains are interconnected by disulfide bonds. The structure of immunoglobulins has been well characterized. See, e.g., Paul, Fundamental Immunology 7th ed., Ch. 5 (2013) Lippincott Williams & Wilkins, Philadelphia, Pa. Briefly, each heavy chain typically comprises a heavy chain variable region (V_H) and a heavy chain constant region (C_H). The heavy chain constant region typically comprises three domains, CH1, CH2, and CH3. Each light chain typically comprises a light chain variable region (VL) and a light chain constant region. The light chain constant region typically comprises one domain, abbreviated CL.

The term “antibody” describes a type of immunoglobulin molecule and is used herein in its broadest sense. An antibody specifically includes intact antibodies (e.g., intact immunoglobulins) and antibody fragments.

The V_Hand V_Lregions may be further subdivided into regions of hypervariability (“hypervariable regions (HVRs);” also called “complementarity determining regions” (CDRs)) interspersed with regions that are more conserved. The more conserved regions are called framework regions (FRs). Each V_Hand V_Lgenerally comprises three CDRs and four FRs, arranged in the following order (from N-terminus to C-terminus): FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4. The CDRs are involved in antigen binding, and confer antigen specificity and binding affinity to the antibody. See Kabat et al., Sequences of Proteins of Immunological Interest 5th ed. (1991) Public Health Service, National Institutes of Health, Bethesda, Md., incorporated by reference in its entirety.

The light chain from any vertebrate species can be assigned to one of two types, called kappa and lambda, based on the sequence of the constant domain.

The heavy chain from any vertebrate species can be assigned to one of five different classes (or isotypes): IgA, IgD, IgE, IgG, and IgM. These classes are also designated α, δ, ε, γ, and μ, respectively. The IgG and IgA classes are further divided into subclasses on the basis of differences in sequence and function. Humans express the following subclasses: IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2.

The amino acid sequence boundaries of a CDR can be determined by one of skill in the art using any of a number of known numbering schemes, including those described by Kabat et al., supra (“Kabat” numbering scheme); Al-Lazikani et al., 1997, J. Mol. Biol., 273:927-948 (“Chothia” numbering scheme); MacCallum et al., 1996, J. Mol. Biol. 262:732-745 (“Contact” numbering scheme); Lefranc et al., Dev. Comp. Immunol., 2003, 27:55-77 (“IMGT” numbering scheme); and Honegge and Plückthun, J. Mol. Biol., 2001, 309:657-70 (“AHo” numbering scheme), each of which is incorporated by reference in its entirety.

Table 1 provides the positions of CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3 as identified by the Kabat and Chothia schemes. For CDR-H1, residue numbering is provided using both the Kabat and Chothia numbering schemes.

Unless otherwise specified, the numbering scheme used for identification of a particular CDR herein is the Kabat numbering scheme. Variant and equivalent antibodies with a Chothia numbering scheme are intended to be within the scope of the invention.

TABLE 1

Residues in CDRs according to Kabat

and Chothia numbering schemes.

CDR
Kabat
Chothia

L1
L24-L34
L24-L34

L2
L50-L56
L50-L56

L3
L89-L97
L89-L97

H1 (Kabat Numbering)
H31-H35B
H26-H32 or H34*

H1 (Chothia Numbering)
H31-H35
H26-H32

H2
H50-H65
H52-H56

H3
H95-H102
H95-H102

*The C-terminus of CDR-H1, when numbered using the Kabat numbering convention, varies between H32 and H34, depending on the length of the CDR.

The “EU numbering scheme” is generally used when referring to a residue in an antibody heavy chain constant region (e.g., as reported in Kabat et al., supra). Unless stated otherwise, the EU numbering scheme is used to refer to residues in antibody heavy chain constant regions described herein.

An “antibody fragment” comprises a portion of an intact antibody, such as the antigen binding or variable region of an intact antibody. Antibody fragments include, for example, Fv fragments, Fab fragments, F(ab′)₂fragments, Fab′ fragments, scFv (sFv) fragments, and scFv-Fc fragments. In some embodiments, an antibody or antigen binding fragment that binds HLA-G and an antibody or antigen binding fragment that binds an additional binding domain, such as CD3, includes antibody fragments of binding domain that binds HLA-G and a binding domain that binds an additional binding domain.

“Fv” fragments comprise a non-covalently linked dimer of one heavy chain variable domain and one light chain variable domain.

“Fab” fragments comprise, in addition to the heavy and light chain variable domains, the constant domain of the light chain and the first constant domain (Cm) of the heavy chain. Fab fragments may be generated, for example, by papain digestion of a full-length antibody.

“F(ab′)₂” fragments contain two Fab′ fragments joined, near the hinge region, by disulfide bonds. F(ab′)₂fragments may be generated, for example, by pepsin digestion of an intact antibody. The F(ab′) fragments can be dissociated, for example, by treatment with β-mercaptoethanol.

“Single-chain Fv” or “sFv” or “scFv” antibody fragments comprise a V_Hdomain and a V_Ldomain in a single polypeptide chain. The V_Hand V_Lare generally linked by a peptide linker. See Plückthun A. (1994). Antibodies from Escherichia coli. In Rosenberg M. & Moore G. P. (Eds.), The Pharmacology of Monoclonal Antibodies vol. 113 (pp. 269-315). Springer-Verlag, New York, incorporated by reference in its entirety. “scFv-Fc” fragments comprise an scFv attached to an Fc domain. For example, an Fc domain may be attached to the C-terminal of the scFv. The Fc domain may follow the V_Hor V_Ldepending on the orientation of the variable domains in the scFv (i.e., V_H-V_Lor V_L-V_H). Any suitable Fc domain known in the art or described herein may be used.

A “minibody” comprises an antibody which features a smaller molecular weight than that of a traditional larger antibody.

The term “monoclonal antibody” refers to an antibody from a population of substantially homogeneous antibodies. A population of substantially homogeneous antibodies comprises antibodies that are substantially similar and that bind the same epitope(s), except for variants that may normally arise during production of the monoclonal antibody. Such variants are generally present in only minor amounts. A monoclonal antibody is typically obtained by a process that includes the selection of a single antibody from a plurality of antibodies. For example, the selection process can be the selection of a unique clone from a plurality of clones, such as a pool of hybridoma clones, phage clones, yeast clones, bacterial clones, or other recombinant DNA clones. The selected antibody can be further altered, for example, to improve affinity for the target (“affinity maturation”), to humanize the antibody, to improve its production in cell culture, and/or to reduce its immunogenicity in a subject.

The term “chimeric antibody” refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.

The term “bispecific antigen binding construct” or “bispecific antibody” or any related term known or used by one skilled in the art describes a type of immunoglobulin that can bind at least two different antigens. For example, without limitation, a bispecific antigen binding construct may bind HLA-G and CD3.

“Humanized” forms of non-human antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody. A humanized antibody is generally a human immunoglobulin (recipient antibody) in which residues from one or more CDRs are replaced by residues from one or more CDRs of a non-human antibody (donor antibody). The donor antibody can be any suitable non-human antibody, such as a mouse, rat, rabbit, chicken, llama, or non-human primate antibody having a desired specificity, affinity, or biological effect. In some instances, selected framework region residues of the recipient antibody are replaced by the corresponding framework region residues from the donor antibody. Humanized antibodies may also comprise residues that are not found in either the recipient antibody or the donor antibody. Such modifications may be made to further refine antibody function. For further details, see Jones et al., Nature, 1986, 321:522-525; Riechmann et al., Nature, 1988, 332:323-329; and Presta, Curr. Op. Struct. Biol., 1992, 2:593-596, each of which is incorporated by reference in its entirety.

A “human antibody” is one which possesses an amino acid sequence corresponding to that of an antibody produced by a human or a human cell, or derived from a non-human source that utilizes a human antibody repertoire or human antibody-encoding sequences (e.g., obtained from human sources or designed de novo). Human antibodies specifically exclude humanized antibodies.

An “isolated antibody” is one that has been separated and/or recovered from a component of its natural environment. Components of the natural environment may include enzymes, hormones, and other proteinaceous or nonproteinaceous materials. In some embodiments, an isolated antibody is purified to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence, for example by use of a spinning cup sequenator. In some embodiments, an isolated antibody is purified to homogeneity by gel electrophoresis (e.g., SDS-PAGE) under reducing or nonreducing conditions, with detection by Coomassie blue or silver stain. An isolated antibody includes an antibody in situ within recombinant cells, since at least one component of the antibody's natural environment is not present. In some embodiments, an isolated antibody is prepared by at least one purification step.

“Affinity” refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K_D). Affinity can be measured by common methods known in the art, including those described herein. Affinity can be determined, for example, using surface plasmon resonance (SPR) technology, such as a Biacore® instrument.

With regard to the binding of an antibody to a target molecule, the terms “binding” or “binds to” a particular antigen (e.g., a polypeptide target) or an epitope on a particular antigen mean binding that is measurably different from a non-selective interaction. Binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule. Binding can also be determined by competition with a control molecule that is similar to the target, such as an excess of non-labeled target. In that case, binding is indicated if the binding of the labeled target to a probe is competitively inhibited by the excess non-labeled target.

The term “k_d” (sec⁻¹), as used herein, refers to the dissociation rate constant of a particular antibody-antigen interaction. This value is also referred to as the k_offvalue.

The term “k_a” (M⁻¹×sec⁻¹), as used herein, refers to the association rate constant of a particular antibody-antigen interaction. This value is also referred to as the k_onvalue.

The term “K_D” (M), as used herein, refers to the dissociation equilibrium constant of a particular antibody-antigen interaction. K_D=k_d/k_a.

The term “K_A” (M⁻¹), as used herein, refers to the association equilibrium constant of a particular antibody-antigen interaction. K_A=k_a/k_d.

Percent “identity” between a polypeptide sequence and a reference sequence is defined as the percentage of amino acid residues in the polypeptide sequence that are identical to the amino acid residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, MEGALIGN (DNASTAR), CLUSTALW, or CLUSTAL OMEGA software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.

A “conservative substitution” or a “conservative amino acid substitution,” refers to the substitution of one or more amino acids with one or more chemically or functionally similar amino acids. Conservative substitution tables providing similar amino acids are well known in the art. Polypeptide sequences having such substitutions are known as “conservatively modified variants.” Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles. By way of example, the following groups of amino acids are considered conservative substitutions for one another.

Acidic Residues
D and E

Basic Residues
K, R, and H

Hydrophilic Uncharged Residues
S, T, N, and Q

Aliphatic Uncharged Residues
G, A, V, L, and I

Non-polar Uncharged Residues
C, M, and P

Aromatic Residues
F, Y, and W

Alcohol Group-Containing Residues
S and T

Aliphatic Residues
I, L, V, and M

Cycloalkenyl-associated Residues
F, H, W, and Y

Hydrophobic Residues
A, C, F, G, H, I, L, M, T, V, W,

and Y

Negatively Charged Residues
D and E

Polar Residues
C, D, E, H, K, N, Q, R, S, and T

Positively Charged Residues
H, K, and R

Small Residues
A, C, D, G, N, P, S, T, and V

Very Small Residues
A, G, and S

Residues Involved in Turn Formation
A, C, D, E, G, H, K, N, Q, R, S,

P, and T

Flexible Residues
Q, T, K, S, G, P, D, E, and R

Group 1
A, S, and T

Group 2
D and E

Group 3
N and Q

Group 4
R and K

Group 5
I, L, and M

Group 6
F, Y, and W

Group A
A and G

Group B
D and E

Group C
N and Q

Group D
R, K, and H

Group E
I, L, M, V

Group F
F, Y, and W

Group G
S and T

Group H
C and M

Additional conservative substitutions may be found, for example, in Creighton, Proteins: Structures and Molecular Properties 2nd ed. (1993) W. H. Freeman & Co., New York, N.Y. An antibody generated by making one or more conservative substitutions of amino acid residues in a parent antibody is referred to as a “conservatively modified variant.”

The term “amino acid” refers to the twenty common naturally occurring amino acids. Naturally occurring amino acids include alanine (Ala; A), arginine (Arg; R), asparagine (Asn; N), aspartic acid (Asp; D), cysteine (Cys; C); glutamic acid (Glu; E), glutamine (Gln; Q), Glycine (Gly; G); histidine (His; H), isoleucine (Ile; I), leucine (Leu; L), lysine (Lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V).

“Treating” or “treatment” of any cancer refers, in certain embodiments, to ameliorating a cancer that exists in a subject. In another embodiment, “treating” or “treatment” includes ameliorating at least one physical parameter, which may be indiscernible by the subject. In yet another embodiment, “treating” or “treatment” includes modulating the cancer, either physically (e.g., stabilization of a discernible symptom) or physiologically (e.g., stabilization of a physical parameter) or both.

As used herein, the term “therapeutically effective amount” or “effective amount” refers to an amount of an antibody or composition that when administered to a subject is effective to treat a cancer. In some embodiments, a therapeutically effective comprises or consists of exemplary doses of each antibody. In some embodiments, a therapeutically effective amount comprises or consists of determining an amount used to achieve a response according to a clinical endpoint. In some embodiments, the clinical endpoint comprises Objective Response Rate (ORR), Progression Free Survival (PFS), and/or Response Evaluation Criteria in Solid Tumors (“RECIST”).

As used herein, the term “subject” means a mammal or a human. In some embodiments subjects include, but are not limited to, monkeys, dogs, cats, mice, rats, cows, horses, camels, avians, goats, and sheep.

In some embodiments, the binding domain comprises a light chain. In some aspects, the light chain is a kappa light chain. In some embodiments, the light chain is a lambda light chain.

In some embodiments, the binding domain comprises a heavy chain. In some embodiments, the heavy chain is an IgA. In some embodiments, the heavy chain is an IgD. In some embodiments, the heavy chain is an IgE. In some embodiments, the heavy chain is an IgG. In some embodiments, the heavy chain is an IgM. In some embodiments, the heavy chain is an IgG1. In some embodiments, the heavy chain is an IgG2. In some embodiments, the heavy chain is an IgG3. In some embodiments, the heavy chain is an IgG4. In some embodiments, the heavy chain is an IgA1. In some embodiments, the heavy chain is an IgA2.

In some embodiments, the binding domain is an antibody fragment. In some embodiments, the antibody fragment is an Fv fragment. In some embodiments, the antibody fragment is a Fab fragment. In some embodiments, the antibody fragment is a F(ab′)2 fragment. In some embodiments, the antibody fragment is a Fab′ fragment. In some embodiments, the antibody fragment is an scFv (sFv) fragment. In some embodiments, the antibody fragment is an scFv-Fc fragment. In some embodiments, the antibody fragment is a minibody. In some embodiments, the antibody fragment is a single domain antibody.

In some embodiments, the binding domain is a chimeric antibody. In some embodiments, the binding domain is a humanized antibody. In some embodiments, the binding domain is a human antibody.

In some embodiments, the binding domain is an affinity matured antibody. In some embodiments, the binding domain is an affinity matured antibody derived from an illustrative sequence provided in this disclosure.

Binding Domains Capable of Binding to HLA-G

In some embodiments, the HLA-G epitope comprises or consists of an amino acid sequence set forth in SEQ ID NO: 342.

V_HSequences Comprising Illustrative CDRs

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising one or more CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-H sequences provided in this disclosure, and variants thereof.

V_HSequences Comprising Illustrative Kabat CDRs

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising one or more Kabat CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Kabat CDR-H sequences provided in this disclosure, and variants thereof.

Kabat CDR-H3

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 76. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 77. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 78. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 79. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 80. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 81. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 82. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 83. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 84. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 85. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 86. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 87. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 88. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 89. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 90. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 91. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 92. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 94. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 95. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 96. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 97. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 98. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 99. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 100. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 101.

In some embodiments, the CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H3 sequence provided in this disclosure. In some embodiments, the CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H3 sequences provided in this disclosure. In some embodiments, the CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some embodiments, the amino acid substitutions are conservative amino acid substitutions.

Kabat CDR-H2

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 54-71. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 54. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 55. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 56. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 57. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 58. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 59. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 60. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 61. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 62. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 63. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 64. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 65. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 66. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 67. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 68. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 69. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 70. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 71.

Kabat CDR-H1

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 18-34. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 18. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 19. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 20. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 21. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 22. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 23. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 24. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 25. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 26. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 27. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 28. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 29. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 30. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 31. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 32. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 33. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 34.

Kabat CDR-H3+Kabat CDR-H2

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101, and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 54-71. In some embodiments, the Kabat CDR-H3 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H3 and Kabat CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 170-200.

Kabat CDR-H3+Kabat CDR-H1

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101, and a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 18-34. In some embodiments, the Kabat CDR-H3 sequence and the Kabat CDR-H1 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H3 and Kabat CDR-H1 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 170-200.

Kabat CDR-H1+Kabat CDR-H2

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 18-34 and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 54-71. In some embodiments, the Kabat CDR-H1 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H1 and Kabat CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 170-200.

Kabat CDR-H1+Kabat CDR-H2+Kabat CDR-H3

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 18-34, a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 54-71, and a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101. In some embodiments, the Kabat CDR-H1 sequence, Kabat CDR-H2 sequence, and Kabat CDR-H3 sequence are all from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H1, Kabat CDR-H2, and Kabat CDR-H3 are all from a single illustrative V_Hsequence selected from SEQ ID NOS: 170-200.

Variants of V_HSequences Comprising Illustrative Kabat CDRs

In some embodiments, the V_Hsequences provided herein comprise a variant of an illustrative Kabat CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.

In some embodiments, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H3 sequence provided in this disclosure. In some embodiments, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H3 sequences provided in this disclosure. In some embodiments, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some embodiments, the amino acid substitutions are conservative amino acid substitutions.

In some embodiments, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H2 sequence provided in this disclosure. In some embodiments, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H2 sequences provided in this disclosure. In some embodiments, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some embodiments, the amino acid substitutions are conservative amino acid substitutions.

In some embodiments, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H1 sequence provided in this disclosure. In some embodiments, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H1 sequences provided in this disclosure. In some embodiments, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some embodiments, the amino acid substitutions are conservative amino acid substitutions.

V_HSequences Comprising Illustrative Chothia CDRs

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising one or more Chothia CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Chothia CDR-H sequences provided in this disclosure, and variants thereof.

Chothia CDR-H3

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 76. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 77. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 78. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 79. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 80. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 81. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 82. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 83. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 84. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 85. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 86. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 87. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 88. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 89. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 90. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 91. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 92. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 93. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 94. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 95. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 96. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 97. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 98. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 99. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 100. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 101.

Chothia CDR-H2

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 38-50. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 38. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 39. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 40. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 41. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 42. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 43. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 44. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 45. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 46. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 47. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 48. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 49. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 50.

Chothia CDR-H1

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 1-14. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 1. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 2. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 3. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 4. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 5. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 6. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 7. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 8. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 9. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 10. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 11. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 12. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 13. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 14.

Chothia CDR-H3+Chothia CDR-H2

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101, and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 38-50. In some embodiments, the Chothia CDR-H3 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H3 and Chothia CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 170-200.

Chothia CDR-H3+Chothia CDR-H1

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101, and a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 1-14. In some embodiments, the Chothia CDR-H3 sequence and the Chothia CDR-H1 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H3 and Chothia CDR-H1 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 170-200.

Chothia CDR-H1+Chothia CDR-H2

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 1-14 and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 38-50. In some embodiments, the Chothia CDR-H1 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H1 and Chothia CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 170-200.

Chothia CDR-H1+Chothia CDR-H2+Chothia CDR-H3

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 1-14, a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 38-50, and a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101. In some embodiments, the Chothia CDR-H1 sequence, Chothia CDR-H2 sequence, and Chothia CDR-H3 sequence are all from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H1, Chothia CDR-H2, and Chothia CDR-H3 are all from a single illustrative V_Hsequence selected from SEQ ID NOS: 170-200.

Variants of V_HSequences Comprising Illustrative Chothia CDRs

In some embodiments, the V_Hsequences provided herein comprise a variant of an illustrative Chothia CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.

In some embodiments, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H3 sequence provided in this disclosure. In some embodiments, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H3 sequences provided in this disclosure. In some embodiments, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some embodiments, the amino acid substitutions are conservative amino acid substitutions.

In some embodiments, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H2 sequence provided in this disclosure. In some embodiments, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H2 sequences provided in this disclosure. In some embodiments, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some embodiments, the amino acid substitutions are conservative amino acid substitutions.

In some embodiments, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H1 sequence provided in this disclosure. In some embodiments, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H1 sequences provided in this disclosure. In some embodiments, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some embodiments, the amino acid substitutions are conservative amino acid substitutions.

V_HSequences

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 170-200. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 170. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 171. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 172. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 173. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 174. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 175. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 176. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 177. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 178. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 179. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 180. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 181. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 182. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 183. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 184. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 185. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 186. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 187. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 188. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 189. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 190. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 191. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 192. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 193. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 194. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 195. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 196. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 197. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 198. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 199. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 200.

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises three heavy chain CDRs each comprising, consisting of, or consisting essentially of a CDR sequence of a V_Hhaving the sequence set forth in one of SEQ ID NOS: 170-200.

Variants of V_HSequences

In some embodiments, the V_Hsequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V_Hsequence provided in this disclosure.

In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of a variant of an illustrative V_Hsequence provided in this disclosure. In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of the illustrative V_Hsequences provided in this disclosure.

In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of any of the illustrative V_Hsequences provided in this disclosure, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some embodiments, the amino acid substitutions are conservative amino acid substitutions.

CDR-L3 Sequences

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 150. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 151. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 152. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 153. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 154. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 155. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 156. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 157. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 158. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 159. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 160. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 161. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 162. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 163. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 164. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 165. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 166.

In some embodiments, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some embodiments, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some embodiments, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some embodiments, the amino acid substitutions are conservative amino acid substitutions.

V_LSequences Comprising Illustrative CDRs

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising one or more CDR-L sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-L sequences provided in this disclosure, and variants thereof.

CDR-L3

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 150. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 151. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 152. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 153. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 154. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 155. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 156. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 157. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 158. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 159. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 160. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 161. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 162. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 163. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 164. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 165. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 166.

CDR-L2

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 128-145. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 128. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 129. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 130. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 131. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 132. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 133. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 134. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 135. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 136. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 137. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 138. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 139. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 140. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 141. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 142. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 143. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 144. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 145.

CDR-L1

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 105-124. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 105. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 106. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 107. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 108. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 109. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 110. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 111. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 112. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 113. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 114. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 115. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 116. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 117. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 118. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 119. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 120. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 121. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 122. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 123. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 124.

CDR-L3+CDR-L2

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 128-145. In some embodiments, the CDR-L3 sequence and the CDR-L2 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L3 and CDR-L2 are both from a single illustrative V_Lsequence selected from SEQ ID NOS: 204-228.

CDR-L3+CDR-L1

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166 and a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 105-124. In some embodiments, the CDR-L3 sequence and the CDR-L1 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L3 and CDR-L1 are both from a single illustrative V_Lsequence selected from SEQ ID NOS: 204-228.

