BISPECIFIC MOLECULE BINDING TLR9 AND CD32 AND COMPRISING A T CELL EPITOPE FOR TREATMENT OF ALLERGIES

Information

  • Patent Application
  • 20160362491
  • Publication Number
    20160362491
  • Date Filed
    August 26, 2016
    7 years ago
  • Date Published
    December 15, 2016
    7 years ago
Abstract
A molecule or molecule complex capable of binding to TLR9 and to CD32 comprising at least one epitope of at least one antigen, its production and its use a medicament, especially for the treatment of allergies.
Description

The present invention relates to molecules with binding specificity to both, Toll-like Receptor 9 (TLR9) and CD32 containing one or more T cell antigen epitopes.


The invention further relates to the production of these molecules and their use for the preparation of medicaments for the treatment of allergies.


INTRODUCTION

Allergy is considered to be a hypersensitive reaction to proteins in the environment (air/water/food). Allergens are antigens to which atopic patients respond with IgE antibody responses subsequently leading to allergic reactions. Antigens in the complexes or fusion proteins can be environmental allergens (e.g. house dust mite, birch pollen, grass pollen, cat antigens, cockroach antigens), or food allergens (e.g. cow milk, peanut, shrimp, soya), or a combination of both. IgE molecules are important because of their role in effector cell (mast cell, basophiles and eosinophiles) activation. More recently, it has been accepted that IgE also plays an important role in the induction phase of allergic diseases, by up-regulating the antigen capture potential of B cells and dendritic cells (DC), both through low affinity (CD23) and high affinity receptors (FcεRI) [1]. The negative functions of IgE antibodies can be counteracted by allergen specific IgG antibodies. e.g. because they direct the immune response away from B cells to monocytes and DC [2]. In addition, they compete with IgE molecules for allergen binding sites. Allergies therefore can be treated, cured and prevented by the induction of allergen specific IgG molecules.


IgG molecules have a serum half-life of approximately 3 weeks as compared to roughly 3 days for IgE molecules. IgE molecules are induced by the interaction between (naïve) B cells and Th2 cells which provide the IL-4 and IL-13 together with CD40L expression necessary to induce a class switch to IgE in memory B cells and plasma cells [3]. In contrast, Th1 cells, which produce IFN-γ and IL-2, induce a class switch to IgG. Therefore, induction of Th1, rather than Th2 helper T cell responses against allergens, is beneficial for the prevention, treatment and cure of allergic diseases.


To date several forms of active vaccination using allergens are used. The most common is the so called “Immunotherapy”, which depends on frequent immunizations with relatively high concentrations of allergens. This technique is only moderately effective in a minority of allergic diseases such as Bee venom allergy and in some cases of Rhinitis and Conjunctivitis, and recently some reports have shown effectiveness in asthma and atopic dermatitis. More recently rush immunotherapy, where increasing amounts of allergen are injected in a rather short time frame, has been proposed with slightly better results [4; 5]. Usually the subcutaneous route is used for administration of the allergens, but recently this route has been compared to oral application or even local application, the results are generally positive but not always consistent. A different technique for immunotherapy is the one described by Saint-Remy (EP 0 178 085 and 0 287 361), which makes use of autologous IgG antibodies which are in vitro complexed to the relevant allergens. This technique allows far smaller amounts of allergen to be applied with fewer side effects.


The mechanism behind these therapies is unclear. In the classical therapy there seems to be a beneficial effect if the therapy induces an increase in specific IgG antibodies, although not every significant increase of specific IgG is correlated with successful immunotherapy. A possible argument why this is the case is the relatively low affinity of IgG antibodies for CD32 on B cells, monocytes and mast cells. The Saint-Remy approach selects the specific IgG antibodies from the patient, which are subsequently mixed with relevant allergens in vitro. This way they assure that the allergen cannot react freely with cells or other antibody isotypes on cells such as IgE on mast cells. In addition they claim that anti-idiotypic antibodies are raised against the specific IgG molecules, which in the future will prevent allergy.