CDR-L1+CDR-L2

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 105-124 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 128-145. In some embodiments, the CDR-L1 sequence and the CDR-L2 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L1 and CDR-L2 are both from a single illustrative V_Lsequence selected from SEQ ID NOS: 204-228.

CDR-L1+CDR-L2+CDR-L3

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 105-124, a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 128-145, and a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L1 sequence, CDR-L2 sequence, and CDR-L3 sequence are all from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L1, CDR-L2, and CDR-L3 are all from a single illustrative V_Lsequence selected from SEQ ID NOS: 204-228.

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 106, a CDR-L2 sequence comprising SEQ ID NO: 129, and a CDR-L3 sequence SEQ ID NO: 150. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 151. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 108, a CDR-L2 sequence comprising SEQ ID NO: 130, and a CDR-L3 sequence SEQ ID NO: 151. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 109, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 152. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 153. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 151. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 133, and a CDR-L3 sequence SEQ ID NO: 151. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 112, a CDR-L2 sequence comprising SEQ ID NO: 134, and a CDR-L3 sequence SEQ ID NO: 155. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 113, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 156. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 114, a CDR-L2 sequence comprising SEQ ID NO: 136, and a CDR-L3 sequence SEQ ID NO: 157. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 157. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 116, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 155. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 117, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 155. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 158. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 155. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 119, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence SEQ ID NO: 159. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 140, and a CDR-L3 sequence SEQ ID NO: 160. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 141, and a CDR-L3 sequence SEQ ID NO: 161. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 122, a CDR-L2 sequence comprising SEQ ID NO: 142, and a CDR-L3 sequence SEQ ID NO: 162. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 163. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 164. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 123, a CDR-L2 sequence comprising SEQ ID NO: 144, and a CDR-L3 sequence SEQ ID NO: 165. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 124, a CDR-L2 sequence comprising SEQ ID NO: 145, and a CDR-L3 sequence SEQ ID NO: 166.

Variants of V_LSequences Comprising Illustrative CDR-Ls

In some embodiments, the V_Lsequences provided herein comprise a variant of an illustrative CDR-L3, CDR-L2, and/or CDR-L1 sequence provided in this disclosure.

In some embodiments, the CDR-L2 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L2 sequence provided in this disclosure. In some embodiments, the CDR-L2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L2 sequences provided in this disclosure. In some embodiments, the CDR-L2 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some embodiments, the amino acid substitutions are conservative amino acid substitutions.

In some embodiments, the CDR-L1 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L1 sequence provided in this disclosure. In some embodiments, the CDR-L1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L1 sequences provided in this disclosure. In some embodiments, the CDR-L1 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some embodiments, the amino acid substitutions are conservative amino acid substitutions.

V_LSequences

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 204-228. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 204. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 205. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 206. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 207. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 208. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 209. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 210. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 211. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 212. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 213. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 214. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 215. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 216. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 217. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 218. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 219. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 220. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 221. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 222. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 223. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 224. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 225. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 226. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 227. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 228.

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises three light chain CDRs, each comprising, consisting of, or consisting essentially of a CDR sequence of a VL having the sequence set forth in one of SEQ ID NO: 204-228.

Variants of V_LSequences

In some embodiments, the V_Lsequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V_Lsequence provided in this disclosure.

In some embodiments, the V_Lsequence comprises, consists of, or consists essentially of a variant of an illustrative V_Lsequence provided in this disclosure. In some embodiments, the V_Lsequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.05% identity with any of the illustrative V_Lsequences provided in this disclosure.

In some embodiments, the V_Lsequence comprises, consists of, or consists essentially of any of the illustrative V_Lsequences provided in this disclosure, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some embodiments, the amino acid substitutions are conservative amino acid substitutions.

Pairs
CDR-H3-CDR-L3 Pairs

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a CDR-H3 sequence and a CDR-L3 sequence. In some embodiments, the CDR-H3 sequence is part of a V_Hand the CDR-L3 sequence is part of a V_L.

In some embodiments, the CDR-H3 sequence is a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 76-101, and the CDR-L3 sequence is a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 149-166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 76 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 77 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 160. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 161. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 162. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 78 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 79 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 160. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 161. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 162. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 80 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 81 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 160. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 161. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 162. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 82 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 83 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 160. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 161. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 162. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 84 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 85 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 160. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 161. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 162. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 86 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 87 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 160. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 161. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 162. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 88 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 89 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 160. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 161. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 162. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 90 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 91 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 160. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 161. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 162. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 92 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 93 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 160. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 161. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 162. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 94 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 95 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 160. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 161. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 162. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 96 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 97 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 160. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 161. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 162. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 98 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 99 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 160. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 161. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 162. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 100 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 160. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 161. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 162. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 101 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 149. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 150. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 151. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 152. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 153. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 154. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 155. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 156. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 157. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 158. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 159. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 160. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 161. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 162. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 163. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 164. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 165. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 166.

1.1.1.1. Variants of CDR-H3-CDR-L3 Pairs

In some embodiments, the CDR-H3-CDR-L3 pairs provided herein comprise a variant of an illustrative CDR-H3 and/or CDR-L1 sequence provided in this disclosure.

V_H-V_LPairs

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence and/or a V_Lsequence.

In some embodiments, the V_Hsequence is a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 170-200 and the V_Lsequence is a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 204-228.

In some embodiments, the V_Hsequence is SEQ ID NO: 170 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 171 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 172 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 173 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 174 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 175 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 176 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 177 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 178 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 179 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 180 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 181 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 182 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 183 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 184 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 185 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 186 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 187 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 188 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 189 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 190 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 191 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 192 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 193 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 194 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 195 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 196 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 197 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 198 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 199 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the V_Hsequence is SEQ ID NO: 200 and the V_Lsequence is selected from SEQ ID NOS: 204-228. In some embodiments, the V_Lsequence is SEQ ID NO: 204. In some embodiments, the V_Lsequence is SEQ ID NO: 205. In some embodiments, the V_Lsequence is SEQ ID NO: 206. In some embodiments, the V_Lsequence is SEQ ID NO: 207. In some embodiments, the V_Lsequence is SEQ ID NO: 208. In some embodiments, the V_Lsequence is SEQ ID NO: 209. In some embodiments, the V_Lsequence is SEQ ID NO: 210. In some embodiments, the V_Lsequence is SEQ ID NO: 211. In some embodiments, the V_Lsequence is SEQ ID NO: 212. In some embodiments, the V_Lsequence is SEQ ID NO: 213. In some embodiments, the V_Lsequence is SEQ ID NO: 214. In some embodiments, the V_Lsequence is SEQ ID NO: 215. In some embodiments, the V_Lsequence is SEQ ID NO: 216. In some embodiments, the V_Lsequence is SEQ ID NO: 217. In some embodiments, the V_Lsequence is SEQ ID NO: 218. In some embodiments, the V_Lsequence is SEQ ID NO: 219. In some embodiments, the V_Lsequence is SEQ ID NO: 220. In some embodiments, the V_Lsequence is SEQ ID NO: 221. In some embodiments, the V_Lsequence is SEQ ID NO: 222. In some embodiments, the V_Lsequence is SEQ ID NO: 223. In some embodiments, the V_Lsequence is SEQ ID NO: 224. In some embodiments, the V_Lsequence is SEQ ID NO: 225. In some embodiments, the V_Lsequence is SEQ ID NO: 226. In some embodiments, the V_Lsequence is SEQ ID NO: 227. In some embodiments, the V_Lsequence is SEQ ID NO: 228.

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises three heavy chain CDRs and three light chain CDRs, each comprising, consisting of, or consisting essentially of a CDR sequence of a VH-VL pair set forth above. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises three heavy chain CDRs and three light chain CDRs, each comprising, consisting of, or consisting essentially of a CDR sequence of a VH-VL pair set forth in Table S.

CDR-H1+CDR-H2+CDR-H3+CDR-L1+CDR-L2+CDR-L3

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 18, a Kabat CDR-H2 sequence comprising SEQ ID NO: 54, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 19, a Kabat CDR-H2 sequence comprising SEQ ID NO: 55, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 77 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 20, a Kabat CDR-H2 sequence comprising SEQ ID NO: 56, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 78 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 79 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 22, a Kabat CDR-H2 sequence comprising SEQ ID NO: 58, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 80 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 106, a CDR-L2 sequence comprising SEQ ID NO: 129, and a CDR-L3 sequence SEQ ID NO: 150. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 151. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 60, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 81 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 108, a CDR-L2 sequence comprising SEQ ID NO: 130, and a CDR-L3 sequence SEQ ID NO: 151. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 109, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 152. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO:153. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 81 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 151. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 83 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 133, and a CDR-L3 sequence SEQ ID NO: 151. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 84 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 85 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 86 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 62, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 112, a CDR-L2 sequence comprising SEQ ID NO: 134, and a CDR-L3 sequence SEQ ID NO: 155. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 88 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 113, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 156. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 89 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 114, a CDR-L2 sequence comprising SEQ ID NO: 136, and a CDR-L3 sequence SEQ ID NO: 157. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 90 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 157. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 27, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 90 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 116, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 155. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 28, a Kabat CDR-H2 sequence comprising SEQ ID NO: 62, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 91 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 117, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 155. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 29, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 92 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 158. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 93 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 155. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 66, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 94 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 119, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence SEQ ID NO: 159. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 31, a Kabat CDR-H2 sequence comprising SEQ ID NO: 67, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 95 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 140, and a CDR-L3 sequence SEQ ID NO: 160. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 32, a Kabat CDR-H2 sequence comprising SEQ ID NO: 68, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 96 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 141, and a CDR-L3 sequence SEQ ID NO: 161. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 33, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 97 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 122, a CDR-L2 sequence comprising SEQ ID NO: 142, and a CDR-L3 sequence SEQ ID NO: 162. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 34, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 98 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 163. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 18, a Kabat CDR-H2 sequence comprising SEQ ID NO: 54, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 99 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 164. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 31, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 100 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 123, a CDR-L2 sequence comprising SEQ ID NO: 144, and a CDR-L3 sequence SEQ ID NO: 165. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 101 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 124, a CDR-L2 sequence comprising SEQ ID NO: 145, and a CDR-L3 sequence SEQ ID NO: 166.

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 38, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 39, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 77 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 40, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 78 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 79 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 4, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 80 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 106, a CDR-L2 sequence comprising SEQ ID NO: 129, and a CDR-L3 sequence SEQ ID NO: 150. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 151. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 43, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 81 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 108, a CDR-L2 sequence comprising SEQ ID NO: 130, and a CDR-L3 sequence SEQ ID NO: 151. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 109, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 152. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 5, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 153. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 81 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 151. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 83 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 133, and a CDR-L3 sequence SEQ ID NO: 151. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 84 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 85 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 86 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 45, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 112, a CDR-L2 sequence comprising SEQ ID NO: 134, and a CDR-L3 sequence SEQ ID NO: 155. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 88 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 113, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 156. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 89 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 114, a CDR-L2 sequence comprising SEQ ID NO: 136, and a CDR-L3 sequence SEQ ID NO: 157. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 90 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 157. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 9, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 90 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 116, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 155. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 45, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 91 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 117, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 155. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 92 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 158. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 93 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 155. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 94 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 119, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence SEQ ID NO: 159. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 11, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 95 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 140, and a CDR-L3 sequence SEQ ID NO: 160. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 12, a Chothia CDR-H2 sequence comprising SEQ ID NO: 48, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 96 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 141, and a CDR-L3 sequence SEQ ID NO: 161. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 13, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 97 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 122, a CDR-L2 sequence comprising SEQ ID NO: 142, and a CDR-L3 sequence SEQ ID NO: 162. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 14, a Chothia CDR-H2 sequence comprising SEQ ID NO: 49, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 98 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 163. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 38, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 99 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 164. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 11, a Chothia CDR-H2 sequence comprising SEQ ID NO: 50, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 100 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 123, a CDR-L2 sequence comprising SEQ ID NO: 144, and a CDR-L3 sequence SEQ ID NO: 165. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 101 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 124, a CDR-L2 sequence comprising SEQ ID NO: 145, and a CDR-L3 sequence SEQ ID NO: 166.

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises three heavy chain CDRs and three light chain CDRs, each comprising, consisting of, or consisting essentially of a CDR sequence of a VH-VL pair, with the VH having the sequence set forth in one of SEQ ID NOS: 170-200 and with the VL having the sequence set forth in one of SEQ ID NOS: 204-228.

Variants of V_H-V_LPairs

In some embodiments, the V_H-V_Lpairs provided herein comprise a variant of an illustrative V_Hand/or V_Lsequence provided in this disclosure.

In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of a variant of an illustrative V_Hsequence provided in this disclosure. In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.1% identity with any of the illustrative V_Hsequences provided in this disclosure.

HC+LC

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises or consists of one or more heavy chains consisting of an HC sequence and one or more light chains consisting of an LC sequence. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises or consists of two identical heavy chains consisting of an HC sequence and two identical light chains consisting of an LC sequence.

In some embodiments, the HC sequence is an HC sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 232-262 and the LC sequence is an LC sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 300-330. In some embodiments, the HC sequence is an HC sequence consisting of a sequence selected from SEQ ID NOS: 232-262 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the HC sequence is an HC sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 266-296 and the LC sequence is an LC sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 300-330. In some embodiments, the HC sequence is an HC sequence consisting of a sequence selected from SEQ ID NOS: 266-296 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 232 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 233 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 234 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 235 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 236 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 237 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 238 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 239 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 240 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 241 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 242 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 243 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 244 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 245 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 246 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 247 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 248 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 249 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 250 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 251 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 252 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 253 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 254 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 255 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 256 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 257 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 258 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 259 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 260 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 261 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 262 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 266 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 267 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 268 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 269 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 270 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 271 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 272 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 273 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 274 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 275 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 276 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 277 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 278 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 279 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 280 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 281 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 282 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 283 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 284 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 285 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 286 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 287 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 288 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 289 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 290 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 291 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 292 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 293 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 294 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 295 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 296 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the LC sequence is SEQ ID NO: 300. In some embodiments, the LC sequence is SEQ ID NO: 301. In some embodiments, the LC sequence is SEQ ID NO: 302. In some embodiments, the LC sequence is SEQ ID NO: 303. In some embodiments, the LC sequence is SEQ ID NO: 304. In some embodiments, the LC sequence is SEQ ID NO: 305. In some embodiments, the LC sequence is SEQ ID NO: 306. In some embodiments, the LC sequence is SEQ ID NO: 307. In some embodiments, the LC sequence is SEQ ID NO: 308. In some embodiments, the LC sequence is SEQ ID NO: 309. In some embodiments, the LC sequence is SEQ ID NO: 310. In some embodiments, the LC sequence is SEQ ID NO: 311. In some embodiments, the LC sequence is SEQ ID NO: 312. In some embodiments, the LC sequence is SEQ ID NO: 313. In some embodiments, the LC sequence is SEQ ID NO: 314. In some embodiments, the LC sequence is SEQ ID NO: 315. In some embodiments, the LC sequence is SEQ ID NO: 316. In some embodiments, the LC sequence is SEQ ID NO: 317. In some embodiments, the LC sequence is SEQ ID NO: 318. In some embodiments, the LC sequence is SEQ ID NO: 319. In some embodiments, the LC sequence is SEQ ID NO: 320. In some embodiments, the LC sequence is SEQ ID NO: 321. In some embodiments, the LC sequence is SEQ ID NO: 322. In some embodiments, the LC sequence is SEQ ID NO: 323. In some embodiments, the LC sequence is SEQ ID NO: 324. In some embodiments, the LC sequence is SEQ ID NO: 325. In some embodiments, the LC sequence is SEQ ID NO: 326. In some embodiments, the LC sequence is SEQ ID NO: 327. In some embodiments, the LC sequence is SEQ ID NO: 328. In some embodiments, the LC sequence is SEQ ID NO: 329. In some embodiments, the LC sequence is SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 232 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 300. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 233 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 301. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 234 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 302. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 235 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 303. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 236 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 304. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 237 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 305. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 238 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 306. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 239 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 307. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 240 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 308. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 241 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 309. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 242 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 310. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 243 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 311. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 244 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 312. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 245 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 313. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 246 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 314. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 247 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 315. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 248 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 316. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 249 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 317. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 250 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 318. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 251 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 319. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 252 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 320. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 253 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 321. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 254 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 322. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 255 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 323. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 256 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 324. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 257 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 325. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 258 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 326. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 259 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 327. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 260 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 328. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 261 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 329. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 262 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 330.

In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 266 and the LC sequence is an LC sequence consisting of a sequence SEQ ID NO: 300. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 267 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 301. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 268 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 302. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 269 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 303. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 270 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 304. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 271 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 305. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 272 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 306. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 273 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 307. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 274 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 308. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 275 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 309. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 276 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 310. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 277 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 311. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 278 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 312. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 279 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 313. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 280 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 314. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 281 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 315. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 282 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 316. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 283 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 317. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 284 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 318. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 285 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 319. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 286 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 320. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 287 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 321. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 288 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 322. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 289 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 323. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 290 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 324. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 291 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 325. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 292 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 326. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 293 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 327. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 294 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 328. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 295 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 329. In some embodiments, the HC sequence is an HC sequence consisting of SEQ ID NO: 296 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 330.

In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises three heavy chain CDRs and three light chain CDRs, each comprising, consisting of, or consisting essentially of a CDR sequence of a HC-LC pair set forth above. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises three heavy chain CDRs and three light chain CDRs, each comprising, consisting of, or consisting essentially of a CDR sequence of a HC-LC pair set forth in Table S.

Binding Domains Capable of Binding to CD3

In some embodiments, the second epitope comprises a CD3ε epitope. In some embodiments, the CD3ε epitope comprises or consists of an amino acid sequence set forth in SEQ ID NO: 629.

CD3 is a protein complex and T cell co-receptor that is involved in activating the cytotoxic T cell (CD8⁺ T cells), T helper cells (CD4⁺ T cells) and natural killer T cells (NKT cells).” CD3 is composed of four distinct chains. In mammals, the complex contains a CD3γ chain, a CD3δ chain, and two CD3ε chains. These chains associate with the T-cell receptor (TCR) and the ζ-chain (zeta-chain) to generate an activation signal in T lymphocytes. The TCR, ζ-chain, and CD3 molecules together constitute the TCR complex.

The CD3γ, CD3δ, and CD3ε chains are highly related cell-surface proteins of the immunoglobulin superfamily containing a single extracellular immunoglobulin domain. The intracellular tails of the CD3γ, CD3ε, and CD3δ molecules each contain a single conserved motif known as an immunoreceptor tyrosine-based activation motif or ITAM for short, which is essential for the signaling capacity of the TCR. The intracellular tail of CD3ζ contains 3 ITAM motifs. Phosphorylation of the ITAM on CD3 renders the CD3 chain capable of binding an enzyme called ZAP70 (zeta associated protein), a kinase that is important in the signaling cascade of the T cell. In some embodiments, CD3 proteins include murine CD3. In some embodiments, CD3 proteins include cynomolgus CD3.

CDR-H3 Sequences

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 379-382. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 379.

V_HSequences Comprising Illustrative CDRs

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising one or more CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-H sequences provided in this disclosure, and variants thereof.

V_HSequences Comprising Illustrative Kabat CDRs

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising one or more Kabat CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Kabat CDR-H sequences provided in this disclosure, and variants thereof.

Kabat CDR-H3

Kabat CDR-H2

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 371-375. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 371.

Kabat CDR-H1

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 354-357. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 354.

Kabat CDR-H3+Kabat CDR-H2

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 379-382, and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 371-375. In some embodiments, the Kabat CDR-H3 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H3 and Kabat CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 413-418.

Kabat CDR-H3+Kabat CDR-H1

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 379-382, and a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 354-357. In some embodiments, the Kabat CDR-H3 sequence and the Kabat CDR-H1 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H3 and Kabat CDR-H1 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 413-418.

Kabat CDR-H1+Kabat CDR-H2

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 354-357 and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 371-375. In some embodiments, the Kabat CDR-H1 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H1 and Kabat CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 413-418.

Kabat CDR-H1+Kabat CDR-H2+Kabat CDR-H3

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 354-357, a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 371-375, and a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 379-382. In some embodiments, the Kabat CDR-H1 sequence, Kabat CDR-H2 sequence, and Kabat CDR-H3 sequence are all from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H1, Kabat CDR-H2, and Kabat CDR-H3 are all from a single illustrative V_Hsequence selected from SEQ ID NOS: 413-418.

Variants of V_HSequences Comprising Illustrative Kabat CDRs

In some embodiments, the V_Hsequences provided herein comprise a variant of an illustrative Kabat CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.

V_HSequences Comprising Illustrative Chothia CDRs

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising one or more Chothia CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Chothia CDR-H sequences provided in this disclosure, and variants thereof.

Chothia CDR-H3

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 379-382. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 413-418. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 379.

Chothia CDR-H2

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 362-365. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 413-418. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 362.

Chothia CDR-H1

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 346-349. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 413-418. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 346.

Chothia CDR-H3+Chothia CDR-H2

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 379-382, and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 362-365. In some embodiments, the Chothia CDR-H3 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H3 and Chothia CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 413-418.

Chothia CDR-H3+Chothia CDR-H1

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 379-382, and a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 346-349. In some embodiments, the Chothia CDR-H3 sequence and the Chothia CDR-H1 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H3 and Chothia CDR-H1 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 413-418.

Chothia CDR-H1+Chothia CDR-H2

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 346-349 and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 362-365. In some embodiments, the Chothia CDR-H1 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H1 and Chothia CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 413-418.

Chothia CDR-H1+Chothia CDR-H2+Chothia CDR-H3

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 346-349, a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 362-365, and a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 379-382. In some embodiments, the Chothia CDR-H1 sequence, Chothia CDR-H2 sequence, and Chothia CDR-H3 sequence are all from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H1, Chothia CDR-H2, and Chothia CDR-H3 are all from a single illustrative V_Hsequence selected from SEQ ID NOS: 413-418.

Variants of V_HSequences Comprising Illustrative Chothia CDRs

In some embodiments, the V_Hsequences provided herein comprise a variant of an illustrative Chothia CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.

V_HSequences

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 413-418. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 413. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 414. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 415. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 416. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 417. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 418.

In some embodiments, the binding domain capable of binding to a CD3ε epitope comprises three heavy chain CDRs each comprising, consisting of, or consisting essentially of a CDR sequence of a VH having the sequence set forth in one of SEQ ID NOS: 413-418.

Variants of V_HSequences

In some embodiments, the V_Hsequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V_Hsequence provided in this disclosure.

CDR-L3 Sequences

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 404-408. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 404.

V_LSequences Comprising Illustrative CDRs

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising one or more CDR-L sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-L sequences provided in this disclosure, and variants thereof.

CDR-L3

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 404-408. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 404.

CDR-L2

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 396-400. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 396.

CDR-L1

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 388-392. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 388.

CDR-L3+CDR-L2

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 404-408 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 396-400. In some embodiments, the CDR-L3 sequence and the CDR-L2 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L3 and CDR-L2 are both from a single illustrative V_Lsequence selected from SEQ ID NOS: 422-427.

CDR-L3+CDR-L1

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 404-408 and a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 388-392. In some embodiments, the CDR-L3 sequence and the CDR-L1 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L3 and CDR-L1 are both from a single illustrative V_Lsequence selected from SEQ ID NOS: 422-427.

CDR-L1+CDR-L2

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 388-392 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 396-400. In some embodiments, the CDR-L1 sequence and the CDR-L2 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L1 and CDR-L2 are both from a single illustrative V_Lsequence selected from SEQ ID NOS: 422-427.

CDR-L1+CDR-L2+CDR-L3

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 388-392, a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 396-400, and a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 404-408. In some embodiments, the CDR-L1 sequence, CDR-L2 sequence, and CDR-L3 sequence are all from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L1, CDR-L2, and CDR-L3 are all from a single illustrative V_Lsequence selected from SEQ ID NOS: 422-427.

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 388, a CDR-L2 sequence comprising SEQ ID NO: 396, and a CDR-L3 sequence SEQ ID NO: 404.

Variants of V_LSequences Comprising Illustrative CDR-Ls

In some embodiments, the V_Lsequences provided herein comprise a variant of an illustrative CDR-L3, CDR-L2, and/or CDR-L1 sequence provided in this disclosure.

V_LSequences

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 422-427. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 422. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 423. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 424. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 425. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 426. In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 427.

In some embodiments, the binding domain capable of binding to a CD3ε epitope comprises three light chain CDRs, each comprising, consisting of, or consisting essentially of a CDR sequence of a VL having the sequence set forth in one of SEQ ID NO: 422-427.

Variants of V_LSequences

In some embodiments, the V_Lsequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V_Lsequence provided in this disclosure.

Pairs
CDR-H3-CDR-L3 Pairs

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a CDR-H3 sequence and a CDR-L3 sequence. In some embodiments, the CDR-H3 sequence is part of a V_Hand the CDR-L3 sequence is part of a V_L.

In some embodiments, the CDR-H3 sequence is a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 379-382, and the CDR-L3 sequence is a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 404-408.

In some embodiments, the CDR-H3 sequence is SEQ ID NO: 379 and the CDR-L3 sequence is selected from SEQ ID NOS: 404-408. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 404. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 405. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 406. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 407. In some embodiments, the CDR-L3 sequence is SEQ ID NO: 408.

Variants of CDR-H3-CDR-L3 Pairs

In some embodiments, the CDR-H3-CDR-L3 pairs provided herein comprise a variant of an illustrative CDR-H3 and/or CDR-L1 sequence provided in this disclosure.

V_H-V_LPairs

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence and a V_Lsequence.

In some embodiments, the V_Hsequence is a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 413-418 and the V_Lsequence is a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 422-427.

In some embodiments, the V_Hsequence is SEQ ID NO: 413 and the V_Lsequence is selected from SEQ ID NOS: 422-427. In some embodiments, the V_Lsequence is SEQ ID NO: 422. In some embodiments, the V_Lsequence is SEQ ID NO: 423. In some embodiments, the V_Lsequence is SEQ ID NO: 424. In some embodiments, the V_Lsequence is SEQ ID NO: 425. In some embodiments, the V_Lsequence is SEQ ID NO: 426. In some embodiments, the V_Lsequence is SEQ ID NO: 427.

In some embodiments, the V_Hsequence is SEQ ID NO: 414 and the V_Lsequence is selected from SEQ ID NOS: 422-427. In some embodiments, the V_Lsequence is SEQ ID NO: 422. In some embodiments, the V_Lsequence is SEQ ID NO: 423. In some embodiments, the V_Lsequence is SEQ ID NO: 424. In some embodiments, the V_Lsequence is SEQ ID NO: 425. In some embodiments, the V_Lsequence is SEQ ID NO: 426. In some embodiments, the V_Lsequence is SEQ ID NO: 427.

In some embodiments, the V_Hsequence is SEQ ID NO: 415 and the V_Lsequence is selected from SEQ ID NOS: 422-427. In some embodiments, the V_Lsequence is SEQ ID NO: 422. In some embodiments, the V_Lsequence is SEQ ID NO: 423. In some embodiments, the V_Lsequence is SEQ ID NO: 424. In some embodiments, the V_Lsequence is SEQ ID NO: 425. In some embodiments, the V_Lsequence is SEQ ID NO: 426. In some embodiments, the V_Lsequence is SEQ ID NO: 427.

In some embodiments, the V_Hsequence is SEQ ID NO: 416 and the V_Lsequence is selected from SEQ ID NOS: 422-427. In some embodiments, the V_Lsequence is SEQ ID NO: 422. In some embodiments, the V_Lsequence is SEQ ID NO: 423. In some embodiments, the V_Lsequence is SEQ ID NO: 424. In some embodiments, the V_Lsequence is SEQ ID NO: 425. In some embodiments, the V_Lsequence is SEQ ID NO: 426. In some embodiments, the V_Lsequence is SEQ ID NO: 427.

In some embodiments, the V_Hsequence is SEQ ID NO: 417 and the V_Lsequence is selected from SEQ ID NOS: 422-427. In some embodiments, the V_Lsequence is SEQ ID NO: 422. In some embodiments, the V_Lsequence is SEQ ID NO: 423. In some embodiments, the V_Lsequence is SEQ ID NO: 424. In some embodiments, the V_Lsequence is SEQ ID NO: 425. In some embodiments, the V_Lsequence is SEQ ID NO: 426. In some embodiments, the V_Lsequence is SEQ ID NO: 427.

In some embodiments, the V_Hsequence is SEQ ID NO: 418 and the V_Lsequence is selected from SEQ ID NOS: 422-427. In some embodiments, the V_Lsequence is SEQ ID NO: 422. In some embodiments, the V_Lsequence is SEQ ID NO: 423. In some embodiments, the V_Lsequence is SEQ ID NO: 424. In some embodiments, the V_Lsequence is SEQ ID NO: 425. In some embodiments, the V_Lsequence is SEQ ID NO: 426. In some embodiments, the V_Lsequence is SEQ ID NO: 427.

In some embodiments, the binding domain capable of binding to a CD3ε epitope comprises three heavy chain CDRs and three light chain CDRs, each comprising, consisting of, or consisting essentially of a CDR sequence of a VH-VL pair set forth above. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises three heavy chain CDRs and three light chain CDRs, each comprising, consisting of, or consisting essentially of a CDR sequence of a VH-VL pair set forth in Table S.

CDR-H1+CDR-H2+CDR-H3+CDR-L1+CDR-L2+CDR-L3

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 354, a Kabat CDR-H2 sequence comprising SEQ ID NO: 371, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 379 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 388, a CDR-L2 sequence comprising SEQ ID NO: 396, and a CDR-L3 sequence SEQ ID NO: 404.

In some embodiments, the additional binding domain capable of binding to a CD3ε epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 346, a Chothia CDR-H2 sequence comprising SEQ ID NO: 362, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 379 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 388, a CDR-L2 sequence comprising SEQ ID NO: 396, and a CDR-L3 sequence SEQ ID NO: 404.

Variants of V_H-V_LPairs

In some embodiments, the V_H-V_Lpairs provided herein comprise a variant of an illustrative V_Hand/or V_Lsequence provided in this disclosure.

In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of a variant of an illustrative V_Hsequence provided in this disclosure. In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.1% identity with any of the illustrative V_Hsequences provided in this disclosure.

Additional Binding Domains Capable of Binding CD16, NKp46, and/or NKp30

CD16

In some embodiments, the additional binding domain comprises an NK cell engager, dendritic cell engager, monocyte, or macrophage engager. In some embodiments, the NK cell engager comprises an antibody for a CD16 epitope. In some embodiments, the monocyte or macrophage engager comprises an antibody for a CD16 epitope. In some embodiments, the epitope comprises one or more amino acids on SEQ ID NOS: 630-631.

In some embodiments, the epitope comprises one or more amino acids on a polymorphism of SEQ ID NO: 630. In some embodiments, the polymorphism comprises a polypeptide sequence comprising or consisting of SEQ ID NO: 630, wherein the amino acid at position 176 is a V. In some embodiments, the polymorphism comprises a polypeptide sequence comprising or consisting of SEQ ID NO: 630, wherein the amino acid at position 176 is an F. In some embodiments, the polymorphism comprises or consists of a polypeptide sequence having an F or having a V at the bold and underlined position or SEQ ID NO: 630 set forth in Table S, herein.

CD16 is a cluster of differentiation molecule found on the surface of natural killer cells, neutrophils, monocytes, dendritic cells, and macrophages. CD16 has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), which participate in signal transduction. The most well-researched membrane receptor implicated in triggering lysis by NK cells, CD16 is a molecule of the immunoglobulin superfamily (IgSF) involved in antibody-dependent cellular cytotoxicity (ADCC). CD16 can be used to isolate populations of specific immune cells through fluorescent-activated cell sorting (FACS) or magnetic-activated cell sorting, using antibodies directed towards CD16.

In humans, CD16 exists in two different forms: FcγRIIIa (CD16a) and FcγRIIIb (CD16b), which have 96% sequence similarity in the extracellular immunoglobulin binding regions. While FcγRIIIa is expressed on mast cells, macrophages, and natural killer cells as a transmembrane receptor, FcγRIIIb is only expressed on neutrophils. In addition, FcγRIIIb is the only Fc receptor anchored to the cell membrane by a glycosyl-phosphatidylinositol (GPI) linker, and also plays a significant role in triggering calcium mobilization and neutrophil degranulation. FcγRIIIa and FcγRIIIb together are able to activate degranulation, phagocytosis, and oxidative burst, which allows neutrophils to clear opsonized pathogens.

CD16 is required for ADCC processes carried out by human monocytes. In humans, monocytes expressing CD16 have a variety of ADCC capabilities in the presence of specific antibodies and can kill primary leukemic cells, cancer cell lines, and cells infected with hepatitis B virus. In addition, CD16 is able to mediate the direct killing of some virally infected and cancer cells without antibodies.

After binding to ligands such as the conserved section of IgG antibodies, CD16 on human NK cells induce gene transcription of surface activation molecules such as IL-2R (CD25) and inflammatory cytokines such as IFN-gamma and TNF. CD16-induced expression of cytokine mRNA in NK cells is mediated by the nuclear factor of activated T cells (NFATp), a cyclosporin A (CsA)-sensitive factor that regulates the transcription of various cytokines. The upregulated expression of specific cytokine genes occurs via a CsA-sensitive and calcium-dependent mechanism.

The crystal structures of FcεRIa, FcγRIIa, FcγRIIb, and FcγRIII have been experimentally determined. These structures revealed a conserved immunoglobulin-like (Ig-like) structure. In addition, the structures demonstrated a common feature in all known Ig superfamily Fc receptors: the acute hinge angle between the N- and C-terminal Ig domains. Specifically, the structure of CD16 (FcγRIIIb) consists of two immunoglobulin-like domains, with an interdomain hinge angle of around 50°. The receptor's Fc binding region also carries a net positive charge, which complements the negatively charged receptor binding regions on Fc.

CDR-H3 Sequences

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 465-472.

V_HSequences Comprising Illustrative CDRs

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising one or more CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-H sequences provided in this disclosure, and variants thereof.

V_HSequences Comprising Illustrative Kabat CDRs

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising one or more Kabat CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Kabat CDR-H sequences provided in this disclosure, and variants thereof.

Kabat CDR-H3

Kabat CDR-H2

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 458-461.

Kabat CDR-H1

Kabat CDR-H3+Kabat CDR-H2

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 465-472, and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 458-461. In some embodiments, the Kabat CDR-H3 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H3 and Kabat CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 501-513.

Kabat CDR-H3+Kabat CDR-H1

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 465-472, and a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 441-444. In some embodiments, the Kabat CDR-H3 sequence and the Kabat CDR-H1 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H3 and Kabat CDR-H1 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 501-513.

Kabat CDR-H1+Kabat CDR-H2

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 441-444 and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 458-461. In some embodiments, the Kabat CDR-H1 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H1 and Kabat CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 501-513.

Kabat CDR-H1+Kabat CDR-H2+Kabat CDR-H3

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 441-444, a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 458-461, and a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 465-472. In some embodiments, the Kabat CDR-H1 sequence, Kabat CDR-H2 sequence, and Kabat CDR-H3 sequence are all from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H1, Kabat CDR-H2, and Kabat CDR-H3 are all from a single illustrative V_Hsequence selected from SEQ ID NOS: 501-513.

Variants of V_HSequences Comprising Illustrative Kabat CDRs

In some embodiments, the V_Hsequences provided herein comprise a variant of an illustrative Kabat CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.

V_HSequences Comprising Illustrative Chothia CDRs

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising one or more Chothia CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Chothia CDR-H sequences provided in this disclosure, and variants thereof.

Chothia CDR-H3

Chothia CDR-H2

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 448-454.

Chothia CDR-H1

Chothia CDR-H3+Chothia CDR-H2

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 465-472, and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 448-454. In some embodiments, the Chothia CDR-H3 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H3 and Chothia CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 501-513.

Chothia CDR-H3+Chothia CDR-H1

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 465-472, and a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 431-437. In some embodiments, the Chothia CDR-H3 sequence and the Chothia CDR-H1 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H3 and Chothia CDR-H1 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 501-513.

Chothia CDR-H1+Chothia CDR-H2

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 431-437 and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 448-454. In some embodiments, the Chothia CDR-H1 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H1 and Chothia CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 501-513.

Chothia CDR-H1+Chothia CDR-H2+Chothia CDR-H3

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 431-437, a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 448-454, and a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 465-472. In some embodiments, the Chothia CDR-H1 sequence, Chothia CDR-H2 sequence, and Chothia CDR-H3 sequence are all from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H1, Chothia CDR-H2, and Chothia CDR-H3 are all from a single illustrative V_Hsequence selected from SEQ ID NOS: 501-513.

Variants of V_HSequences Comprising Illustrative Chothia CDRs

In some embodiments, the V_Hsequences provided herein comprise a variant of an illustrative Chothia CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.

V_HSequences

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 501-513. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially SEQ ID NO: 501. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially SEQ ID NO: 502. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially SEQ ID NO: 503. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially SEQ ID NO: 504. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially SEQ ID NO: 505. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially SEQ ID NO: 506. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially SEQ ID NO: 507. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially SEQ ID NO: 508. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially SEQ ID NO: 509. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially SEQ ID NO: 510. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially SEQ ID NO: 511. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially SEQ ID NO: 512. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially SEQ ID NO: 513.

In some embodiments, the binding domain capable of binding to a CD16 epitope comprises three heavy chain CDRs each comprising, consisting of, or consisting essentially of a CDR sequence of a V_Hhaving the sequence set forth in one of SEQ ID NOS: 501-513.

Variants of V_HSequences

In some embodiments, the V_Hsequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V_Hsequence provided in this disclosure.

CDR-L3 Sequences

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 492-497.

V_LSequences Comprising Illustrative CDRs

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising one or more CDR-L sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-L sequences provided in this disclosure, and variants thereof.

CDR-L3

CDR-L2

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 484-488.

CDR-L1

CDR-L3+CDR-L2

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 492-497 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 484-488. In some embodiments, the CDR-L3 sequence and the CDR-L2 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L3 and CDR-L2 are both from a single illustrative V_Lsequence selected from SEQ ID NOS: 517-524.

CDR-L3+CDR-L1

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 492-497 and a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 476-480. In some embodiments, the CDR-L3 sequence and the CDR-L1 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L3 and CDR-L1 are both from a single illustrative V_Lsequence selected from SEQ ID NOS: 517-524.

CDR-L1+CDR-L2

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 476-480 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 484-488. In some embodiments, the CDR-L1 sequence and the CDR-L2 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L1 and CDR-L2 are both from a single illustrative V_Lsequence selected from SEQ ID NOS: 517-524.

CDR-L1+CDR-L2+CDR-L3

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 476-480, a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 484-488, and a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 492-497. In some embodiments, the CDR-L1 sequence, CDR-L2 sequence, and CDR-L3 sequence are all from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L1, CDR-L2, and CDR-L3 are all from a single illustrative V_Lsequence selected from SEQ ID NOS: 517-524.

Variants of V_LSequences Comprising Illustrative CDR-Ls

In some embodiments, the V_Lsequences provided herein comprise a variant of an illustrative CDR-L3, CDR-L2, and/or CDR-L1 sequence provided in this disclosure.

V_LSequences

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 517-524. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 517. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 518. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 519. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 520. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 521. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 522. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 523. In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 524.

In some embodiments, the binding domain capable of binding to a CD16 epitope comprises three light chain CDRs each comprising, consisting of, or consisting essentially of a CDR sequence of a VL having the sequence set forth in one of SEQ ID NOS: 517-524.

Variants of V_LSequences

In some embodiments, the V_Lsequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V_Lsequence provided in this disclosure.

Pairs
CDR-H3-CDR-L3 Pairs

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a CDR-H3 sequence and a CDR-L3 sequence. In some embodiments, the CDR-H3 sequence is part of a V_Hand the CDR-L3 sequence is part of a V_L.

In some embodiments, the CDR-H3 sequence is a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 465-472, and the CDR-L3 sequence is a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 492-497.

Variants of CDR-H3-CDR-L3 Pairs

In some embodiments, the CDR-H3-CDR-L3 pairs provided herein comprise a variant of an illustrative CDR-H3 and/or CDR-L1 sequence provided in this disclosure.

V_H-V_LPairs

In some embodiments, the additional binding domain capable of binding to a CD16 epitope comprises a V_Hsequence and a V_Lsequence.

In some embodiments, the V_Hsequence is a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 501-513 and the V_Lsequence is a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 517-524.

Variants of V_H-V_LPairs

In some embodiments, the V_H-V_Lpairs provided herein comprise a variant of an illustrative V_Hand/or V_Lsequence provided in this disclosure.

In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of a variant of an illustrative V_Hsequence provided in this disclosure. In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.1% identity with any of the illustrative V_Hsequences provided in this disclosure.

NKp46

In some embodiments, the NK cell engager comprises an antibody for an NKp46 epitope. In some embodiments, the NKp46 epitopes comprises at least one of SEQ ID NOS: 632-637. In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 544.

NKp46 is a protein that in humans is encoded by the NCR1 gene. NKp46 is a major NK cell-activating receptor that is involved in the elimination of target cells. NK cells form different types of synapses that result in distinct functional outcomes: cytotoxic, inhibitory, and regulatory. NKp46 is a member of the natural cytotoxicity receptor (NCR) family.

Engagement of the NKp46 receptor on NK cells results in increased cellular activation, manifesting as increased cytokine production and release of cytolytic granules. The receptor can confer tumor cell recognition by NK cells and can specifically bind viral hemagglutinins. Normal NK cells in humans and in rodents uniformly express NKp46, which is upregulated during NK cell maturation following commitment to the NK cell lineage.

NKp46 is often considered a highly selective if not specific marker of NK cells in basic immunology. NKp46 is a highly specific marker of NK cells and is of potential utility in the diagnosis of NK cell and some T-cell-derived neoplasms.

V_HSequences Comprising Illustrative CDRs

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising one or more CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-H sequences provided in this disclosure, and variants thereof.

V_HSequences Comprising Illustrative Kabat CDRs

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising one or more Kabat CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Kabat CDR-H sequences provided in this disclosure, and variants thereof.

Kabat CDR-H3

Kabat CDR-H2

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 540.

Kabat CDR-H1

Kabat CDR-H3+Kabat CDR-H2

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 544, and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 540. In some embodiments, the Kabat CDR-H3 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H3 and Kabat CDR-H2 are both from a single illustrative V_Hsequence having SEQ ID NO: 560.

Kabat CDR-H3+Kabat CDR-H1

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 544, and a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 532. In some embodiments, the Kabat CDR-H3 sequence and the Kabat CDR-H1 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H3 and Kabat CDR-H1 are both from a single illustrative V_Hsequence having SEQ ID NO: 560.

Kabat CDR-H1+Kabat CDR-H2

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of SEQ ID NO: 532 and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 540. In some embodiments, the Kabat CDR-H1 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H1 and Kabat CDR-H2 are both from a single illustrative V_Hsequence having SEQ ID NO: 560.

Kabat CDR-H1+Kabat CDR-H2+Kabat CDR-H3

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 532, a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 540, and a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 544. In some embodiments, the Kabat CDR-H1 sequence, Kabat CDR-H2 sequence, and Kabat CDR-H3 sequence are all from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H1, Kabat CDR-H2, and Kabat CDR-H3 are all from a single illustrative V_Hsequence having SEQ ID NO: 560.

Variants of V_HSequences Comprising Illustrative Kabat CDRs

In some embodiments, the V_Hsequences provided herein comprise a variant of an illustrative Kabat CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.

V_HSequences Comprising Illustrative Chothia CDRs

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising one or more Chothia CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Chothia CDR-H sequences provided in this disclosure, and variants thereof.

Chothia CDR-H3

Chothia CDR-H2

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 536.

Chothia CDR-H1

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 528.

Chothia CDR-H3+Chothia CDR-H2

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 544, and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence SEQ ID NO: 536. In some embodiments, the Chothia CDR-H3 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H3 and Chothia CDR-H2 are both from a single illustrative V_Hsequence having SEQ ID NO: 560.

Chothia CDR-H3+Chothia CDR-H1

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 544, and a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 528. In some embodiments, the Chothia CDR-H3 sequence and the Chothia CDR-H1 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H3 and Chothia CDR-H1 are both from a single illustrative V_Hhaving SEQ ID NO: 560.

Chothia CDR-H1+Chothia CDR-H2

In some embodiments, the additional binding domain capable of binding to an NKp46 comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 528 and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 536. In some embodiments, the Chothia CDR-H1 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H1 and Chothia CDR-H2 are both from a single illustrative V_Hsequence SEQ ID NO: 560.

Chothia CDR-H1+Chothia CDR-H2+Chothia CDR-H3

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 528, a Chothia CDR-H2 sequence comprising SEQ ID NO: 536, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 544. For example, in some embodiments, the Chothia CDR-H1, Chothia CDR-H2, and Chothia-H3 are all from a single illustrative V_Hsequence having SEQ ID NO: 560.

Variants of V_HSequences Comprising Illustrative Chothia CDRs

In some embodiments, the V_Hsequences provided herein comprise a variant of an illustrative Chothia CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.

V_HSequences

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 560.

In some embodiments, the binding domain capable of binding to an NKp46 epitope comprises three heavy chain CDRs each comprising, consisting of, or consisting essentially of a CDR sequence of a VH having the sequence set forth in one of SEQ ID NO: 560.

Variants of V_HSequences

In some embodiments, the V_Hsequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V_Hsequence provided in this disclosure.