In WO 97/07218 Allergen-anti-CD32 Fusion Proteins are described. In this publication the problems with isolating specific IgG molecules and the low affinity of these IgG antibodies for CD32 are circumvented and the risk factors of classical immunotherapy, which uses complete “IgE binding” allergens, are reduced. However, the claimed induction of Th1 memory responses due to solely directing the anti-CD32 containing vaccine to dendritic cells cannot be substantiated.


Even in view of the intensive research for therapeutic approaches to treat allergic diseases, there is still a great demand for providing medicaments for successful treatment of allergies.


The object of the invention is therefore to provide novel molecules with improved properties for the treatment of allergic diseases.


According to the invention this object is achieved by the subject matter of the claims.


BRIEF DESCRIPTION OF THE INVENTION
Background

CD32 is strongly expressed on monocytes/dendritic cells and B cells and thus the molecule of the present invention is designed to direct the immune response to these important immunological cells, with the intention to prevent allergen presentation by the B cells, while promoting allergen presentation by especially dendritic cells (DCs), the latter leads to induction of Th1 responses against the allergens in the molecule or molecule complex that can be formulated as vaccine. More recent knowledge shows that two types of dendritic cells (DC) exist myeloid (mDC) and plasmacytoid dendritic cells (pDC) [6], which has led to the new concept of DC1 and DC2 cells [7]. In this concept DC1 cells promote the induction of Th1 cell development after antigen specific stimulation and DC2 cells support the development of Th2 cells. Monocyte derived DC (or mDC) are generally considered to be of DC1 type, whereas pDC are considered to be DC2 type [6]. Both types of DC express CD32a and will induce an allergen specific T cell response; however it is not guaranteed that the outcome will be of Th1 type. In fact, in allergic donors Th2 responses are more likely [8]. Importantly, the pDC express the TLR9 receptor, which binds CpG-OONs (oligodeoxynucleotides [ODNs] containing unmethylated CpG motifs). Activation of this receptor in the pDC leads to a very strong production of IFN-α and IL-12 [9], which promotes Th1 induction and thus transforms the potential DC2 into DC1 cells.


Therefore, the molecule of the invention can combine the activation of the TLR9 receptor in pDC with the specific stimulation and induction of allergen specific Th1 cells and comprises therefore a significant improvement of earlier concepts.


The invention comprises a molecule or a molecule complex having binding specificity for toll-like receptor 9 and CD32, wherein the molecule or molecule complex includes at least one epitope, preferably at least one T cell epitope, of at least one antigen.


The molecule or molecule complex of the invention will also bypass the effector function of mast cells, which carry IgE, for the native allergen of which T cell epitopes have been selected to be part of the fusion protein.


Preferably the molecule or molecule complex according to the invention can have one or more of the following unique characteristics:

    • Activation and induction of allergen specific Th1 cells, without activation of allergen-specific B-cells.
    • Activation and induction of allergen specific Th1 cells, without activation of mast cells or any other effector cell, which, by means of allergen specific IgE or IgG, may become activated by the natural allergens of which the selected T cell epitopes are represented in the molecule or molecule complex of the invention.


The CD32-binding part of the molecule or molecule complex of the invention selects the relevant cells, which should internalize the complete molecule or molecule complex.


After internalization of the fusion protein according to the present invention by antigen presenting cells the molecule of the invention is degraded and various peptides, including the incorporated T cell epitope(s) are presented on the MHC class II molecules of the antigen presenting cells, therefore stimulating allergen specific T cells.


The incorporated TLR9-binding structure(s) in the molecule or molecule complex of the invention are necessary for the induction of an allergen specific Th1 memory pool, by binding to the cytoplasmatic [10;11] TLR9 receptor. Activation of the TLR9 receptor leads to a strong induction of IFN-α and IL12 production [9].