CDR-L3 Sequences

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 556.

V_LSequences Comprising Illustrative CDRs

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Lsequence comprising one or more CDR-L sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-L sequences provided in this disclosure, and variants thereof.

CDR-L3

CDR-L2

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 552.

CDR-L1

CDR-L3+CDR-L2

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 556 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 552. In some embodiments, the CDR-L3 sequence and the CDR-L2 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L3 and CDR-L2 are both from a single illustrative V_Lsequence having SEQ ID NOS: 564.

CDR-L3+CDR-L1

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 556 and a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 548. In some embodiments, the CDR-L3 sequence and the CDR-L1 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L3 and CDR-L1 are both from a single illustrative V_Lsequence having SEQ ID NO: 564.

CDR-L1+CDR-L2

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 548 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 552. In some embodiments, the CDR-L1 sequence and the CDR-L2 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L1 and CDR-L2 are both from a single illustrative V_Lsequence having SEQ ID NO: 564.

CDR-L1+CDR-L2+CDR-L3

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 548, a CDR-L2 sequence comprising SEQ ID NO: 552, and a CDR-L3 sequence SEQ ID NO: 556. In some embodiments, the CDR-L1 sequence, CDR-L2 sequence, and CDR-L3 sequence are all from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L1, CDR-L2, and CDR-L3 are all from a single illustrative V_Lsequence having SEQ ID NOS: 564.

Variants of V_LSequences Comprising Illustrative CDR-Ls

In some embodiments, the V_Lsequences provided herein comprise a variant of an illustrative CDR-L3, CDR-L2, and/or CDR-L1 sequence provided in this disclosure.

V_LSequences

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 564.

In some embodiments, the binding domain capable of binding to an NKp46 epitope comprises three light chain CDRs each comprising, consisting of, or consisting essentially of a CDR sequence of a VL having the sequence set forth in one of SEQ ID NO: 564.

Variants of V_LSequences

In some embodiments, the V_Lsequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V_Lsequence provided in this disclosure.

Pairs
CDR-H3-CDR-L3 Pairs

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a CDR-H3 sequence and a CDR-L3 sequence. In some embodiments, the CDR-H3 sequence is part of a V_Hand the CDR-L3 sequence is part of a V_L. In some embodiments, the CDR-H3 sequence is SEQ ID NO: 544 and the CDR-L3 sequence is SEQ ID NO: 556.

Variants of CDR-H3-CDR-L3 Pairs

In some embodiments, the CDR-H3-CDR-L3 pairs provided herein comprise a variant of an illustrative CDR-H3 and/or CDR-L1 sequence provided in this disclosure.

V_H-V_LPairs

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence and a V_Lsequence. In some embodiments, the V_Hsequence is SEQ ID NO: 560 and the V_Lsequence is SEQ ID NO: 564.

In some embodiments, the binding domain capable of binding to an NKp46 epitope comprises three heavy chain CDRs and three light chain CDRs, each comprising, consisting of, or consisting essentially of a CDR sequence of a VH-VL pair set forth above. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises three heavy chain CDRs and three light chain CDRs, each comprising, consisting of, or consisting essentially of a CDR sequence of a VH-VL pair set forth in Table S.

CDR-H1+CDR-H2+CDR-H3+CDR-L1+CDR-L2+CDR-L3

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 532, a Kabat CDR-H2 sequence comprising SEQ ID NO: 540, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 544 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 548, a CDR-L2 sequence comprising SEQ ID NO: 552, and a CDR-L3 sequence SEQ ID NO: 556.

In some embodiments, the additional binding domain capable of binding to an NKp46 epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 528, a Chothia CDR-H2 sequence comprising SEQ ID NO: 536, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 544 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 548, a CDR-L2 sequence comprising SEQ ID NO: 552, and a CDR-L3 sequence SEQ ID NO: 556.

Variants of V_H-V_LPairs

In some embodiments, the V_H-V_Lpairs provided herein comprise a variant of an illustrative V_Hand/or V_Lsequence provided in this disclosure.

In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of a variant of an illustrative V_Hsequence provided in this disclosure. In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.1% identity with any of the illustrative V_Hsequences provided in this disclosure.

NKp30

In some embodiments, the NK cell engager comprises an antibody for an NKp30 epitope. In some embodiments, the NKp30 epitope comprises one or more amino acids in SEQ ID NOS: 638-643. In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 568-570.

NKp30 is a protein that is encoded by the NCR3 gene. NKp30, also known as natural cytotoxicity receptor 3 (NCR3), was identified as a 30 kDa protein that, similarly to NKp46, is expressed on all mature resting and activated NK cells. Molecular cloning of the NKp30 cDNA revealed an open reading frame predicted to encode one extracellular IgV domain and a hydrophobic TM domain with a charged arginine residue capable of associating with the ITAM adaptors, CD3ζ and/or FcRγ. The crystal structure of NKp30 reveals some structural similarity to CTLA-4 and PD-1 and NKp30 is thus considered a member of the CD28 family of receptors (83, 89). Both NKp30 and NKp46 have reduced surface expression on adaptive memory NK cells most likely due to the downregulated expression of the FcRγ signaling chain required for the surface expression of these receptors.

Six alternatively spliced transcripts are transcribed from the NKp30 gene, termed NKp30a-f. Whilst NKp30a and NKp30b evoke NK cell activation, the NKp30c isoform was shown to elicit secretion of the immunosuppressive cytokine, IL-10, from NK cells (93). NKp30 has also been shown to be expressed by γδ T cells (30), CD8⁺ T cells (94), and UCB T cells cultured in IL-15.

V_HSequences Comprising Illustrative CDRs

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising one or more CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-H sequences provided in this disclosure, and variants thereof.

V_HSequences Comprising Illustrative Kabat CDRs

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising one or more Kabat CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Kabat CDR-H sequences provided in this disclosure, and variants thereof.

Kabat CDR-H3

Kabat CDR-H2

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 586-588.

Kabat CDR-H1

Kabat CDR-H3+Kabat CDR-H2

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 592-594, and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 586-588. In some embodiments, the Kabat CDR-H3 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H3 and Kabat CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 613-616.

Kabat CDR-H3+Kabat CDR-H1

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 592-594, and a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 574-576. In some embodiments, the Kabat CDR-H3 sequence and the Kabat CDR-H1 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H3 and Kabat CDR-H1 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 613-616.

Kabat CDR-H1+Kabat CDR-H2

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 574-576 and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 586-588. In some embodiments, the Kabat CDR-H1 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H1 and Kabat CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 613-616.

Kabat CDR-H1+Kabat CDR-H2+Kabat CDR-H3

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 574-576, a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 586-588, and a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 592-594. In some embodiments, the Kabat CDR-H1 sequence, Kabat CDR-H2 sequence, and Kabat CDR-H3 sequence are all from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Kabat CDR-H1, Kabat CDR-H2, and Kabat CDR-H3 are all from a single illustrative V_Hsequence selected from SEQ ID NOS: 613-616.

Variants of V_HSequences Comprising Illustrative Kabat CDRs

In some embodiments, the V_Hsequences provided herein comprise a variant of an illustrative Kabat CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.

V_HSequences Comprising Illustrative Chothia CDRs

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising one or more Chothia CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Chothia CDR-H sequences provided in this disclosure, and variants thereof.

Chothia CDR-H3

Chothia CDR-H2

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 580-582.

Chothia CDR-H1

Chothia CDR-H3+Chothia CDR-H2

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 592-594, and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 580-582. In some embodiments, the Chothia CDR-H3 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H3 and Chothia CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 613-616.

Chothia CDR-H3+Chothia CDR-H1

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 592-594, and a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 568-570. In some embodiments, the Chothia CDR-H3 sequence and the Chothia CDR-H1 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H3 and Chothia CDR-H1 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 613-616.

Chothia CDR-H1+Chothia CDR-H2

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 568-570 and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 580-582. In some embodiments, the Chothia CDR-H1 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H1 and Chothia CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOS: 613-616.

Chothia CDR-H1+Chothia CDR-H2+Chothia CDR-H3

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 568-570, a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 580-582, and a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 592-594. In some embodiments, the Chothia CDR-H1 sequence, Chothia CDR-H2 sequence, and Chothia CDR-H3 sequence are all from a single illustrative V_Hsequence provided in this disclosure. For example, in some embodiments, the Chothia CDR-H1, Chothia CDR-H2, and Chothia CDR-H3 are all from a single illustrative V_Hsequence selected from SEQ ID NOS: 613-616.

Variants of V_HSequences Comprising Illustrative Chothia CDRs

In some embodiments, the V_Hsequences provided herein comprise a variant of an illustrative Chothia CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.

V_HSequences

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 613-616. In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 613. In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 614. In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 615. In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 616.

In some embodiments, the binding domain capable of binding to an NKp30 epitope comprises three heavy chain CDRs each comprising, consisting of, or consisting essentially of a CDR sequence of a VH having the sequence set forth in one of SEQ ID NOS: 613-616.

Variants of V_HSequences

In some embodiments, the V_Hsequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V_Hsequence provided in this disclosure.

CDR-L3 Sequences

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 608-609.

V_LSequences Comprising Illustrative CDRs

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Lsequence comprising one or more CDR-L sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-L sequences provided in this disclosure, and variants thereof.

CDR-L3

CDR-L2

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 603-604.

CDR-L1

CDR-L3+CDR-L2

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 608-609 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 603-604. In some embodiments, the CDR-L3 sequence and the CDR-L2 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L3 and CDR-L2 are both from a single illustrative V_Lsequence selected from SEQ ID NOS: 624-625.

CDR-L3+CDR-L1

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 608-609 and a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 598-599. In some embodiments, the CDR-L3 sequence and the CDR-L1 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L3 and CDR-L1 are both from a single illustrative V_Lsequence selected from SEQ ID NOS: 624-625.

CDR-L1+CDR-L2

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 598-599 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 603-604. In some embodiments, the CDR-L1 sequence and the CDR-L2 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L1 and CDR-L2 are both from a single illustrative V_Lsequence selected from SEQ ID NOS: 624-625.

CDR-L1+CDR-L2+CDR-L3

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 598-599, a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 603-604, and a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 608-609. In some embodiments, the CDR-L1 sequence, CDR-L2 sequence, and CDR-L3 sequence are all from a single illustrative V_Lsequence provided in this disclosure. For example, in some embodiments, the CDR-L1, CDR-L2, and CDR-L3 are all from a single illustrative V_Lsequence selected from SEQ ID NOS: 624-625.

Variants of V_LSequences Comprising Illustrative CDR-Ls

In some embodiments, the V_Lsequences provided herein comprise a variant of an illustrative CDR-L3, CDR-L2, and/or CDR-L1 sequence provided in this disclosure.

V_LSequences

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 624-625. In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 624. In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 625.

In some embodiments, the binding domain capable of binding to an NKp30 epitope comprises three light chain CDRs each comprising, consisting of, or consisting essentially of a CDR sequence of a VL having the sequence set forth in one of SEQ ID NOS: 624-625.

Variants of V_LSequences

In some embodiments, the V_Lsequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V_Lsequence provided in this disclosure.

Pairs
CDR-H3-CDR-L3 Pairs

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a CDR-H3 sequence and a CDR-L3 sequence. In some embodiments, the CDR-H3 sequence is part of a V_Hand the CDR-L3 sequence is part of a V_L.

In some embodiments, the CDR-H3 sequence is a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 592-594, and the CDR-L3 sequence is a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 608-609.

Variants of CDR-H3-CDR-L3 Pairs

In some embodiments, the CDR-H3-CDR-L3 pairs provided herein comprise a variant of an illustrative CDR-H3 and/or CDR-L1 sequence provided in this disclosure.

V_H-V_LPairs

In some embodiments, the additional binding domain capable of binding to an NKp30 epitope comprises a V_Hsequence and a V_Lsequence.

In some embodiments, the V_Hsequence is a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 613-616 and the V_Lsequence is a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 624-625.

In some embodiments, the binding domain capable of binding to an NKp30 epitope comprises three heavy chain CDRs and three light chain CDRs, each comprising, consisting of, or consisting essentially of a CDR sequence of a VH-VL pair set forth above. In some embodiments, the binding domain capable of binding to an HLA-G epitope comprises three heavy chain CDRs and three light chain CDRs, each comprising, consisting of, or consisting essentially of a CDR sequence of a VH-VL pair set forth in Table S.

Variants of V_H-V_LPairs

In some embodiments, the V_H-V_Lpairs provided herein comprise a variant of an illustrative V_Hand/or V_Lsequence provided in this disclosure.

In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of a variant of an illustrative V_Hsequence provided in this disclosure. In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.1% identity with any of the illustrative V_Hsequences provided in this disclosure.

Pharmaceutical Compositions

Some embodiments provide a pharmaceutical composition comprising or consisting of any of the bispecific antigen binding constructs provided herein. Suitable routes of administration include, but are not limited to, the inhalation, intra-arterial, intradermal, intramuscular, intraperitoneal, intravenous, nasal, parenteral, pulmonary, and subcutaneous routes.

The pharmaceutical composition may comprise one or more pharmaceutical excipients. Any suitable pharmaceutical excipient may be used, and one of ordinary skill in the art is capable of selecting suitable pharmaceutical excipients. Accordingly, the pharmaceutical excipients provided below are intended to be illustrative, and not limiting. Additional pharmaceutical excipients include, for example, those described in the Handbook of Pharmaceutical Excipients, Rowe et al. (Eds.) 6th Ed. (2009), incorporated by reference in its entirety.

Further encompassed herein are anhydrous pharmaceutical compositions and dosage forms comprising an antibody, since water can facilitate the degradation of some antibodies. Anhydrous pharmaceutical compositions and dosage forms provided herein can be prepared using anhydrous or low moisture containing ingredients and low moisture or low humidity conditions. Pharmaceutical compositions and dosage forms that comprise lactose and at least one active ingredient that comprises a primary or secondary amine can be anhydrous if substantial contact with moisture and/or humidity during manufacturing, packaging, and/or storage is expected.

An anhydrous pharmaceutical composition should be prepared and stored such that its anhydrous nature is maintained. Accordingly, anhydrous compositions can be packaged using materials known to prevent exposure to water such that they can be included in suitable formulary kits. Examples of suitable packaging include, but are not limited to, hermetically sealed foils, plastics, unit dose containers (e.g., vials), blister packs, and strip packs.

In some embodiments, the pharmaceutical composition further comprises one or both of an antibody to an immune inhibitory receptor or ligand and/or an antibody to an immune stimulatory receptor and/or ligand. In some embodiments, the pharmaceutical composition further comprises an effective amount of at least one of the following: an anti-ILT2 antibody or a small molecule inhibitor; an anti-ILT4 antibody or small molecule inhibitor; an anti-KIR2DL4 antibody or small molecule inhibitor; an anti-PD-L1 antibody or small molecule inhibitor; an anti-PD-1 antibody or small molecule inhibitor; an anti-CTLA4 antibody or small molecule inhibitor; an anti-CD38 antibody or small molecule inhibitor; an anti-CD73 antibody or small molecule inhibitor; an anti-A2A receptor antibody or small molecule inhibitor; an anti-A2B receptor antibody or small molecule inhibitor; an anti-A2A/A2B dual receptor antibody or small molecule inhibitor or a combination thereof; an anti-CD39 antibody or small molecule inhibitor; an anti-CD73 antibody or small molecule inhibitor; an anti-CD47 antibody or small molecule inhibitor; and/or a small molecule inhibitor. In some embodiments, the pharmaceutical composition further comprises an anti-ILT2 antibody or small molecule inhibitor, an anti-ILT4 antibody or small molecule inhibitor, an anti-PD-L1 antibody or small molecule inhibitor, and/or an anti-CD47 antibody or small molecule inhibitor.

In some embodiments, the pharmaceutical composition further comprises an effective amount of one or more of:

- a) an anti-PD-L1 antibody or small molecule inhibitor;
- b) an anti-PD-1 antibody or small molecule inhibitor;
- c) an anti-CD38 antibody or small molecule inhibitor;
- d) an anti-CD39 antibody or small molecule inhibitor;
- e) an anti-CD73 antibody or small molecule inhibitor;
- f) an anti-A2A receptor antibody or small molecule inhibitor;
- g) an anti-A2B receptor antibody or small molecule inhibitor;
- h) an anti-A2A/A2B dual receptor antibody or small molecule inhibitor;
- i) an anti-CD47 antibody or small molecule inhibitor;
- j) an anti-CTLA-4 antibody or small molecule inhibitor;
- k) an anti-LAG-3 antibody or small molecule inhibitor;
- l) an anti-TIM-3 antibody or small molecule inhibitor;
- m) an anti-TIGIT antibody or small molecule inhibitor;
- n) an anti-VISTA antibody or small molecule inhibitor;
- o) an anti-CD94 antibody or small molecule inhibitor;
- p) a small molecule inhibitor;
- q) an oncolytic virus;
- r) a chemotherapy;
- s) ADCC capable therapies using effector competent antibodies such as anti-CD19, anti-CD20, anti-EGFR, anti-Her2, anti-SLAMF7, anti-CD52, anti-BCMA, anti-GD2, and/or anti-CCR4.

In some embodiments, chemotherapy comprises one or more receptor tyrosine kinase inhibitors. Examples of receptor tyrosine inhibitors include acalabrutinibafatinib, alecensa, alectinib, avapritinib, axitinib, bosulif, bosutinib, brukinsa cabozantinib, calquence, caprelsa, cometriq, crizotinib, dacomitinib, dasatinib, entrectinib, erlotinib, gilotrif, gilteritinib, gleevec, ibrutinib, iclusig, imatinib, imbruvica, inlyta, lapatinib, midostaurin, neratinib, nerlynx, nexavar, nilotinib, pacritinib, pazopanib, pexidartinib, ponatinib, quizartinib, regorafenib, Rozlytrek, rydapt, sorafenib, sprycel, stivarga, sunitinib, sutent, tarceva, tasigna, turalio, tykerb, vandetanib, vizimpro, votrient, xalkori, xospata, zaltrap, zanubrutinib, ziv-aflibercept.

In some embodiments, chemotherapy comprises one or more antimetabolites. Antimetabolities include, without limitation, zacitidine, 5-fluorouracil (5-FU), 6-mercaptopurine (6-MP), capecitabine (Xeloda), cladribine, clofarabine, cytarabine (Ara-C), decitabine, floxuridine, fludarabine, gemcitabine (Gemzar), hydroxyurea, methotrexate, nelarabine, pemetrexed (Alimta), pentostatin, pralatrexate, thioguanine, and/or trifluridine/tipiracil.

In some embodiments, chemotherapy comprises one or more alkylating agents. Alkylating agents include, with out limitation, altretamine, bendamustine, busulfan, carboplatin, carmustine, chlorambucil, cisplatin, cyclophosphamide, dacarbazin, iosfamide, lomustine, mechlorethamine, melphalan, oxaliplatin, temozolomide, thiotepa, and/or trabectedin.

In some embodiments, chemotherapy comprises one or more anthracyclines. Anthracyclines include, without limitation, daunorubicin, doxorubicin (Adriamycin), doxorubicin liposomal, epirubicin, idarubicin, and/or valrubicin.

In some embodiments, chemotherapy comprises one or more topoisomerase inhibitors such as, for example, without limitation, irinotecan, irinotecan liposomal, and/or topotecan.

In some embodiments, chemotherapy comprises one or more taxanes such as, for example, without limitation, cabazitaxel, docetaxel, nab-paclitaxel, and/or paclitaxel.

In some embodiments, chemotherapy comprises one or more, vinca alkaloids such, for example, without limitation, vinblastine, vincristine, vincristine liposomal, and/or vinorelbine.

In some embodiments, chemotherapy comprises one or more of all-trans-retinoic acid, arsenic trioxide, asparaginase, eribulin, hydroxyurea, ixabepilone, mitotane, omacetaxine, pegaspargase, procarbazine, romidepsin, and/or vorinostat.

In some embodiments, the pharmaceutical composition further comprises one or both of:

- c) an antibody to an immune inhibitory receptor or ligand and/or
- d) an antibody to an immune stimulatory receptor or ligand.

Nucleic Acids, Vectors, Hosts, and Cell Lines

A second aspect provides a one or more nucleic acids encoding any of the bispecific antigen binding constructs provided herein. In some embodiments, the one or more nucleic acids comprises one or more vectors. Some embodiments provide a host transformed with the one or more vectors. Some embodiments provide a method for the production of one or more bispecific antigen binding construct comprising the steps of expressing any of the one or more nucleic acids provided herein in a prokaryotic or eukaryotic host cell and recovering the one or more bispecific antigen binding construct from the cell or the cell culture supernatant.

For recombinant production of the antibody or bispecific antigen binding construct, the one or more nucleic acids encoding it may be isolated and inserted into one or more replicable vectors for further cloning (i.e., amplification of the DNA) or expression. In some aspects, the one or more nucleic acids may be produced by homologous recombination, for example as described in U.S. Pat. No. 5,204,244, which is incorporated by reference in its entirety herein.

Many different vectors are known in the art. The vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence, for example as described in U.S. Pat. No. 5,534,615, which is incorporated in its entirety herein.

Suitable host cells include any prokaryotic (e.g., bacterial), lower eukaryotic (e.g., yeast), or higher eukaryotic (e.g., mammalian) cells. Suitable prokaryotes include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia (E. coli), Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella (S. typhimurium), Serratia (S. marcescans), Shigella, Bacilli (B. subtilis and B. licheniformis), Pseudomonas (P. aeruginosa), and Streptomyces. One useful E. coli cloning host is E. coli 294, although other strains such as E. coli B, E. coli X1776, and E. coli W3110 are suitable.

In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are also suitable cloning or expression hosts for antibody-encoding vectors. Saccharomyces cerevisiae, or common baker's yeast, is a commonly used lower eukaryotic host microorganism. However, a number of other genera, species, and strains are available and useful, such as Schizosaccharomyces pombe, Kluyveromyces (K. lactis, K. fragilis, K. bulgaricus K. wickeramii, K. waltii, K. drosophilarum, K. thermotolerans, and K. marxianus), Yarrowia, Pichia pastoris, Candida (C. albicans), Trichoderma reesia, Neurospora crassa, Schwanniomyces (S. occidentalis), and filamentous fungi such as, for example Penicillium, Tolypocladium, and Aspergillus (A. nidulans and A. niger).

Useful mammalian host cells include COS-7 cells, HEK293 cells; baby hamster kidney (BHK) cells; Chinese hamster ovary (CHO); mouse sertoli cells; African green monkey kidney cells (VERO-76), and the like.

The host cells used to produce the bispecific antigen binding construct or antibody of this invention may be cultured in a variety of media. Commercially available media such as, for example, Ham's F10, Minimal Essential Medium (MEM), RPMI-1640, and Dulbecco's Modified Eagle's Medium (DMEM) are suitable for culturing the host cells. In addition, any of the media described in Ham et al., Meth. Enz., 1979, 58:44; Barnes et al., Anal. Biochem., 1980, 102:255; and U.S. Pat. Nos. 4,767,704, 4,657,866, 4,927,762, 4,560,655, and 5,122,469, or WO 90/03430 and WO 87/00195 may be used; each of the above-noted references are incorporated by reference herein in their entirety.