According to the present invention, a molecule is a single entity made up of atoms and/or other molecules by covalent bonds. The molecule can be made up of one single class of substances or a combination thereof. Classes of substances are e.g. polypeptides, carbohydrates, lipids, nucleic acids etc.


A molecule complex is an aggregate of molecules specifically and strongly interacting with each other. A complex of various molecules may be formed by hydrophobic interactions (such as e.g. the binding of antibody variable regions in an Fv) or by strong binding of one molecule to another via ligand/receptor interactions such as antibody-antigen binding or avidin-biotin or by complex formation via chelating chemical groups and the like.


An Antigen can be a structure which can be recognized by an antibody, a B-cell-receptor or a T-cell-receptor when presented by MHC class I or II molecules.


An epitope is the smallest structure to be specifically bound within by an antibody, a B-cell-receptor or a T-cell receptor when presented by MHC class I or II molecules. Specificity is defined as preferred binding to a certain molecular structure (in antibody/antigen interactions also called epitope) within a certain context.


A domain is a discrete region found in a protein or polypeptide. A monomer domain forms a native three-dimensional structure in solution in the absence of flanking native amino acid sequences. Domains of the invention will specifically bind to CD32 and/or TLR9 and/or display or present epitopes. Domains may be used as single domains or monomer domains or combined to form dimers and multimeric domains. For example, a polypeptide that forms a three-dimensional structure that binds to a target molecule is a monomer domain.


According to the present invention the term antibody includes antibodies or antibody derivatives or fragments thereof as well as related molecules of the immunoglobulin superfamily (such as soluble T-cell receptors). Among the antibody fragments are functional equivalents or homologues of antibodies including any polypeptide comprising an immunoglobulin binding domain or a small mutated immunoglobulin domain or peptides mimicking this binding domain together with an Fc region or a region homologous to an Fc region or at least part of it. Chimeric molecules comprising an immunoglobulin binding domain, or equivalents, fused to another polypeptide are included.


Allergens are antigens to which atopic patients respond with allergic reactions.







DETAILED DESCRIPTION OF THE INVENTION

The invention provides a molecule or a molecule complex being capable of binding to toll-like receptor 9 (TLR9) and Fc gamma receptor RII (CD32) and including at least one epitope of at least one antigen.


In one embodiment of the invention the molecule or molecule complex comprises at least three parts, one part being a structure specifically binding to TLR9 (monovalently, bivalently or multivalently), another part being a structure specifically binding to CD32 (monovalently, bivalently or multivalently) and at least one other part being one or more T cells epitopes of an antigen and/or allergen. The parts may be independent structures which are linked together either by chemical linkages or by genetic fusion or by other (non-covalent) interactions such as ligand-receptor or antibody interactions.


The linkages between the different parts may be different. For example, in one preferred embodiment, the linkage between the parts binding to TLR9 and CD32 is by genetic fusion and the link to at least one of the T cell epitopes is via a receptor/ligand interaction (e.g. biotin-streptavidin). The advantage of such a setup is the flexibility in production. The bispecific (anti-TLR9/anti-CD32), generic part of the molecule complex can be produced in the same way for all patients, selected T cell epitopes are linked to the generic part of the molecule complex according to the need. The selection can be based on disease prevalence or on results of individual specificity tests of patients (specific allergy). The complex formation may be performed centralized or at the bed side or at a physicians office.


Chemical linkage of molecules of the various binding molecules of the same or different chemical class may be achieved by many different techniques yielding either a defined molecular ratio of the various parts of the molecule or molecule complex of the invention. It may also lead to a mixture of molecules with different molecular ratios of the various parts of the molecule or molecule complex of the invention.


The ratio of the various parts of the invention may be an equimolar or non-equimolar. The molecule may be monovalent for binding to TLR9 and/or CD32 and/or T cell epitope(s). It may also be bi, tri- and multivalent for at least one of the parts of the molecule or the molecule complex. If the binding to TLR9 and/or CD32 is bivalent or of higher valency, the binding specificity may be for one or for more epitopes on CD32 and/or TLR9 respectively.