Any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics, trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.

The culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.

When using recombinant techniques, the bispecific antigen binding construct or antibody can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody or bispecific antigen binding construct is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration. For example, Carter et al. (BioTechnology, 1992, 10:163-167, which is incorporated by reference in its entirety herein) describes a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli. Briefly, cell paste is thawed in the presence of sodium acetate (pH 3.5), EDTA, and phenylmethylsulfonylfluoride (PMSF) over about 30 minutes. Cell debris can be removed by centrifugation.

In some embodiments, the bispecific antigen binding construct or antibody is produced in a cell-free system. In some embodiments, the cell-free system is an in vitro transcription and translation system as described in Yin et al., mAbs, 2012, 4:217-225, incorporated by reference in its entirety. In some embodiments, the cell-free system utilizes a cell-free extract from a eukaryotic cell or from a prokaryotic cell. In some embodiments, the prokaryotic cell is E. coli. Cell-free expression of the antibody or bispecific antigen binding construct may be useful, for example, where the antibody or bispecific antigen binding construct accumulates in a cell as an insoluble aggregate, or where yields from periplasmic expression are low.

Where the bispecific antigen binding construct or antibody is secreted into the medium, supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon® or Millipore® Pelicon® ultrafiltration unit. A protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.

The bispecific antigen binding construct or antibody composition prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being a particularly useful purification technique. The suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody. Protein A can be used to purify antibodies that are based on human 71, y2, or y4 heavy chains (Lindmark et al., J. Immunol. Meth., 1983, 62:1-13). Protein G is useful for all mouse isotypes and for human y3 (Guss et al., EMBO J., 1986, 5:1567-1575).

The matrix to which the affinity ligand is attached is most often agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose. Where the bispecific antigen binding construct or antibody comprises a CH3 domain, the BakerBond ABX® resin is useful for purification.

Other techniques for protein purification, such as fractionation on an ion-exchange column, ethanol precipitation, Reverse Phase HPLC, chromatography on silica, chromatography on heparin Sepharose®, chromatofocusing, SDS-PAGE, and ammonium sulfate precipitation are also available, and can be applied by one of skill in the art.

Following any preliminary purification step(s), the mixture comprising the antibody or bispecific antigen binding construct of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5 to about 4.5, generally performed at low salt concentrations (e.g., from about 0 to about 0.25 M salt).

Preparation of Anti-HLA-G Bispecific Antigen Binding Constructs

Methods for making bispecific antigen binding constructs or bispecific antibodies are known in the art (See, e.g., Suresh et al., Methods in Enzymology 121:210, 1986, which is incorporated by reference herein in its entirety). Traditionally, recombinant production of bispecific antigen binding constructs or bispecific antibodies was based on the coexpression of two IgG heavy chain-light chain pairs, with the two heavy chains having different specificities (See, Millstein and Cuello, Nature 305: 537-539, 1983, which is incorporated by reference in its entirety herein).

For example, in one approach, bispecific antigen binding constructs or bispecific antibodies may be composed of a hybrid IgG heavy chain with a first binding specificity in one arm and a hybrid IgG heavy chain-light chain pair (providing a second binding specificity) in the other arm. This asymmetric structure, with an IgG light chain in only one half of the bispecific molecule, facilitates the separation of the desired bispecific compound from unwanted IgG chain combinations. The approach is described in PCT Publication No. WO 94/04690, which is incorporated by reference in its entirety herein.

In another approach, for example, bispecific antigen binding constructs or bispecific antibodies are composed of amino acid modification by replacement of a small amino acid with a larger one in the CH3 domain in one arm to introduce a protuberance at the IgG Fc interface (‘knob’) and replacement of a large residue with a smaller one in the CH3 domain in another arm to introduce a cavity of the corresponding IgG Fc interface (‘hole’). The ‘knob’ can be positioned in the ‘hole’ so as to promote heteromultimer formation and hinder homomultimer formation. This ‘knobs-into-holes’ approach is described in Ridgway et al Protein Engineering 9: 617-621, 1996, and U.S. Pat. No. 8,679,785 B2, which is incorporated by reference herein in its entirety.

In another approach, bispecific antigen binding constructs or bispecific antibodies are composed of amino acid modification in the first hinge region in one arm and the substituted/replaced amino acid in the first hinge region has an opposite charge to the corresponding amino acid in a second hinge region in another arm. The formation of the bispecific antigen binding constructs or bispecific antibody is enhanced by altering or engineering an interface between a first and a second IgG Fc region (e.g., a hinge region and/or a CH3 region). In this approach, the bispecific antigen binding constructs or bispecific antibodies may be composed of a CH3 region, wherein the CH3 region comprises a first CH3 polypeptide and a second CH3 polypeptide which interact together to form a CH3 interface, wherein one or more amino acids within the CH3 interface destabilize homodimer formation and are not electrostatically unfavorable to homodimer formation. This approach is described in International Patent Application No. PCT/US2011/036419 (WO2011/143545) and Strop et al. JMB 420: 204-219, 2012, which is incorporated by reference in its entirety herein.

In some embodiments, the bispecific antigen binding construct comprises or consist of one or more diabodies. Diabodies are bivalent, bispecific antigen binding constructs or bispecific antibodies in which heavy chain variable (VH) and light chain variable (VL) domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen binding sites (See, e.g., Holliger, P., et al., Proc. Natl. Acad Sci. USA 90:6444-6448, 1993; Poljak, R. J., et al., Structure 2:1121-1123, 1994, which is incorporated by reference in its entirety herein). The short linking peptide bridges between the carboxy terminus of one variable region (e.g. of HLA-G) and the amino terminus of the other variable region (e.g. of CD3), producing a VL-VH sequence. The VL-VH sequence may be further linked to an IgG Fc region. In some embodiments, the IgG Fc can be either human or mouse or human/mouse IgG1, IgG2, IgG3, or IgG4 isotype.

In some embodiments, a bispecific diabody-Fc antibody comprises or consists of a diabody fused to an IgG Fc domain, wherein a first antibody variable domain of the diabody is capable of specifically binding to a target antigen (e.g. HLA-G), and wherein a second antibody variable domain of the diabody is capable of recruiting the activity of a human immune effector cell by specifically binding to an effector antigen located on a human immune effector cell. In some embodiments, the effector antigen is CD3. In some embodiments, the human immune effector cell is a CD8⁺ T cell.

In some embodiments, bispecific antigen binding fragments comprise or consist of one or more of an scFv, minibodies, or VHH single domain antibodies. For scFv, single chain variable region fragments are made by linking light and/or heavy chain variable regions by using a short linking peptide (See, Bird et al., Science 242:423-426, 1988, which is incorporated by reference in its entirety). An example of a linking peptide is (GGGGS)₄, which bridges between the carboxy terminus of one variable region and the amino terminus of the other variable region. Linkers of other sequences have been designed and used (See, Bird et al., Science 242:423-426, 1988). For example, two scFvs targeting two different antigens can be linked by another linker to form a bispecific scFv.

In some embodiments, the bispecific antigen binding construct comprises or consists of a minibody. A minibody is an antibody which features a smaller molecular weight that a traditional large antibody while still maintaining binding. Because of the smaller size, a minibody features faster clearance from a subject's system and could also feature enhanced penetration when targeting a tumor tissue.

A minibody may be composed of a pair of scFv fragments which are linked via CH3 domains, and Fvs with distinct specificity, which are paired to scFv fragments through heterodimerization process. To promote the heterodimerization efficiency, single-residue mutations can be introduced into each CH3 domain to achieve the knob and hole approach. Far more than that, additional cysteine residues can also be introduced into CH3 domains to stabilize the bispecific minibody structure.

Minibodies can also include the VL and VH domains of a native antibody fused to the hinge region and CH3 domain of the immunoglobulin molecule. See, e.g., U.S. Pat. No. 5,837,821, which is incorporated by reference in its entirety herein.

In some embodiments, the bispecific antigen binding construct comprises or consists of one or more VHH single domain antibodies. A VHH single domain antibody is engineered from VH domain found in camelids (See, Muyldermans and Lauwereys, Journal of Molecular Recognition, 1999, which is incorporated by reference herein), and can be fused to IgG Fc domain to form a bispecific antigen binding construct VHH antibody. Exemplary heterologous sequences include, but are not limited to, a “tag” such as a Avi tag or a 8His tag. Tags are well known in the art.

Methods of Treatment

A third aspect provides a method for treating a subject with cancer comprising administering any of the bispecific antigen binding constructs or pharmaceutical compositions provided herein to the subject in a therapeutically effective amount.

In some embodiments, the method further comprises one or more of the following:

- a) administering chemotherapy to the subject;
- b) administering radiation therapy to the subject; and/or
- c) administering one or more additional therapeutic agents to the subject.
  
  In some embodiments, the one or more additional therapeutic agents comprise one or more immunomodulatory agents.

Dosage

Parenteral dosage forms of the bispecific antigen binding constructs are provided in some embodiments. Parenteral dosage forms can be administered to subjects by various routes including, but not limited to, subcutaneous, intravenous (including bolus injection), intramuscular, and intra-arterial. Because their administration typically bypasses subjects' natural defenses against contaminants, parenteral dosage forms are typically sterile or capable of being sterilized prior to administration to a subject. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions.

Suitable vehicles that can be used to provide parenteral dosage forms are well known to those skilled in the art. Examples include, but are not limited to, water for injection; aqueous vehicles such as for example including, but not limited to, sodium chloride injection, ringer's injection, dextrose injection, dextrose and sodium chloride injection, lactated ringer's injection; water miscible vehicles such as for example including, but not limited to, ethyl alcohol, polyethylene glycol, and polypropylene glycol; and non-aqueous vehicles such as for example including, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.

Excipients that increase the solubility of one or more of the bispecific antigen binding constructs disclosed herein can also be incorporated into the parenteral dosage forms.

In human therapeutics, the doctor will determine the dosology which she considers most appropriate according to a preventive or curative treatment and according to the age, weight, condition, and other factors specific to the subject to be treated.

The amount of the bispecific antigen binding construct or composition which will be effective in the prevention or treatment of a disorder or one or more symptoms thereof will vary with the nature and severity of the disease or condition, and the route by which the antibody is administered. The frequency and dosage will also vary according to factors specific for each subject depending on the specific therapy (e.g., therapeutic or prophylactic agents) administered, the severity of the disorder, disease, or condition, the route of administration, as well as age, body, weight, response, and the past medical history of the subject. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.

Bispecific antigen binding constructs or pharmaceutical compositions according to the invention may be administered according to any suitable schedule. Bispecific antigen binding constructs or pharmaceutical compositions may be administered multiple times and at the same of different dosages. Bispecific antigen binding constructs or pharmaceutical compositions may be administered in any order and at any dose with respect to any of the other agents. Some embodiments comprise or consist of administering to the subject a bispecific antigen binding constructs or pharmaceutical compositions simultaneously or sequentially with any other agents provided herein. In some embodiments, bispecific antigen binding constructs or pharmaceutical compositions are administered before other agents. In some embodiments, bispecific antigen binding constructs or pharmaceutical compositions are administered after other agents. In some embodiments, bispecific antigen binding constructs or pharmaceutical compositions are administered multiple times and at the same of different dosages, or a combination thereof, as other agents.

In certain embodiments, exemplary doses of a bispecific antigen binding construct or composition include milligram or microgram amounts of the antibody per kilogram of subject or sample weight (e.g., about 10 micrograms per kilogram to about 50 milligrams per kilogram, about 100 micrograms per kilogram to about 25 milligrams per kilogram, or about 100 microgram per kilogram to about 10 milligrams per kilogram). In certain embodiment, the dosage of the bispecific antigen binding construct provided herein, based on weight, administered to prevent, treat, manage, or ameliorate a disorder, or one or more symptoms thereof in a subject is 0.1 mg/kg, 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg, 6 mg/kg, 10 mg/kg, or 15 mg/kg or more of a subject's body weight. In another embodiment, the dosage of the bispecific antigen binding construct or a composition provided herein administered to prevent, treat, manage, or ameliorate a disorder, or one or more symptoms thereof in a subject is 0.1 mg to 200 mg, 0.1 mg to 100 mg, 0.1 mg to 50 mg, 0.1 mg to 25 mg, 0.1 mg to 20 mg, 0.1 mg to 15 mg, 0.1 mg to 10 mg, 0.1 mg to 7.5 mg, 0.1 mg to 5 mg, 0.1 to 2.5 mg, 0.25 mg to 20 mg, 0.25 to 15 mg, 0.25 to 12 mg, 0.25 to 10 mg, 0.25 mg to 7.5 mg, 0.25 mg to 5 mg, 0.25 mg to 2.5 mg, 0.5 mg to 20 mg, 0.5 to 15 mg, 0.5 to 12 mg, 0.5 to 10 mg, 0.5 mg to 7.5 mg, 0.5 mg to 5 mg, 0.5 mg to 2.5 mg, 1 mg to 20 mg, 1 mg to 15 mg, 1 mg to 12 mg, 1 mg to 10 mg, 1 mg to 7.5 mg, 1 mg to 5 mg, or 1 mg to 2.5 mg.

The dose can be administered according to a suitable schedule, for example, once, two times, three times, or four times weekly. It may be necessary to use dosages of the bispecific antigen binding construct outside the ranges disclosed herein in some cases, as will be apparent to those of ordinary skill in the art. Furthermore, it is noted that the clinician or treating physician will know how and when to interrupt, adjust, or terminate therapy in conjunction with subject response.

In certain embodiments, treatment or prevention can be initiated with one or more loading doses of a bispecific antigen binding construct or composition provided herein followed by one or more maintenance doses.

In certain embodiments, a dose of a bispecific antigen binding construct or composition provided herein can be administered to achieve a steady-state concentration of the bispecific antigen binding construct in blood or serum of the subject. The steady-state concentration can be determined by measurement according to techniques available to those of skill or can be based on the physical characteristics of the subject such as height, weight and age.

In certain embodiments, administration of the same bispecific antigen binding construct or composition may be repeated and the administrations may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or 6 months. In other embodiments, administration of the same prophylactic or therapeutic agent may be repeated and the administration may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or 6 months.

In some embodiments, a therapeutically effective amount comprises or consists of determining an amount used to achieve a response according to a clinical endpoint. In some embodiments, the clinical endpoint comprises Objective Response Rate (ORR), Progression Free Survival (PFS), and/or Response Evaluation Criteria in Solid Tumors (“RECIST”).

EXAMPLES
Example 1: Selection of HLA-G Antibodies

HLA-G antibodies were selected from a synthetic library of human antibodies presented on the surface of yeast cells in IgG format, as generally described, e.g., in WO2009036379; WO2010105256; WO2012009568; and Xu et al., Protein Eng. Des. Sel., 2013, 26:663-670 (each incorporated by reference in its entirety), and more specifically as provided below. The sequences and characteristics of the antibodies isolated from the recombinant library are provided in Table S.

Eight naïve human synthetic yeast libraries each of ^˜10E+09 diversity were propagated as described in WO2009036379; WO2010105256; WO2012009568; and Xu et al., Protein Eng. Des. Sel., 2013, 26:663-670; each incorporated by reference in its entirety. For the first two rounds of selection, a magnetic bead sorting technique utilizing the Miltenyi MACS® system was performed, as described in Siegel et al., J. Immunol. Meth., 2004, 286:141-153. The following rounds of selection were performed using flow cytometry-based sorting. For all rounds of selection, the antigen was biotinylated human HLA-G, decreasing concentrations of antigen were used in each subsequent round of selection. In addition to selection on antigen, some rounds of selection were employed to reduce the number of non-specific binders utilizing soluble membrane proteins from CHO cells (see WO2014179363 and Xu et al., Protein Eng. Des. Sel., 2013, 26:663-670, each incorporated by reference in its entirety). In addition to the CHO cell proteins, deselections against recombinant HLA-A/B/C proteins were performed to maintain specific binding to HLA-G. After the final round of sorting, yeast were plated and individual colonies were picked for characterization and for nomination of clones for affinity maturation.

Antibody variable domains of interest were synthesized, with codon optimization to maximize transient expression in host cells. The variable regions were cloned into expression vectors containing human immunoglobulin constant domains and their sequence confirmed. Antibody heavy and light chain vector pairings were transfected into Expi293 cells using the Expifectamine system (Invitrogen). Transient cultures were harvested on day 4 and clarified cell culture supernatant IgG titer was estimated using Bio-Layer Interferometry (BLI) using Octet (ForteBio) alongside standards. Antibodies were subsequently purified on a Protein A column and eluted using low pH glycine. Purified antibody samples were then buffer-exchanged or dialyzed into downstream assay-compatible buffers.

Antibody purity was assessed by running samples on SDS-PAGE and on an analytical size exclusion chromatography column.

Light Chain Shuffling: Heavy chain plasmids were extracted from naïve outputs (described herein) and transformed into a pre-made naïve light chain library with a diversity of 10E+06. Selections were performed as described above with one round of MACS sorting and three rounds of FACS sorting using decreasing amounts of biotinylated HLA-G antigen for respective rounds.

Example 2: Affinity Maturation of HLA-G Antibodies

Optimization of naïve clones was carried out utilizing four maturation strategies; diversification of CDR-H1 and CDR-H2; diversification of CDR-H3; diversification of CDR-L1, L2 and L3; shuffling of diversified heavy and light chains.

CDR-H1 and CDR-H2 Selection: The CDR-H3s from clones selected from light chain batch diversification, light chain diversification, and naive discovery efforts were independently recombined into premade libraries with CDR-H1 and CDR-H2 variants of a diversity of >10E+8. Selections were performed using HLA-G antigen. Affinity pressures were applied by using decreasing concentrations of antigen and HLA-G specificity was maintained with deselections against HLA-A/B/C antigens.

CDR-H3 Selection: After characterization of CDR-H1 and CDR-H2 variants, clones with binding to HLA antigens outside of HLA-G were removed. Chemical liabilities were also removed from the variable regions when applicable. The remaining clones obtained from the CDR-H1 and CDR-H2 selection procedure were subject to additional rounds of affinity maturation via walking dimer mutagenesis of the CDR-H3. Selections were performed using HLA-G as antigen generally as described above, except for employing FACS sorting for all selection rounds.

CDR-L1, L2, L3 Selection: Clones obtained from the CDR-H1 and CDR-H2 selection procedure were subject to additional rounds of affinity maturation via mutagenesis of the light chain. The CDR-L1 and CDR-L2 diversity was derived from a pre-made library while CDR-L3 diversity was derived from walking monomer mutagenesis. Selections were performed using HLA-G as antigen, starting with one round of MACS followed by three rounds of FACS in the CDR-L1, L2, L3 process described here.

Diversified Heavy Chain and Light Chain Shuffling: Outputs from CDR-H3 diversification and CDR-L1, L2, L3 diversification described above were recombined and selections were performed using HLA-G as antigen generally as described above, except for employing FACS sorting for all selection rounds.

Example 3: Generation of HLA-G×CD3 Bispecific Antibody

The HLA-G×CD3 bispecific antibody was prepared using two single-chain VL-VH-Fc constructs. Anti-human CD3 VL (SEQ ID NO: 422) domain was linked on its C-terminus via a 7-amino acid linker, GGGSGGG, to the N-terminus of the anti-human HLA-G VH domain (SEQ ID NO: 192). This VL-VH sequence was linked to the ‘effector-silent’ human Fc region containing the “EEE” mutations in the hinge region and the CH3 domain. The resultant construct was transiently co-transfected with the single-chain anti-HLA-G VL (SEQ ID NO: 220)-anti-CD3 VH (SEQ ID NO: 413)-Fc with the “RRR” mutations in Expi-293 cells to form the bispecific antibody-Fc fusion molecules. The bispecific antibody was then purified using protein A, size-exclusion and ion exchange chromatography. This bispecific antibody generation approach is described in International Patent Application No. PCT/US2011/036419 (WO2011/143545) and Strop et al. JMB 420: 204-219, 2012, which is incorporated by reference in its entirety herein.

Example 4: HLA-G×CD3 Bispecific Antibody Binds to HLA-G Expressing Cancer Cell Lines and to Human CD4⁺ and CD8⁺ T Cells

To evaluate binding to HLA-G⁺ tumor cells, A549 lung adenocarcinoma cells engineered to express HLA-G or JEG-3 choriocarcinoma cells that endogenously express HLA-G were incubated with a titration of an HLA-G×CD3 bispecific antibody and the parental anti-HLA-G monoclonal antibody for 30 minutes at 4° C. in staining buffer (Phosphate Buffered Saline (PBS), 2% Fetal bovine serum (FBS), 6% mouse serum, 1:10 human Fc block (Becton Dickinson) and 2 mM EDTA). After incubation, cells were washed in wash buffer (PBS, 2% FBS, 2 mM EDTA) followed by a 30-minute incubation with a PE-conjugated anti-human Fc secondary antibody (Biolegend). A final wash was performed followed by sample acquisition using a BD Celesta flow cytometer (Becton Dickinson). Sample data was exported as FCS files and analyzed using FlowJo software v10 (Tree Star, Inc.).

The results are shown in FIG. 1A and FIG. 1B. Negative controls included JEG-3 HLA-G KO cells generated by CRISPR-Cas9 gene editing and A549 parental cells.

Binding of an HLA-G×CD3 bispecific antibody to CD3 was evaluated on primary human T cells. Briefly, pan T cells were isolated by negative selection using a pan T cell negative isolation kit (StemCell Technologies). Similar to the method used to evaluate tumor cell binding, T cells were incubated with a titration of an HLA-G×CD3 bispecific antibody followed by a 30-minute incubation with a PE-conjugated anti-human Fc secondary antibody (Biolegend). For the parental anti-CD3 antibody, a PE-conjugated anti-mouse Fc secondary antibody (Biolegend) was used. Cells were subsequently washed twice with wash buffer and then stained with fluorescently conjugated antibodies against CD4, CD8, and CD28 for 30 minutes at 4° C. A final wash was performed followed by sample acquisition using a BD Celesta flow cytometer (Becton Dickinson). Sample data was exported as FCS files and analyzed using FlowJo software v10 (Tree Star, Inc.). Gating was performed on CD28⁺CD4⁺ T cells and CD28⁺CD8⁺ T cells. Results from 2 representative donors are shown in FIG. 2.

Example 5: HLA-G×CD3 Bispecific Antibody Induces T-Cell Mediated Cellular Cytotoxicity

To demonstrate that an HLA-G×CD3 bispecific antibody can induce killing of HLA-G⁺ cancer cells by human T cells, A549-HLA-G⁺ or JEG-3 cells were co-cultured with human peripheral blood mononuclear cells (PBMC). Negative controls included JEG-3 HLA-G KO cells and A549 parental cells, neither of which express detectable levels of HLA-G. Isolated PBMC (effector cells) were plated in complete RPMI (cRPMI) in a 96-well flat bottom plate at 400,000 cells/well. The effector cells were subsequently incubated with the HLA-G×CD3 bispecific antibody for 1 hour at 37° C., 5% CO₂. Target cells (A549 parental cells, A549-HLA-G⁺ cells, JEG-3 cells or JEG-3 HLA-G KO cells) were stained with 1:1000 CellTrace Violet at 37° C. in PBS, washed and plated in cRPMI at 10,000 cells/well. The mixture of effector cells and HLA-G×CD3 bispecific antibody was then combined with the target cells and incubated for 48 hours at 37° C., 5% CO₂. The final ratio of PBMC to target cells was 40:1.

After the 48-hour incubation, cells were washed once in 4° C. PBS, then resuspended in 50 μL TrypLE Express Enzyme (1×) with phenol red. The cells were incubated with TrypLE for 7 minutes at 37° C., 5% CO₂before being quenched with 150 μL cRPMI. After quenching the enzyme, the cells were washed once in 4° C. wash buffer (Phosphate Buffered Saline, 2% FBS, 2 mM EDTA), and then stained with 1:2000 Fixable Viability Dye eFluor™ 780 (Invitrogen) for 30 minutes at 4° C. Cells were washed again in 4° C. wash buffer before being resuspended in wash buffer and analyzed for percent dead target cells by flow cytometry analysis on a BD LSRFortessa. Percent of dead target cells was determined by gating on CTV positive cells, then dividing the Fixable Viability Dye positive portion of these cells by the total CTV count.

FIG. 3A and FIG. 3B demonstrate the titration of an HLA-G×CD3 bispecific antibody to induce T-cell mediated cytotoxicity of A549-HLA-G⁺ cells and JEG-3 cells, respectively.

TABLE S

Sequences.

SEQ ID

NO:
Region
Scheme/Clone
Sequence

1
CDR-H1
Chothia
GGSISSSDY

2
CDR-H1
Chothia
GGSISSSST

3
CDR-H1
Chothia
GGSISSSDT

4
CDR-H1
Chothia
GGSISSADN

5
CDR-H1
Chothia
GGSVSSSST

6
CDR-H1
Chothia
GYSISSGY

7
CDR-H1
Chothia
GYSILSGY

8
CDR-H1
Chothia
GYSISSGH

9
CDR-H1
Chothia
GYSISSGF

10
CDR-H1
Chothia
GFTFDNY

11
CDR-H1
Chothia
GFTFSDY

12
CDR-H1
Chothia
GFTFSSS

13
CDR-H1
Chothia
GGSISSSN

14
CDR-H1
Chothia
GGSISSSSY

15

16

17

18
CDR-H1
Kabat
SSDYYWG

19
CDR-H1
Kabat
SSSTYWA

20
CDR-H1
Kabat
SSSTYWG

21
CDR-H1
Kabat
SSDTYWG

22
CDR-H1
Kabat
SADNYWG

23
CDR-H1
Kabat
SSSTYWS

24
CDR-H1
Kabat
SGYYWG

25
CDR-H1
Kabat
SGYYWF

26
CDR-H1
Kabat
SGHYWI

27
CDR-H1
Kabat
SGFYWT

28
CDR-H1
Kabat
SGYYWL

29
CDR-H1
Kabat
SGHYWT

30
CDR-H1
Kabat
NYAMH

31
CDR-H1
Kabat
DYYMS

32
CDR-H1
Kabat
SSAMA

33
CDR-H1
Kabat
SSNWWS

34
CDR-H1
Kabat
SSSYYWG

35

36

37

38
CDR-H2
Chothia
YYSGS

39
CDR-H2
Chothia
SSSGS

40
CDR-H2
Chothia
HHSGA

41
CDR-H2
Chothia
HYSGS

42
CDR-H2
Chothia
AYSGS

43
CDR-H2
Chothia
SYNAL

44
CDR-H2
Chothia
YHSGS

45
CDR-H2
Chothia
YHSAS

46
CDR-H2
Chothia
SARAGI

47
CDR-H2
Chothia
ASSGSV

48
CDR-H2
Chothia
SGSGIT

49
CDR-H2
Chothia
SYSGS

50
CDR-H2
Chothia
SSSGST

51

52

53

54
CDR-H2
Kabat
SIYYSGSTYYNPSLKS

55
CDR-H2
Kabat
SISSSGSTYYNPSLKS

56
CDR-H2
Kabat
SIHHSGATYYNPSLKS

57
CDR-H2
Kabat
SIHYSGSTLYNPSLKS

58
CDR-H2
Kabat
SIHYSGSTYYNPSLKS

59
CDR-H2
Kabat
GIAYSGSTYYNPSLKS

60
CDR-H2
Kabat
SISYNALTYYNPSLKS

61
CDR-H2
Kabat
SIYHSGSTYYNPSLKS

62
CDR-H2
Kabat
GIYHSASTAYNPSLKS

63
CDR-H2
Kabat
GIYHSGSTYYNPSLKS

64
CDR-H2
Kabat
AIYHSGSTVYNPSLKS

65
CDR-H2
Kabat
GIYHSGSTAYNPSLKS

66
CDR-H2
Kabat
AISARAGITYYADSVKG

67
CDR-H2
Kabat
YIASSGSVIYYADSVKG

68
CDR-H2
Kabat
TISGSGITTWYADSVKG

69
CDR-H2
Kabat
EIYHSGSTNYNPSLKS

70
CDR-H2
Kabat
SISYSGSTYYNPSLKS

71
CDR-H2
Kabat
YISSSGSTIYYADSVKG

72

73

74

75

76
CDR-H3

GVRRAVPFDY

77
CDR-H3

GIARAVPFDY

78
CDR-H3

GPKRAVPFDY

79
CDR-H3

GVRRAVPFVD

80
CDR-H3

GVRRAVPFQR

81
CDR-H3

GTRRAVPFDY

82
CDR-H3

GVRRAVPFAD

83
CDR-H3

GIRRAVPFDY

84
CDR-H3

GQFRAVPFDY

85
CDR-H3

GGTHTYSRGPMDV

86
CDR-H3

GGTHTYSRGPFDV

87
CDR-H3

GGTPIYSRGPLDV

88
CDR-H3

GGGQTYSRGPLDV

89
CDR-H3

GGGATYSRGPLDV

90
CDR-H3

GGTHTYSRGPLDV

91
CDR-H3

GGTVKYSRGPLDV

92
CDR-H3

GGQVTYSRGPLDV

93
CDR-H3

GGEVTYSRGPLDV

94
CDR-H3

RIGYSYGTAPPFDV

95
CDR-H3

HGTPRAFDI

96
CDR-H3

GSRHLNAFNR

97
CDR-H3

GVYHYDPYGMDV

98
CDR-H3

TELGKMHFDY

99
CDR-H3

GSPRYMQD

100
CDR-H3

HSSLGTHNWFDP

101
CDR-H3

EGALSYSWLAAFDI

102

103

104

105
CDR-L1

RASQSVSSSYLA

106
CDR-L1

GASQSVSSDYLA

107
CDR-L1

QASQAVSSNYLA

108
CDR-L1

GASQSVSSAFLA

109
CDR-L1

RASQSVSSTYLA

110
CDR-L1

QASQSVSSSYLA

111
CDR-L1

KASQAVSSSYLA

112
CDR-L1

EASQSVSSSYLA

113
CDR-L1

EASQSVSASYLA

114
CDR-L1

EASQSVSSAYLA

115
CDR-L1

RVSQSVSDAYLA

116
CDR-L1

EVSQSVSASYLA

117
CDR-L1

RASQSVSSAYLA

118
CDR-L1

RASNAVSSSYLA

119
CDR-L1

RASQSINSWLA

120
CDR-L1

AASQGISSDLA

121
CDR-L1

RASQDISTYLN

122
CDR-L1

RSSQSLLHSNGYNYLD

123
CDR-L1

RASQSISSYLN

124
CDR-L1

RASQSVSSNLA

125

126

127

128
CDR-L2

GASSRAT

129
CDR-L2

GAYSLAT

130
CDR-L2

GASARAT

131
CDR-L2

GASSREA

132
CDR-L2

GASNRAA

133
CDR-L2

GASSRQD

134
CDR-L2

GASNRAT

135
CDR-L2

DASSRAS

136
CDR-L2

DASTRAT

137
CDR-L2

GASDRAN

138
CDR-L2

GASYRAT

139
CDR-L2

DASSLES

140
CDR-L2

SASSTQS

141
CDR-L2

DAFNLET

142
CDR-L2

LGSNRAS

143
CDR-L2

GASRRAT

144
CDR-L2

AASSLQS

145
CDR-L2

GASTRAT

146

147

148

149
CDR-L3

QQAVHSPYT

150
CDR-L3

QWAVHSPYT

151
CDR-L3

QQVVHSPYT

152
CDR-L3

QQTVHSPYT

153
CDR-L3

QQAIHSPYT

154
CDR-L3

QQHSSYPPT

155
CDR-L3

QQHSLYPPT

156
CDR-L3

QQFSSYPPT

157
CDR-L3

QQVSSYPPT

158
CDR-L3

QQHSIYPPT

159
CDR-L3

QQYDSHIT

160
CDR-L3

QQAYLYPIT

161
CDR-L3

QQLPFLPIT

162
CDR-L3

MQALGGPWT

163
CDR-L3

QQYVSDPIT

164
CDR-L3

QQVGSSPIT

165
CDR-L3

QQSHLVPRT

166
CDR-L3

QQANHHPPFT

167

168

169

170
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

YYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFDYWGQGTLVTVSS

171
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWAWIRQPPGKGLEWIGSISSSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GIARAVPFDYWGQGTLVTVSS

172
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWGWIRQSPGKGLEWIGSIHHSGATYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GPKRAVPFDYWGQGTLVTVSS

173
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFVDWGQGTLVTVSS

174
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSISSAD

NYWGWIRQPPGKGLEWIGSIHYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFQRWGQGTLVTVSS

175
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

TYWGWIRQPPGKGPEWIGSIHYSGSTLYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFDYWGQGTLVTVSS

176
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFDYWGQGTLVTVSS

177
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWSWIRQPPGKGLEWIGSISYNALTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GTRRAVPFDYWGQGTLVTVSS

178
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFADWGQGTLVTVSS

179
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSVSSSS

TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFDYWGQGTLVTVSS

180
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GTRRAVPFDYWGQGTLVTVSS

181
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GIRRAVPFDYWGQGTLVTVSS

182
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GQFRAVPFDYWGQGTLVTVSS

183
VH

QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY

YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTHTYSRGPMDVWGQGTTVTVSS

184
VH

QLQLQESGPRLVKPSETLSLTCAVSGYSISSGY

YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTHTYSRGPFDVWGQGTTVTVSS

185
VH

LVQLQESGPGLVKPSETLSLTCAVSGYSILSGY

YWFWIRQPPGKGLEWIGGIYHSASTAYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTPIYSRGPLDVWGQGTTVTVSS

186
VH

QVQLQESGPGLVKPSETLSLTCAVSGYSISSGH

YWIWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS

RVTISVDTSKDQFSLKLSSVTAADTAVYYCARG

GGQTYSRGPLDVWGQGTTVTVSS

187
VH

QVQLQESGPGLVKPPETLSLTCAVSGYSISSGH

YWIWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GGATYSRGPLDVWGQGTTVTVSS

188
VH

QVQLQESGPGLVKPSETLSLTCAVSGYSILSGY

YWFWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTHTYSRGPLDVWGQGTTVTVSS

189
VH

QVQLQESGPGLVKPSETLSLTCAVSGYSISSGF

YWTWIRQPPGKGLEWIGAIYHSGSTVYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTHTYSRGPLDVWGQGTTVTVSS

190
VH

QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY

YWLWIRQPPGKGLEWIGGIYHSASTAYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTVKYSRGPLDVWGQGTTVTVSS

191
VH

QVQLQESGPGLVKPSETLSLTCAVSGYSISSGH

YWTWIRQPPGKGLEWIGAIYHSGSTVYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GQVTYSRGPLDVWGQGTTVTVSS

192
VH

QVQLQESGPGLVKPSETLSLTCAVSGYSILSGY

YWFWIRQPPGKGLEWIGGIYHSGSTAYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GEVTYSRGPLDVWGQGTTVTVSS

193
VH

EVQLLESGGGLVQPGGSLRLSCAASGFTFDNYA

MHWVRQAPGKGLEWVSAISARAGITYYADSVKG

RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARR

IGYSYGTAPPFDVWGQGTTVTVSS

194
VH

QVQLVESGGGLVQPGGSLRLSCAASGFTFSDYY

MSWIRQAPGKGLEWVSYIASSGSVIYYADSVKG

RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARH

GTPRAFDIWGQGTTVTVSS

195
VH

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSSA

MAWVRQAPGKGLEWVSTISGSGITTWYADSVKG

RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKG

SRHLNAFNRWGQGTTVTVSS

196
VH

QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSN

WWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKS

RVTISVDKSKNQFSLKLSSVTAADTAVYYCARG

VYHYDPYGMDVWGQGTTVTVSS

197
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

YYWGWIRQPPGKGLEWIGSISYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

TELGKMHFDYWGQGTLVTVSS

198
VH

QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

YYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GSPRYMQDWGQGTLVTVSS

199
VH

QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYY

MSWIRQAPGKGLEWVSYISSSGSTIYYADSVKG

RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARH

SSLGTHNWFDPWGQGTLVTVSS

200
VH

QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY

YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARE

GALSYSWLAAFDIWGQGTMVTVSS

201

202

203

204
VL

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY

LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQAVHSPYTF

GGGTKVEIK

205
VL

EIVLTQSPGTLSLSPGERATLSCGASQSVSSDY

LAWYQQKPGQAPRLLIYGAYSLATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQWAVHSPYTF

GGGTKVEIK

206
VL

EIVLTQSPGTLSLSPGERATLSCQASQAVSSNY

LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF

GGGTKVEIK

207
VL

EIVLTQSPGTLSLSPGERATLSCGASQSVSSAF

LAWYQQKPGQAPRLLIYGASARATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF

GGGTKVEIK

208
VL

EIVLTQSPGTLSLSPGERATLSCRASQSVSSTY

LAWYQQKPGQAPRLLIYGASSREAGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQTVHSPYTF

GGGTKVEIK

209
VL

EIVLTQSPGTLSLSPGERATLSCQASQAVSSNY

LAWYQQKPGQAPRLLIYGASNRAAGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQAIHSPYTF

GGGTKVEIK

210
VL

EIVLTQSPGTLSLSPGERATLSCQASQSVSSSY

LAWYQQKPGQAPRLLIYGASNRAAGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF

GGGTKVEIK

211
VL

EIVLTQSPGTLSLSPGERATLSCKASQAVSSSY

LAWYQQKPGQAPRLLIYGASSRQDGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF

GGGTKVEIK

212
VL

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY

LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQHSSYPPTF

GGGTKVEIK

213
VL

EIVLTQSPGTLSLSPGERATLSCEASQSVSSSY

LAWYQQKPGQAPRLLIYGASNRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF

GGGTKVEIK

214
VL

EIVLTQSPGTLSLSPGERATLSCEASQSVSASY

LAWYQQKPGQAPRLLIYDASSRASGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQFSSYPPTF

GGGTKVEIK

215
VL

EIVLTQSPGTLSLSPGERATLSCEASQSVSSAY

LAWYQQKPGQAPRLLIYDASTRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQVSSYPPTF

GGGTKVEIK

216
VL

EIVLTQSPGTLSLSPGERAALSCRVSQSVSDAY

LAWYQQKPGQAPRLLIYDASSRASGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQVSSYPPTF

GGGTKVEIK

217
VL

EIVLTQSPGTLSLSPGERATLSCEVSQSVSASY

LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF

GGGTKVEIK

218
VL

EIVLTQSPGTLSLSPGERATLSCRASQSVSSAY

LAWYQQKPGQAPRLLIYGASDRANGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF

GGGTKVEIK

219
VL

EIVLTQSPGTLSLSPGERATLSCRASNAVSSSY

LAWYQQKPGQAPRLLIYGASDRANGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQHSIYPPTF

GGGTKVEIK

220
VL

EIVLTQSPGTLSLSPGERATLSCRASNAVSSSY

LAWYQQKPGQAPRLLIYGASYRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF

GGGTKVEIK

221
VL

DIQMTQSPSTLSASVGDRVTITCRASQSINSWL

AWYQQKPGKAPKLLISDASSLESGVPSRFSGSG

SGTEFTLTISSLQPDDFATYYCQQYDSHITFGG

GTKVEIK

222
VL

DIQMTQSPSSVSASVGDRVTITCAASQGISSDL

AWYQQKPGKAPKLLIYSASSTQSGVPSRFSGSG

SGTDFTLTISSLQPEDFATYYCQQAYLYPITFG

GGTKVEIK

223
VL

GVQMTQSPSSLSASVGDRVTITCRASQDISTYL

NWYQQKPGKAPKLLIYDAFNLETGVPSRFSGSG

SGTDFTFTISSLQPEDIATYYCQQLPFLPITFG

GGTKVEIK

224
VL

DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSN

GYNYLDWYLQKPGQS PQLLIYLGSNRASGVPDR

FSGSGSGTDFTLKISRVEAEDVGVYYCMQALGG

PWTFGGGTKVEIK

225
VL

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY

LAWYQQKPGQAPRLLIYGASRRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQYVSDPITF

GGGTKVEIK

226
VL

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY

LAWYQQKPGQAPRLLIYGASRRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQVGSSPITF

GGGTKVEIK

227
VL

DIQMTQSPSSLSASVGDRVTITCRASQSISSYL

NWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSG

SGTDFTLTISSLQPEDFATYYCQQSHLVPRTFG

GGTKVEIK

228
VL

EIVMTQSPATLSVSPGERATLSCRASQSVSSNL

AWYQQKPGQAPRLLIYGASTRATGIPARFSGSG

SGTEFTLTISSLQSEDFAVYYCQQANHHPPFTF

GGGTKVEIK

229

230

231

232
IGG1 AAA HC
33343
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

YYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP

CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE

QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA

LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS

VMHEALHNHYTQKSLSLSPGK

233
IGG1 AAA HC
37268
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWAWIRQPPGKGLEWIGSISSSGSTYYNPSLK

SRVT1SVDTSKNQFSLKLSSVTAADTAVYYCAR

GIARAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP

CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE

QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA

LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS

VMHEALHNHYTQKSLSLSPGK

234
IGG1 AAA HC
37269
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWGWIRQSPGKGLEWIGSIHHSGATYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GPKRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP

CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE

QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA

LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS

VMHEALHNHYTQKSLSLSPGK

235
IGG1 AAA HC
37271
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFVDWGQGTLVTVSSASTKGPSVFPLA

PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP

CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE

QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA

LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS

VMHEALHNHYTQKSLSLSPGK

236
IGG1 AAA HC
37272
QLQLQESGPGLVKPSETLSLTCTVSGGSISSAD

NYWGWIRQPPGKGLEWIGSIHYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFQRWGQGTLVTVSSASTKGPSVFPLA

PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP

CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE

QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA

LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS

VMHEALHNHYTQKSLSLSPGK

237
IGG1 AAA HC
37277
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

TYWGWIRQPPGKGPEWIGSIHYSGSTLYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP

CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE

QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA

LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS

VMHEALHNHYTQKSLSLSPGK

238
IGG1 AAA HC
38373
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP

CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE

QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA

LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS

VMHEALHNHYTQKSLSLSPGK

239
IGG1 AAA HC
38375
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWSWIRQPPGKGLEWIGSISYNALTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GTRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP

CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE

QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA

LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS

VMHEALHNHYTQKSLSLSPGK

240
IGG1 AAA HC
38379
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFADWGQGTLVTVSSASTKGPSVFPLA

PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP

CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE

QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA

LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS

VMHEALHNHYTQKSLSLSPGK

241
IGG1 AAA HC
38381
QLQLQESGPGLVKPSETLSLTCTVSGGSVSSSS

TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP

CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE

QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA

LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS

VMHEALHNHYTQKSLSLSPGK

242
IGG1 AAA HC
38383
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GTRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP

CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE

QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA

LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS

VMHEALHNHYTQKSLSLSPGK

243
IGG1 AAA HC
38386
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GIRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP

CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE

QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA

LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS

VMHEALHNHYTQKSLSLSPGK

244
IGG1 AAA HC
37273
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GQFRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP

CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE

QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA

LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS

VMHEALHNHYTQKSLSLSPGK

245
IGG1 AAA HC
33361
QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY

YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTHTYSRGPMDVWGQGTTVTVSSASTKGPSVFP

LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC

PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV

TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR

EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN

KALPAPIEKTISKAKGQPREPQVYTLPPSREEM

TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY

KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS

CSVMHEALHNHYTQKSLSLSPGK

246
IGG1 AAA HC
35624
QLQLQESGPRLVKPSETLSLTCAVSGYSISSGY

YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTHTYSRGPFDVWGQGTTVTVSSASTKGPSVFP

LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC

PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV

TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR

EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN

KALPAPIEKTISKAKGQPREPQVYTLPPSREEM

TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY

KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS

CSVMHEALHNHYTQKSLSLSPGK

247
IGG1 AAA HC
38410
LVQLQESGPGLVKPSETLSLTCAVSGYSILSGY

YWFWIRQPPGKGLEWIGGIYHSASTAYNPSLKS

RVT1SVDTSKNQFSLKLSSVTAADTAVYYCARG

GTPIYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC

PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV

TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR

EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN

KALPAPIEKTISKAKGQPREPQVYTLPPSREEM

TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY

KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS

CSVMHEALHNHYTQKSLSLSPGK

248
IGG1 AAA HC
38418
QVQLQESGPGLVKPSETLSLTCAVSGYSISSGH

YWIWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS

RVTISVDTSKDQFSLKLSSVTAADTAVYYCARG

GGQTYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC

PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV

TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR

EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN

KALPAPIEKTISKAKGQPREPQVYTLPPSREEM

TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY

KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS

CSVMHEALHNHYTQKSLSLSPGK

249
IGG1 AAA HC
38420
QVQLQESGPGLVKPPETLSLTCAVSGYSISSGH

YWIWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GGATYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC

PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV

TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR

EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN

KALPAPIEKTISKAKGQPREPQVYTLPPSREEM

TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY

KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS

CSVMHEALHNHYTQKSLSLSPGK

250
IGG1 AAA HC
38421
QVQLQESGPGLVKPSETLSLTCAVSGYSILSGY

YWFWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS

RVT1SVDTSKNQFSLKLSSVTAADTAVYYCARG

GTHTYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC

PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV

TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR

EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN

KALPAPIEKTISKAKGQPREPQVYTLPPSREEM

TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY

KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS

CSVMHEALHNHYTQKSLSLSPGK

251
IGG1 AAA HC
38422
QVQLQESGPGLVKPSETLSLTCAVSGYSISSGF

YWTWIRQPPGKGLEWIGAIYHSGSTVYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTHTYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC

PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV

TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR

EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN

KALPAPIEKTISKAKGQPREPQVYTLPPSREEM

TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY

KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS

CSVMHEALHNHYTQKSLSLSPGK

252
IGG1 AAA HC
38424
QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY

YWLWIRQPPGKGLEWIGGIYHSASTAYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTVKYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC

PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV

TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR

EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN

KALPAPIEKTISKAKGQPREPQVYTLPPSREEM

TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY

KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS

CSVMHEALHNHYTQKSLSLSPGK

253
IGG1 AAA HC
38425
QVQLQESGPGLVKPSETLSLTCAVSGYSISSGH

YWTWIRQPPGKGLEWIGAIYHSGSTVYNPSLKS

RVT1SVDTSKNQFSLKLSSVTAADTAVYYCARG

GQVTYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC

PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV

TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR

EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN

KALPAPIEKTISKAKGQPREPQVYTLPPSREEM

TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY

KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS

CSVMHEALHNHYTQKSLSLSPGK

254
IGG1 AAA HC
38426
QVQLQESGPGLVKPSETLSLTCAVSGYSILSGY

YWFWIRQPPGKGLEWIGGIYHSGSTAYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GEVTYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC

PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV

TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR

EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN

KALPAPIEKTISKAKGQPREPQVYTLPPSREEM

TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY

KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS

CSVMHEALHNHYTQKSLSLSPGK

255
IGG1 AAA HC
37323
EVQLLESGGGLVQPGGSLRLSCAASGFTFDNYA

MHWVRQAPGKGLEWVSAISARAGITYYADSVKG

RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARR

IGYSYGTAPPFDVWGQGTTVTVSSASTKGPSVF

PLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN

SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS

LGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT

CPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPE

VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP

REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS

NKALPAPIEKTISKAKGQPREPQVYTLPPSREE

MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN

YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF

SCSVMHEALHNHYTQKSLSLSPGK

256
IGG1 AAA HC
38389
QVQLVESGGGLVQPGGSLRLSCAASGFTFSDYY

MSWIRQAPGKGLEWVSYIASSGSVIYYADSVKG

RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARH

GTPRAFDIWGQGTTVTVSSASTKGPSVFPLAPS

SKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT

SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT

YICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCP

APEAAGAPSVFLFPPKPKDTLMISRTPEVTCVV

VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY

NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP

APIEKTISKAKGQPREPQVYTLPPSREEMTKNQ

VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP

PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM

HEALHNHYTQKSLSLSPGK

257
IGG1 AAA HC
38358
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSSA

MAWVRQAPGKGLEWVSTISGSGITTWYADSVKG

RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKG

SRHLNAFNRWGQGTTVTVSSASTKGPSVFPLAP

SSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL

TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ

TYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPC

PAPEAAGAPSVFLFPPKPKDTLMISRTPEVTCV

VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ

YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL

PAPIEKTISKAKGQPREPQVYTLPPSREEMTKN

QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT

PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV

MHEALHNHYTQKSLSLSPGK

258
IGG1 AAA HC
33303
QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSN

WWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKS

RVTISVDKSKNQFSLKLSSVTAADTAVYYCARG

VYHYDPYGMDVWGQGTTVTVSSASTKGPSVFPL

APSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG

ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG

TQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP

PCPAPEAAGAPSVFLFPPKPKDTLMISRTPEVT

CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE

EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK

ALPAPIEKTISKAKGQPREPQVYTLPPSREEMT

KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK

TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC

SVMHEALHNHYTQKSLSLSPGK

259
IGG1 AAA HC
33342
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

YYWGWIRQPPGKGLEWIGSISYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

TELGKMHFDYWGQGTLVTVSSASTKGPSVFPLA

PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP

CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE

QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA

LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS

VMHEALHNHYTQKSLSLSPGK

260
IGG1 AAA HC
33299
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

YYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GSPRYMQDWGQGTLVTVSSASTKGPSVFPLAPS

SKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT

SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT

YICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCP

APEAAGAPSVFLFPPKPKDTLMISRTPEVTCVV

VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY

NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP

APIEKTISKAKGQPREPQVYTLPPSREEMTKNQ

VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP

PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM

HEALHNHYTQKSLSLSPGK

261
IGG1 AAA HC
33351
QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYY

MSWIRQAPGKGLEWVSYISSSGSTIYYADSVKG

RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARH

SSLGTHNWFDPWGQGTLVTVSSASTKGPSVFPL

APSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG

ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG

TQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP

PCPAPEAAGAPSVFLFPPKPKDTLMISRTPEVT

CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE

EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK

ALPAPIEKTISKAKGQPREPQVYTLPPSREEMT

KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK

TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC

SVMHEALHNHYTQKSLSLSPGK

262
IGG1 AAA HC
33357
QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY

YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS

RVT1SVDTSKNQFSLKLSSVTAADTAVYYCARE

GALSYSWLAAFDIWGQGTMVTVSSASTKGPSVF

PLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN

SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS

LGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT

CPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPE

VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP

REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS

NKALPAPIEKTISKAKGQPREPQVYTLPPSREE

MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN

YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF

SCSVMHEALHNHYTQKSLSLSPGK

263

264

265

266
IGG4 HC
33343
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

YYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA

PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV

DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN

STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS

SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH

EALHNHYTQKSLSLSPGK

267
IGG4 HC
37268
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWAWIRQPPGKGLEWIGSISSSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GIARAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA

PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV

DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN

STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS

SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH

EALHNHYTQKSLSLSPGK

268
IGG4 HC
37269
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWGWIRQSPGKGLEWIGSIHHSGATYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GPKRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA

PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV

DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN

STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS

SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH

EALHNHYTQKSLSLSPGK

269
IGG4 HC
37271
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFVDWGQGTLVTVSSASTKGPSVFPLA

PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA

PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV

DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN

STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS

SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH

EALHNHYTQKSLSLSPGK

270
IGG4 HC
37272
QLQLQESGPGLVKPSETLSLTCTVSGGSISSAD

NYWGWIRQPPGKGLEWIGSIHYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFQRWGQGTLVTVSSASTKGPSVFPLA

PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA

PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV

DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN

STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS

SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH

EALHNHYTQKSLSLSPGK

271
IGG4 HC
37277
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

TYWGWIRQPPGKGPEWIGSIHYSGSTLYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA

PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV

DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN

STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS

SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH

EALHNHYTQKSLSLSPGK

272
IGG4 HC
38373
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA

PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV

DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN

STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS

SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH

EALHNHYTQKSLSLSPGK

273
IGG4 HC
38375
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWSWIRQPPGKGLEWIGSISYNALTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GTRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA

PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV

DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN

STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS

SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH

EALHNHYTQKSLSLSPGK

274
IGG4 HC
38379
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFADWGQGTLVTVSSASTKGPSVFPLA

PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA

PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV

DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN

STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS

SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH

EALHNHYTQKSLSLSPGK

275
IGG4 HC
38381
QLQLQESGPGLVKPSETLSLTCTVSGGSVSSSS

TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA

PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV

DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN

STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS

SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH

EALHNHYTQKSLSLSPGK

276
IGG4 HC
38383
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GTRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA

PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV

DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN

STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS

SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH

EALHNHYTQKSLSLSPGK

277
IGG4 HC
38386
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GIRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA

PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV

DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN

STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS

SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH

EALHNHYTQKSLSLSPGK

278
IGG4 HC
37273
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GQFRAVPFDYWGQGTLVTVSSASTKGPSVFPLA

PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA

PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV

DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN

STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS

SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH

EALHNHYTQKSLSLSPGK

279
IGG4 HC
33361
QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY

YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTHTYSRGPMDVWGQGTTVTVSSASTKGPSVFP

LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC

PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV

VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ

FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL

PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN

QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT

PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV

MHEALHNHYTQKSLSLSPGK

280
IGG4 HC
35624
QLQLQESGPRLVKPSETLSLTCAVSGYSISSGY

YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTHTYSRGPFDVWGQGTTVTVSSASTKGPSVFP

LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC

PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV

VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ

FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL

PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN

QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT

PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV

MHEALHNHYTQKSLSLSPGK

281
IGG4 HC
38410
LVQLQESGPGLVKPSETLSLTCAVSGYSILSGY

YWFWIRQPPGKGLEWIGGIYHSASTAYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTPIYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC

PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV

VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ

FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL

PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN

QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT

PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV

MHEALHNHYTQKSLSLSPGK

282
IGG4 HC
38418
QVQLQESGPGLVKPSETLSLTCAVSGYSISSGH

YWIWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS

RVTISVDTSKDQFSLKLSSVTAADTAVYYCARG

GGQTYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC

PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV

VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ

FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL

PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN

QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT

PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV

MHEALHNHYTQKSLSLSPGK

283
IGG4 HC
38420
QVQLQESGPGLVKPPETLSLTCAVSGYSISSGH

YWIWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GGATYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC

PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV

VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ

FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL

PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN

QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT

PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV

MHEALHNHYTQKSLSLSPGK

284
IGG4 HC
38421
QVQLQESGPGLVKPSETLSLTCAVSGYSILSGY

YWFWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTHTYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC

PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV

VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ

FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL

PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN

QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT

PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV

MHEALHNHYTQKSLSLSPGK

285
IGG4 HC
38422
QVQLQESGPGLVKPSETLSLTCAVSGYSISSGF

YWTWIRQPPGKGLEWIGAIYHSGSTVYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTHTYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC

PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV

VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ

FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL

PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN

QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT

PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV

MHEALHNHYTQKSLSLSPGK

286
IGG4 HC
38424
QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY

YWLWIRQPPGKGLEWIGGIYHSASTAYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GTVKYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC

PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV

VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ

FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL

PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN

QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT

PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV

MHEALHNHYTQKSLSLSPGK

287
IGG4 HC
38425
QVQLQESGPGLVKPSETLSLTCAVSGYSISSGH

YWTWIRQPPGKGLEWIGAIYHSGSTVYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GQVTYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC

PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV

VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ

FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL

PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN

QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT

PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV

MHEALHNHYTQKSLSLSPGK

288
IGG4 HC
38426
QVQLQESGPGLVKPSETLSLTCAVSGYSILSGY

YWFWIRQPPGKGLEWIGGIYHSGSTAYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG

GEVTYSRGPLDVWGQGTTVTVSSASTKGPSVFP

LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS

GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL

GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC

PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV

VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ

FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL

PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN

QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT

PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV

MHEALHNHYTQKSLSLSPGK

289
IGG4 HC
37323
EVQLLESGGGLVQPGGSLRLSCAASGFTFDNYA

MHWVRQAPGKGLEWVSAISARAGITYYADSVKG

RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARR

IGYSYGTAPPFDVWGQGTTVTVSSASTKGPSVF

PLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN

SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS

LGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPP

CPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREE

QFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKG

LPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCS

VMHEALHNHYTQKSLSLSPGK

290
IGG4 HC
38389
QVQLVESGGGLVQPGGSLRLSCAASGFTFSDYY

MSWIRQAPGKGLEWVSYIASSGSVIYYADSVKG

RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARH

GTPRAFDIWGQGTTVTVSSASTKGPSVFPLAPC

SRSTSESTAALGCLVKDYFPEPVTVSWNSGALT

SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKT

YTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPE

FLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV

SQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST

YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSI

EKTISKAKGQPREPQVYTLPPSQEEMTKNQVSL

TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL

DSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEA

LHNHYTQKSLSLSPGK

291
IGG4 HC
38358
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSSA

MAWVRQAPGKGLEWVSTISGSGITTWYADSVKG

RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKG

SRHLNAFNRWGQGTTVTVSSASTKGPSVFPLAP

CSRSTSESTAALGCLVKDYFPEPVTVSWNSGAL

TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTK

TYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAP

EFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD

VSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNS

TYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSS

IEKTISKAKGQPREPQVYTLPPSQEEMTKNQVS

LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV

LDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHE

ALHNHYTQKSLSLSPGK

292
IGG4 HC
33303
QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSN

WWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKS

RVTISVDKSKNQFSLKLSSVTAADTAVYYCARG

VYHYDPYGMDVWGQGTTVTVSSASTKGPSVFPL

APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG

ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG

TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP

APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV

VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF

NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP

SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ

VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP

PVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVM

HEALHNHYTQKSLSLSPGK

293
IGG4 HC
33342
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS

YYWGWIRQPPGKGLEWIGSISYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

TELGKMHFDYWGQGTLVTVSSASTKGPSVFPLA

PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA

LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT

KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA

PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV

DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN

STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS

SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV

SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH

EALHNHYTQKSLSLSPGK

294
IGG4 HC
33329
QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD

YYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLK

SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

GSPRYMQDWGQGTLVTVSSASTKGPSVFPLAPC

SRSTSESTAALGCLVKDYFPEPVTVSWNSGALT

SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKT

YTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPE

FLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV

SQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST

YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSI

EKTISKAKGQPREPQVYTLPPSQEEMTKNQVSL

TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL

DSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEA

LHNHYTQKSLSLSPGK

295
IGG4 HC
33351
QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYY

MSWIRQAPGKGLEWVSYISSSGSTIYYADSVKG

RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARH

SSLGTHNWFDPWGQGTLVTVSSASTKGPSVFPL

APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG

ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG

TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP

APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV

VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF

NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP

SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ

VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP

PVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVM

HEALHNHYTQKSLSLSPGK

296
IGG4 HC
33357
QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY

YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS

RVTISVDTSKNQFSLKLSSVTAADTAVYYCARE

GALSYSWLAAFDIWGQGTMVTVSSASTKGPSVF

PLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN

SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS

LGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPP

CPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTC

VVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREE

QFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKG

LPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK

NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT

TPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCS

VMHEALHNHYTQKSLSLSPGK

297

298

299

300
LC
33343
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY

LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQAVHSPYTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

301
LC
37268
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY

LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQAVHSPYTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

302
LC
37269
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY

LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQAVHSPYTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

303
LC
37271
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY

LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQAVHSPYTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

304
LC
37272
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY

LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQAVHSPYTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

305
LC
37277
EIVLTQSPGTLSLSPGERATLSCGASQSVSSDY

LAWYQQKPGQAPRLLIYGAYSLATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQWAVHSPYTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

306
LC
38373
EIVLTQSPGTLSLSPGERATLSCQASQAVSSNY

LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

307
LC
38375
EIVLTQSPGTLSLSPGERATLSCGASQSVSSAF

LAWYQQKPGQAPRLLIYGASARATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

308
LC
38379
EIVLTQSPGTLSLSPGERATLSCRASQSVSSTY

LAWYQQKPGQAPRLLIYGASSREAGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQTVHSPYTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

309
LC
38381
EIVLTQSPGTLSLSPGERATLSCQASQAVSSNY

LAWYQQKPGQAPRLLIYGASNRAAGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQAIHSPYTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

310
LC
38383
EIVLTQSPGTLSLSPGERATLSCQASQSVSSSY

LAWYQQKPGQAPRLLIYGASNRAAGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

311
LC
38386
EIVLTQSPGTLSLSPGERATLSCKASQAVSSSY

LAWYQQKPGQAPRLLIYGASSRQDGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

312
LC
37273
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY

LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQAVHSPYTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

313
LC
33361
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY

LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQHSSYPPTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

314
LC
35624
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY

LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQHSSYPPTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

315
LC
38410
EIVLTQSPGTLSLSPGERATLSCEASQSVSSSY

LAWYQQKPGQAPRLLIYGASNRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

316
LC
38418
EIVLTQSPGTLSLSPGERATLSCEASQSVSASY

LAWYQQKPGQAPRLLIYDASSRASGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQFSSYPPTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

317
LC
38420
EIVLTQSPGTLSLSPGERATLSCEASQSVSSAY

LAWYQQKPGQAPRLLIYDASTRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQVSSYPPTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

318
LC
38421
EIVLTQSPGTLSLSPGERAALSCRVSQSVSDAY

LAWYQQKPGQAPRLLIYDASSRASGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQVSSYPPTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

319
LC
38422
EIVLTQSPGTLSLSPGERATLSCEVSQSVSASY

LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

320
LC
38424
EIVLTQSPGTLSLSPGERATLSCRASQSVSSAY

LAWYQQKPGQAPRLLIYGASDRANGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

321
LC
38425
EIVLTQSPGTLSLSPGERATLSCRASNAVSSSY

LAWYQQKPGQAPRLLIYGASDRANGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQHSIYPPTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

322
LC
38426
EIVLTQSPGTLSLSPGERATLSCRASNAVSSSY

LAWYQQKPGQAPRLLIYGASYRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

323
LC
37323
DIQMTQSPSTLSASVGDRVTITCRASQSINSWL

AWYQQKPGKAPKLLISDASSLESGVPSRFSGSG

SGTEFTLTISSLQPDDFATYYCQQYDSHITFGG

GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVV

CLLNNFYPREAKVQWKVDNALQSGNSQESVTEQ

DSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ

GLSSPVTKSFNRGEC

324
LC
38389
DIQMTQSPSSVSASVGDRVTITCAASQGISSDL

AWYQQKPGKAPKLLIYSASSTQSGVPSRFSGSG

SGTDFTLTISSLQPEDFATYYCQQAYLYPITFG

GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV

VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE

QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH

QGLSSPVTKSFNRGEC

325
LC
38358
GVQMTQSPSSLSASVGDRVTITCRASQDISTYL

NWYQQKPGKAPKLLIYDAFNLETGVPSRFSGSG

SGTDFTFTISSLQPEDIATYYCQQLPFLPITFG

GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV

VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE

QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH

QGLSSPVTKSFNRGEC

326
LC
33303
DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSN

GYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDR

FSGSGSGTDFTLKISRVEAEDVGVYYCMQALGG

PWTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKS

GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ

ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYA

CEVTHQGLSSPVTKSFNRGEC

327
LC
33342
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY

LAWYQQKPGQAPRLLIYGASRRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQYVSDPITF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

328
LC
33299
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY

LAWYQQKPGQAPRLLIYGASRRATGIPDRFSGS

GSGTDFTLTISRLEPEDFAVYYCQQVGSSPITF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