In another embodiment of the invention the binding specificities of the molecule are overlapping so that one part of the molecule or the molecule complex of the invention is binding to both, TLR9 and CD32. Such a part could be selected for by simultaneous screening of molecules for binding to both CD32 and TLR9 or by engineering of a molecule to bind both, CD32 and TLR9. For example, a protein scaffold can be used for displaying loops to bind CD32 and other loops that bind to TLR9.


In a further embodiment of the invention, a protein scaffold can be used to display structures that bind CD32, structures that bind TLR9 and to display T-cell epitopes.


The specific binding molecules can be natural ligands for CD32 and TLR9 and derivatives thereof. For example, the Fc-part of immunoglobulin is binding to CD32. CpG is a naturally occurring ligand for TLR9.


The specific binding molecules can be peptides. CD32- and TLR9-specific peptides according to the invention can be selected by various methods such as phage display technology or by screening of combinatorial peptide libraries or peptide arrays. The peptides can be selected and used in various formats such as linear, constrained or cyclic peptides, the peptides can be chemically modified for stability and/or specificity.


A specifically binding peptide may also be derived from analysis of interaction of a naturally occurring proteinaceous ligand to TLR9 and CD32 by isolation of the minimal binding site of the ligand.


The specific binding peptides can be used as such in the molecule or the molecule complex of the invention or used to be incorporated into other structures such as by grafting into protein scaffolds, antibodies and protein domains or chemically coupled to carrier molecules which might be part of the molecule or molecule complex of the invention.


The binding part of the molecules or molecule complex of the invention can be comprised of proteins such as antibodies or antibody fragments (such as Fab, Fv, scFv, dAb, F(ab)2, minibody, small mutated immunoglobulin domains, soluble T-cell receptor, etc). Antibodies and antibody fragments and derivatives may be generated and selected for binding to TLR9 and/or CD32 according to known methods such as hybridoma technology, B-cell cloning, phage display, ribosome display or cell surface display of antibody libraries, array screening of variant antibodies.


The binding parts of the molecules or molecule complexes of the invention can be protein domains which occur naturally or domains which are artificially modified. Protein domains or domain derivatives, e.g domains with mutations such as amino acid substitutions, deletions or insertions or chemically modified domains may be selected for binding to TLR9 and/or CD32 according to known methods (e.g. phage and cell surface display of libraries of domains or domain variants and screening, arrays of variant molecules and screening). The domains include but are not limited to molecules from the following classes:


EGF-like domain, a Kringle-domain, a fibronectin type I domain, a fibronectin type II domain, a fibronectin type Ill domain, a PAN domain, a Gla domain, a SRCR domain, a Kunitz/Bovine pancreatic trypsin Inhibitor domain, a Kazal-type serine protease inhibitor domain, a Trefoil (P-type) domain, a von Willebrand factor type C domain, an Anaphylatoxin-like domain, a CUB domain, a thyroglobulin type I repeat, a LDL-receptor class A domain, a Sushi domain, a Link domain, a Thrombospondin type I domain, an immunoglobulin domain, an Immunoglobulin-like domain, a C-type lectin domain, a MAM domain, a von Willebrand factor type A domain, an A-domain, a Somatomedin B domain, a WAP-type four disulfide core domain, an F5/8 type C domain, a Hemopexin domain, an SH2 domain, an SH3 domain, a Laminin-type EGF-like domain, a CTLA-4 domain, a C2 domain.


In a preferred embodiment, the binding part of a molecule or molecule complex of the invention comprises a small mutated immunoglobulin domain (SMID) as described in PCT/EP2006/050059.


The binding part of the molecule or molecule complex of the invention can be nucleic acids such as RNAs or DNAs which can be selected for specific binding to TLR9 and/or CD32 according to known methods such as aptamer screening and in vitro evolution techniques.