329
LC
33351
DIQMTQSPSSLSASVGDRVTITCRASQSISSYL

NWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSG

SGTDFTLTISSLQPEDFATYYCQQSHLVPRTFG

GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV

VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE

QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH

QGLSSPVTKSFNRGEC

330
LC
33357
EIVMTQSPATLSVSPGERATLSCRASQSVSSNL

AWYQQKPGQAPRLLIYGASTRATGIPARFSGSG

SGTEFTLTISSLQSEDFAVYYCQQANHHPPFTF

GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS

VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT

EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT

HQGLSSPVTKSFNRGEC

331

332

333

334
Fc for IGG1

ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF

PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS

SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE

PKSCDKTHTCPPCPAPEAAGAPSVFLFPPKPKD

TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV

EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN

GKEYKCKVSNKALPAPIEKTISKAKGQPREPQV

YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW

ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK

SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

335
Fc region for

ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYF

IGG4

PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS

SVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVE

SKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLM

ISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVH

NAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKE

YKCKVSNKGLPSSIEKTISKAKGQPREPQVYTL

PPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESN

GQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRW

QEGNVFSCSVMHEALHNHYTQKSLSLSPGK

336
Kappa region

RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFY

for LC

PREAKVQWKVDNALQSGNSQESVTEQDSKDSTY

SLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT

KSFNRGEC

337

hHLA-Gl
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFS

AAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSAC

PRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDR

MNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGR

LLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQ

ISKRKCEAANVAEQRRAYLEGTCVEWLHRYLEN

GKEMLQRADPPKTHVTHHPVFDYEATLRCWALG

FYPAEIILTWQRDGEDQTQDVELVETRPAGDGT

FQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLR

WKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAV

LWRKKSSD

338

hHLA-G5
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFS

AAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSAC

PRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDR

MNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGR

LLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQ

ISKRKCEAANVAEQRRAYLEGTCVEWLHRYLEN

GKEMLQRADPPKTHVTHHPVFDYEATLRCWALG

FYPAEIILTWQRDGEDQTQDVELVETRPAGDGT

FQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLR

WSKEGDGGIMSVRESRSLSEDL

339

Cyno MHC-AG
MAVMAPRTLLLVLSGVLALTQPRAGSHSMRYFY

TAVSRPGRGQPRFIAVGYVDDTQFVRFDSDAES

PRMEPRAPWVEQEGPEYWDRETQNMKTATQTYQ

ANLRTLLRYYNQSEAGSHTFQKMYGCDLGPDGR

LLRGYEQFAYDGRDYIILNEDLRSWTAADMAAQ

NTQRKWEAAGAAEQHRTYLEGECLEWLRRYLEN

GKETLQRADPPKTNVTHHPVSDYEATLRCWALG

FYPAEITLTWQRDGEEQTEDTELVETRPTGDGT

FQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLR

WEPSSQSTILIVGIIAGLVLLGTVVTGAVVAAV

MWRRKS

340

Rhesus MHC-AG
LLLVLSGVLALTQTRAGSHSMRYFYTSMSRPGR

GQPRFIAVGYVDDTQFVRFDSDAESPRMEPRAP

WVEQEGPEYWDRETQNMKTATQTYRENLRTLLR

YYNQSEAGSHTIQKMYGCDLGPDGRLLRGYEQF

AYDGRDYIALNEDLRSWTAADMAAQFTQRKWEA

AGAAEQHRTYLEGECLEWLRRYLENGKETLQRA

DPPKTNVTHHPVSDYEATLRCWALGFYPAEITL

TWQRDGEEQTEDTELVETRPTGDGTFQKWAAVV

VPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQST

ILIVGIIAGLVLLGTWTGAVVAAVMWRRKSSD

R

341

hHLA-G ECD
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFS

with signal
AAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSAC

peptide
PRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDR

MNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGR

LLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQ

1SKRKCEAANVAEQRRAYLEGTCVEWLHRYLEN

GKEMLQRADPPKTHVTHHPVFDYEATLRCWALG

FYPAEIILTWQRDGEDQTQDVELVETRPAGDGT

FQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLR

W

342

hHLA-G ECD
GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQF

without signal
VRFDSDSACPRMEPRAPWVEQEGPEYWEEETRN

peptide
TKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMI

GCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRS

WTAADTAAQISKRKCEAANVAEQRRAYLEGTCV

EWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE

ATLRCWALGFYPAEIILTWQRDGEDQTQDVELV

ETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHE

GLPEPLMLRW

343

344

345

346
CDR-H1
Chothia
GYSFTGY

CD3

347
CDR-H1
Chothia
GYTFTRY

CD3

348
CDR-H1
Chothia
GFKFSGY

CD3

349
CDRH-1
Chothia
GYTFTNY

CD3

350

351

352

353

354
CDR-H1
Kabat
GYTMN

CD3

355
CDR-H1
Kabat
RYTMH

CD3

356
CDR-H1
Kabat
GYGMH

CD3

357
CDR-H1
Kabat
NYYIH

CD3

358

359

360

361

362
CDR-H2
Chothia
NPYKGV

CD3

363
CDR-H2
Chothia
WYDGSK

CD3

364
CDR-H2
Chothia
NPSRGY

CD3

365
CDR-H2
Chothia
YPGDGN

CD3

366

367

368

369

370

371
CDR-H2
Kabat
LINPYKGVSTYNQKFKD

CD3

372
CDR-H2
Kabat
YINPSRGYTNYNQKFKD

CD3

373
CDR-H2
Kabat
YINPSRGYTNYNQKVKD

CD3

374
CDR-H2
Kabat
WIYPGDGNTKYNEKEKG

CD3

375
CDR-H2
Kabat
VIWYDGSKKYYVDSVKG

CD3

376

377

378

379
CDR-H3

SGYYGDSDWYFDV

CD3

380
CDR-H3

DSYSNYYFDY

CD3

381
CDR-H3

QMGYWHFDL

CD3

382
CDR-H3

YYDDHYCLDY

CD3

383

384

385

386

387

388
CDR-L1

RASQDIRNYLN

CD3

389
CDR-L1

SASSVSYMS

CD3

390
CDR-L1

RASSSVSYMN

CD3

391
CDR-L1

KSSQSLLNSRTRKNYLA

CD3

392
CDR-L1

RASQSVSSYLA

CD3

393

394

395

396
CDR-L2

YTSRLHS

CD3

397
CDR-L2

DTSKLAS

CD3

398
CDR-L2

DTSKVAS

CD3

399
CDR-L2

WASTRES

CD3

400
CDR-L2

DASNRAT

CD3

401

402

403

404
CDR-L3

QQGNTLPWT

CD3

405
CDR-L3

QQWSSNPFT

CD3

406
CDR-L3

QQWSSNPLT

CD3

407
CDR-L3

TQSFILRT

CD3

408
CDR-L3

QQRSNWPPLT

CD3

409

410

411

412

413
VH

EVQLQQSGPELVKPGASMKISCKASGYSFTGYT

CD3

MNWVKQSHGKNLEWMGLINPYKGVSTYNQKFKD

KATLTVDKSSSTAYMELLSLTSEDSAVYYCARS

GYYGDSDWYFDVWGQGTTVTVSS

414
VH

QVQLQQSGAELARPGASVKMSCKASGYTFTRYT

CD3

MHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKD

KATLTTDKSSSTAYMQLSSLTSEDSAVYYCARY

YDDHYCLDYWGQGTTLTVSS

415
ScFV

DIKLQQSGAELARPGASVKMSCKTSGYTFTRYT

CD3

MHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKD

KATLTTDKSSSTAYMQLSSLTSEDSAVYYCARY

YDDHYCLDYWGQGTTLTVSS

416
VH

EVQLVQSGAEVKKPGASVKVSCKASGYTFTNYY

CD3

IHWVRQAPGQGLEWIGWIYPGDGNTKYNEKEKG

RATLTADTSTSTAYLELSSLRSEDTAVYYCARD

SYSNYYFDYWGQGTLVTVSS

417
VH

QVQLVESGGGVVQPGRSLRLSCAASGFKFSGYG

CD3

MHWVRQAPGKGLEWVAVIWYDGSKKYYVDSVKG

RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARQ

MGYWHFDLWGRGTLVTVSS

418
VH

QVQLVQSGGGVVQPGRSLRLSCKASGYTFTRYT

CD3

MHWVRQAPGKGLEWIGYINPSRGYTNYNQKVKD

RFTISRDNSKNTAFLQMDSLRPEDTGVYFCARY

YDDHYCLDYWGQGTPVTVSS

419

420

421

422
VL

DIQMTQTTSSLSASLGDRVTISCRASQDIRNYL

CD3

NWYQQKPDGTVKLLIYYTSRLHSGVPSKFSGSG

SGTDYSLTISNLEQEDIATYFCQQGNTLPWTFA

GGTKLEIK

423
VL

QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMN

CD3

WYQQKSGTSPKRWIYDTSKLASGVPAHFRGSGS

GTSYSLTISGMEAEDAATYYCQQWSSNPFTFGS

GTKLEIK

424
ScFV LCVR

DIQLTQSPAIMSASPGEKVTMTCRASSSVSYMN

CD3

WYQQKSGTSPKRWIYDTSKVASGVPYRFSGSGS

GTSYSLTISSMEAEDAATYYCQQWSSNPLTFGA

GTKLELK

425
VL

DIVMTQSPDSLAVSLGERATINCKSSQSLLNSR

CD3

TRKNYLAWYQQKPGQPPKLLIYWASTRESGVPD

RESGSGSGTDETLTISSLQAEDVAVYYCTQSFI

LRTFGQGTKVEIK

426
VL

EIVLTQSPATLSLSPGERATLSCRASQSVSSYL

CD3

AWYQQKPGQAPRLLIYDASNRATGIPARFSGSG

SGTDFTLTISSLEPEDFAVYYCQQRSNWPPLTF

GGGTKVEIK

427
VL

DIQMTQSPSSLSASVGDRVTITCSASSSVSYMN

CD3

WYQQTPGKAPKRWIYDTSKLASGVPSRFSGSGS

GTDYTFTISSLQPEDIATYYCQQWSSNPFTFGQ

GTKLQIT

428

429

430

431
CDR-H1
Chothia
GFSLSTSGM

CD16

432
CDR-H1
Chothia
GFTFNNY

CD16

433
CDR-H1
Chothia
GFTFSNY

CD16

434
CDR-H1
Chothia
GYTFTSS

CD16

435
CDR-H1
Chothia
GFTFSNYG

CD16

436
CDR-H1
Chothia
GFTFSSYG

CD16

437
CDR-H1
Chothia
GYTFTSYY

CD16

438

439

440

441
CDR-H1
Kabat
TSGMGVG

CD16

442
CDR-H1
Kabat
TSGVGVG

CD16

443
CDR-H1
Kabat
NYGMS

CD16

444
CDR-H1
Chothia
SSAMH

CD16

445

446

447

448
CDR-H2
Chothia
WWDDD

CD16

449
CDR-H2
Chothia
SGGGSY

CD16

450
CDR-H2
Chothia
NHYNDG

CD16

451
CDR-H2
Chothia
IYYSGGST

CD16

452
CDR-H2
Chothia
VNHSGGST

CD16

453
CDR-H2
Chothia
IEPMYGST

CD16

454
CDR-H2
Chothia
INPSGGST

CD16

455

456

457

458
CDR-H2
Kabat
YINHYNDGIKYNERFKG

CD16

459
CDR-H2
Kabat
HIWWDDDKRYNPALKS

CD16

460
CDR-H2
Kabat
HIWWDDDKRYSPSLKS

CD16

461
CDR-H2
Kabat
TISGGGSYTFYPDSVKG

CD16

462

463

464

465
CDR-H3

TNPAWFAY

CD16

466
CDR-H3

INPAYFAY

CD16

467
CDR-H3

QSARAPEPY

CD16

468
CDR-H3

QSANSPVPY

CD16

469
CDR-H3

GYRYASWFAS

CD16

470
CDR-H3

ARESIDY

CD16

471
CDR-H3

ARVGSFDF

CD16

472
CDR-H3

ARGSAYYYDFADY

CD16

473

474

475

476
CDR-L1

KASQSVDFDGDSFMN

CD16

477
CDR-L1

KASQNVGTHVA

CD16

478
CDR-L1

RASVNVGTHVA

CD16

479
CDR-L1

RASQNIGTSIH

CD16

480
CDR-L1

NIGSKN

CD16

481

482

483

484
CDR-L2

TTSNLES

CD16

485
CDR-L2

TTSSLES

CD16

486
CDR-L2

SASYRYS

CD16

487
CDR-L2

SVSESIS

CD16

488
CDR-L2

QDN

CD16

489

490

491

492
CDR-L3

QQSNEDPYT

CD16

493
CDR-L3

QQSNSDPYT

CD16

494
CDR-L3

QQYKSYPLT

CD16

495
CDR-L3

QDYTNYPLT

CD16

496
CDR-L3

QQSNSWPLT

CD16

497
CDR-L3

QVWDNYSVL

CD16

498

499

500

501
VH

QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSG

CD16

MGVGWIRQPPGKALEWLAHIWWDDDKRYNPALK

SRLTISKDTSKNQVVLTMTNMDPVDTATYYCAR

TNPAWFAYWGQGTLVTVSS

502
VH

QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSG

CD16

MGVGWIRQPPGKALEWLAHIWWDDDKRYNPALK

SRLTTSKDTSKNQWLTNTNMDPVDTATYYCAQ

TNPAWFAYWGQGTLVTVSS

503
VH

QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSG

CD16

VGVGWIRQPPGKALEWLAHIWWDDDKRYSPSLK

SRLTISKDTSKNQVVLTMTNMDPVDTATYYCAR

INPAYFAYWGQGTLVTVS

504
VH

EVKLVESGGTLVKPGGSLKLSCAASGFTFNNYG

CD16

MSWVRQTPEKRLEWVATISGGGSYTFYPDSVKG

RFTISRDNAKNSLYLQMSSLRSEDTALYYCIRQ

SARAPEPYWGQGTLVTVSS

505
VH

EVQLVESGGGLVKPGGSLRLSCAASGFTFSNYG

CD16

MSWVRQAPGKGLEWVATISGGGSYTFYPDSVKG

RFTISRDNAKNSLYLQMNSLRTEDTALYYCVRQ

SARAPEPYWGQGTLVTVSS

506
VH

EVQLVESGGGLVKPGGSLRLSCAASGFTFSNYG

CD16

MSWVRQAPGKGLEWVATISGGGSYTFYPDSVKG

RFTISRDNAKNSLYLQMNSLRTEDTALYYCVRQ

SANSPVPYWGQGTLVTVSS

507
VH

EVQLQQSGPELVKPGASVKMSCKASGYTFTSSA

CD16

MHWVKKNPGQGLEWIGYINHYNDGIKYNERFKG

KATLTSDKSSSTAYMELSSLTSEDSAVYYCATG

YRYASWFASWGQGTLVTVSS

508
VH

QVQLVQSGAEVKKPGASVEVSCKASGYTFTSSA

CD16

MHWVRQAPGQGLEWMGYINHYNDGIKYNERFKG

RVTITALKSTSTAYMELSSLRSEDTAVYYCATG

YRYASWFASWGQGTLVTVSS

509
VH

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSSA

CD16

MHWVRQAPGQGLEWMGYINHYNDGIKYNERFKG

RVTITADKSTSTAYMELSSLRSEDTAVYYCARG

YRYASWFASWGQGTLVTVSS

510
VH

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYG

CD16

MSWVRQAPGKGLEWIGSLYYSGGSTNYNPSLKG

SLVISRDNSKNTLYLQMNSLAEDTATYYC

ARESIDYWGQGTLVTVSS

511
VH

EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYG

CD16

MSWVRQAPGKGLEWIGEVNHSGGSTNYNPSLKG

SFVISRDNSKNTLYLQMNSLAEDTAVYYCARVG

SFDFWGQGTLVTVSS

512
VH

QVQLVQSGAEVKKPGESLKVSCKASGYTFTSYY

CD16

MHWVRQAPGQGLEWMGAIEPMYGSTSYAQKFQG

RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG

SAYYYDFADYWGQGTLVTVSS

513
VH

QVQLVQSGAEVEKPGBSLEVSCKASGYTFTSYY

CD16

MHWVRQAPGQGLEWMGIINPSGGSTSYAQKFQG

RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARG

SAYYYDFADYWGQGTLVTVSS

514

515

516

517
VL

DIVMTQSPDSLAVSLGERATINCKASQSVDFDG

CD16

DSFMNWYQQKPGQPPKLLIYTTSNLESGVPDRF

SGSGSGTDFTLTISSLQAEDVAVYYCQQSNEDP

YTFGQGTKLEIK

518
VL

DIVMTQSPDSLAVSLGERATINCKSSQSVDFDG

CD16

DSFMNWYQQKPGQPPKLLIYTTSSLESGVPDRF

SGSGSGTDFTLTISSLQAEDVAVYYCQQSNSDP

YTFGQGTKLEIK

519
VL

DIVMTQSQKFMSTSVGDRVSVTCKASQNVGTHV

CD16

AWYQQKSGQSPKSLLYSASYRYSGVPDRFSGSG

SGTDFTLTISNVQSBDLAEYFCQQYKSYPLTFG

AGTKLELK

520
VL

DIQMTOSPSFLSASVGDRVTITCRASQNVGTHV

CD16

AWYQQKPGKAPESLLYSASYRYSGVPSRFSGSG

SGTDFTLTISSLQSEDIATYYCQQYKSYPLTFG

QGTKLEIK

521
VL

DIQMTQSPSFLSASVGDRVTITCRASQNVGTHV

CD16

AWYQQKPGKAPKSLLYSASYRYSGVPSRFSGSG

SGTDFTLTISSLQSEDIATYYCQDYTNYPLTFG

QGTKLEIK

522
VL

DILLTQSPAILSVSPGERVSFSCRASQNIGTSI

CD16

HWYQQRTDGSPRLLIKSVSESISGIPSRFSGSG

SGTDFTLTINGVESGDISDYYCQQSNSWPLTFG

AGTKLELK

523
VL

EIVLTQSPATLSVSPGERATLSCRASQNIGTSI

CD16

HWYQQKPDQSPKLLIKSVSESISGVPSRFSGSG

SGTDFTLTINSLEAEDFATYYCQQSNSWPLTFG

QGTKLEIK

524
VL

SYVLTQPSSVSVAPGQTATISCGGHNIGSKNVH

CD16

WYQQRPGQSPVLVIYQDNKRPSGIPERFSGSNS

GNTATLTISGTQAMDEADYYCQVWDNYSVLFGG

GTKLTVL

525

526

527

528
CDR-H1
Chothia
GFSLSTYGI

NKp46

529

530

531

532
CDR-H1
Kabat
TYGIGVG

NKp46

533

534

535

536
CDR-H2
Chothia
WWNDN

NKp46

537

538

539

540
CDR-H2
Kabat
HIWWNDNEYYNIDLKS

NKp46

541

542

543

544
CDR-H3

GNYRYARGYVMDY

NKp46

545

546

547

548
CDR-L1

RASESVEYYGTSLMQ

NKp46

549

550

551

552
CDR-L2

AASNVES

NKp46

553

554

555

556
CDR-L3

QQNRKVPWT

NKp46

557

558

559

560
VH

QVTLKESGPGILQPSQTLSLTCSFSGFSLSTYG

NKp46

IGVGWNRQPSGKGLEWLAHIWWNDNEYYNIDLK

SRLTISKDTSNNQVFLKIASVDTADTATYYCVR

GNYRYARGYVMDYWGQGTSVTVSS

561

562

563

564
VL

DIVLTQSPASLAVSLGQRATISCRASESVEYYG

NKp46

TSLMQWYQQKPGQPPKLLIYAASNVESGVPARF

SGSGSGTDFSLNIHPVEEDDFAMYFCQQNRKVP

WTFGGGTKLEIK

565

566

567

568
CDR-H1
Chothia
GHTFTSY

NKp30

569
CDR-H1
Chothia
GGTFTSY

NKp30

570
CDR-H1
Chothia
GHTFTNY

NKp30

571

572

573

574
CDR-H1
Kabat
SYFMH

NKp30

575
CDR-H1
Kabat
SYSVS

NKp30

576
CDR-H1
Kabat
NYYMH

NKp30

577

578

579

580
CDR-H2
Chothia
NPSDDY

NKp30

581
CDR-H2
Chothia
VPIFGT

NKp30

582
CDR-H2
Chothia
NPNGGD

NKp30

583

584

585

586
CDR-H2
Kabat
IINPSDDYANYAQKFQG

NKp30

587
CDR-H2
Kabat
GIVPIFGTADYAQKFQG

NKp30

588
CDR-H2
Kabat
VINPNGGDTSYAQKFQG

NKp30

589

590

591

592
CDR-H3

AIFDY

NKp30

593
CDR-H3

GYSYGQTFDY

NKp30

594
CDR-H3

DRAWYGGNVRAEDI

NKp30

595

596

597

598
CDR-L1

RASQSISSYLN

NKp30

599
CDR-L1

RSSQSLLHSNGYNYLD

NKp30

600

601

602

603
CDR-L2

AASSLQS

NKp30

604
CDR-L2

LGSNRAS

NKp30

605

606

607

608
CDR-L3

QQSYSTPLT

NKp30

609
CDR-L3

MQALQTPYT

NKp30

610

611

612

613
VH

QVQLVQSGAEVKKPGASVKVSCKASGHTFTSYF

NKp30

MHWVRQAPGQGLEWMGIINPSDDYANYAQKFQG

RVTMTRDTSTSTVYMELSSLRSEDTAVYYCATA

IFDYWGQGTLVTVSS

614
VH

QVQLVQSGAEVKKPGASVKVSCKASGHTFTSYF

NKp30

MHWVRQAPGQGLEWMGIINPSDDYANYAQKFQG

RVTMTRDTSTSTVYMELSSLRSEDTAVYYCATA

IFDYWGQGTPVTVSS

615
VH

QVQLVQSGAEVKKPGASVKVSCKASGHTFTNYY

NKp30

MHWVRQAPGQGLEWMGVINPNGGDTSYAQKFQG

RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARD

RAWDYGGNVRAFDIWGQGTMVTVSS

616
VH

QVQLVQSGAEVKKPGSSVKVSCKASGGTFTSYS

NKp30

VSWVRQAPGQGLEWMGGIVPIFGTADYAQKFQG

RVTITADESTSTAYMELSSLRSEDTAVYYCARG

YSYGQTFDYWGQGTLVTVSS

617

618

619

620

621

622

623

624
VL

DIQMTQSPSSLSASVGDRVTITCRASQSISSYL

NKp30

NWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSG

SGTDFTLTISSLQPEDFATYYCQQSYSTPLTFG

GGTKVEIK

625
VL

DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSN

NKp30

GYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDR

FSGSGSGTDFTLKISRVEAEDVGVYYCMQALQT

PYTFGGGTKVEIK

626

627

628

629
CD3ϵ

MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQ

Sequence

TPYKVSISGTTVILTCPQYPGSEILWQHNDKNI

GGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCY

PRGSKPEDANFYLYLRARVCENCMEMDVMSVAT

IVIVDICITGGLLLLVYYWSKNRKAKAKPVTRG

AGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDL

YSGLNQRRI

630
CD16A

MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQ

Sequence

WYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESL

ISSQASSYFIDAATVDDSGEYRCQTNLSTLSDP

VQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWK

NTALHKVTYLQNGKGRKYFHHNSDFYIPKATLK

DSGSYFCRGLFGSKNVSSETVNITITQGLAVST

ISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKT

NIRSSTRDWKDHKFKWRKDPQDK

631
CD16B

MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQ

Sequence

WYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESL

ISSQASSYFIDAATVNDSGEYRCQTNLSTLSDP

VQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWK

NTALHKVTYLQNGKDRKYFHHNSDFHIPKATLK

DSGSYFCRGLVGSKNVSSETVNITITQGLAVST

ISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKT

NI

632
NKp46

MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWA

Sequence

EPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSL

FAVDRPKPPERINKVKFYIPDMNSRMAGQYSCI

YRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGP

EVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQ

RGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHA

WSFPSEPVKLLVTGDIENTSLAPEDPTFPADTW

GTYLLTTETGLQKDHALWDHTAQNLLRMGLAFL

VLVALVWFLVEDWLSRKRTRERASRASTWEGRR

RLNTQTL

633
NKp46

MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWA

Sequence

EPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSL

FAVDRPKPPERINKVKFYIPDMNSRMAGQYSCI

YRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGP

EVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQ

RGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHA

WSFPSEPVKLLVTGDIENTSLAPEDPTFPDHAL

WDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRK

RTRERASRASTWEGRRRLNTQTL

634
NKp4 6

MSSTLPALLCVGLCLSQRISAQQQMYDTPTLSV

Sequence

HPGPEVISGEKVTFYCRLDTATSMFLLLKEGRS

SHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSY

NNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFP

ADTWGTYLLTTETGLQKDHALWDHTAQNLLRMG

LAFLVLVALVWFLVEDWLSRKRTRERASRASTW

EGRRRLNTQTL

635
NKp46

MSSTLPALLCVGLCLSQRISAQQQMYDTPTLSV

Sequence

HPGPEVISGEKVTFYCRLDTATSMFLLLKEGRS

SHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSY

NNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFP

DHALWDHTAQNLLRMGLAFLVLVALVWFLVEDW

LSRKRTRERASRASTWEGRRRLNTQTL

636
NKp46

MSSTLPALLCVEMYDTPTLSVHPGPEVISGEKV

Sequence

TFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQA

EFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPV

KLLVTGDIENTSLAPEDPTFPADTWGTYLLTTE

TGLQKDHALWDHTAQNLLRMGLAFLVLVALVWF

LVEDWLSRKRTRERASRASTWEGRRRLNTQTL

637
NKp46

MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWA

EPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSL

FAVDRPKPPERINKVKFYIPDMNSRMAGQYSCI

YRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGP

EVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQ

RGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHA

WSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWG

TYLLTTETGLQKDHALWDHTAQNLLRMGLAFLV

LVALVWFLVEDWLSRKRTRERASRASTWEGRRR

LNTQTL

638
NKp30

MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGS

Sequence

SAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEV

RNGTPEFRGRLAPLASSRFLHDHQAELHIRDVR

GHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHP

QLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGK

CLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPV

PGG

639
NKp30

MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGS

Sequence

SAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEV

RNGTPEFRGRLAPLASSRFLHDHQAELHIRDVR

GHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHP

QLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGK

CHCHMGTHCHSSDGPRGVIPEPRCP

640
NKp30

MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGS

Sequence

SAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEV

RNGTPEFRGRLAPLASSRFLHDHQAELHIRDVR

GHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHP

QLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGK

YAKSTLSGFPQL

641
NKp30

MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGS

SAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEA

ELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTR

LVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVG

STVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGS

SAHLLPPVPGG

642
NKp30

MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGS

SAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEA

ELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTR

LVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVG

STVYYQGKCHCHMGTHCHSSDGPRGVIPEPRCP

643
NKp30

MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGS

SAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEA

ELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTR

LVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVG

STVYYQGKYAKSTLSGFPQL

BISPECIFIC IMMUNE CELL ENGAGERS WITH BINDING SPECIFICITY FOR HLA-G AND ANOTHER ANTIGEN

Information

Publication Number

Date Filed

Date Published

Inventors

Original Assignees

CPC

International Classifications

Abstract

Description

Claims

PCT Information

Provisional Applications (1)