It is contemplated that also other molecule classes will be able to show specific binding to TLR9 and or CD32. Libraries of other chemical entities than the ones mentioned above, including carbohydrates, lipids, and small organic molecules, may be screened for specific binding to TLR9 and/or CD32 and may be incorporated into the molecule or molecule complex of the invention.


A preferred embodiment of the invention is a recombinant fusion protein consisting of at least one epitope of at least one antigen, at least one binding site interacting with TLR9 and at least one binding site interacting with CD32. The antigen can be as small as one T cell epitope from one antigen or can be a cocktail or mixture of one or more T cell epitopes from one or more different antigens fused or linked together in a way that allows proper processing and presentation by MHC molecules. The order of the epitopes can be selected according to different criteria such as product stability effective processing, (non-)recognition by preformed antibodies in the treated persons. Generally one will select for a stable molecule which can be efficiently presented by MHC and which will lead to minimal recognition by preformed antibodies.


The invention further comprises the physical coupling of at least one molecule interacting with TLR9, at least one molecule interacting with CD32 and one or more T cell epitopes from one or more antigens linked together in a random form.


Additionally, the invention provides the preparation of a medicament containing the fusion protein according to the invention and its use for treatment of allergies. The medicament can be a vaccine formulation containing the molecule or molecule complex according to the invention, useful esp. for active immunotherapy.


The recombinant production of bispecific binding structures of the molecule or the molecule complex of the invention (i.e. binding to CD32 and to TLR9) can be accomplished in different ways, e.g. by

    • Quadroma technology (fused hybridomas) [12;13]
    • bispecific scFvs, either as “diabodies” or simply by genetic fusion of different scFvs [14]
    • single-domain antibodies in which VH recognizes one antigen and VL another one
    • chi-bAbs (as described in EP0640130)
    • small mutated immunoglobulin domains, by including engineered immunoglobulin domains, specifically binding to CD32 and/or to TLR9 in constructs coding either for complete antibodies or for antibody fragments such as Fab (according to PCT/EP2006/050059)
    • in the context of this invention, binding to CD32 can also be accomplished by monomeric or multimeric immunoglobulin Fc region(s) or a parts thereof especially when the affinity for CD32 of the Fc parts is enhanced, while TLR9 binding is achieved through the normal binding site (VH/VL) of the antibody
    • Fc-region(s) of an immunoglobulin or parts thereof, binding to CD32, fused to any other TLR9 specific binding motif
    • the Fc part of the above mentioned antibody may be “glyco-engineered” to increase the affinity for human FcγR's [15]
    • engineered scaffolds, specifically binding to TLR9 and/or CD32 of any kind can be used and linked together as needed. These binding scaffolds can be protein domains, fibronectin III, lipocalins, Protein A or α-amylase inhibitor. Ankyrin Repeat Proteins, a C2 domain, an A-domain, an EGFR like domain, a dab, a chi-bAb, CTLA-4, gamma crystalline or any other protein, protein domain or part thereof.


The molecule or molecule complex of the invention consist of one or more epitopes and one or more binding structures, which interact with TLR9, preferably human TLR9 and one or more binding structures, which interact with CD32, preferably human CD32. For easy in vivo testing of the inventive protein the binding structures that recognize human TLR9 and human CD32 may cross react with monkey or mouse TLR9 and monkey or mouse CD32. The selected antigens/allergens may be complete natural/native proteins or parts of these, as long as epitopes which can be presented on MHC class II molecules and which can be recognized by T cells are present on the sequences present in the molecule or molecule complex. The part(s) of the molecule or molecule complex, which interact with TLR9 and CD32 may be complete or incomplete (modified) antibodies or fragments or derivatives thereof, as long as binding to TLR9 and CD32 is retained.


Alternatively, anti-TLR9 and anti-CD32 antibodies or derivatives or fragments thereof, which still specifically recognize and bind to human TLR9 and CD32 such as expressed by B cells, and dendritic cells can be used.


Alternatively, the antibodies interacting with TLR9 or CD32 are improved antibodies with higher affinity than the original antibodies.


Exemplary antibody molecules are intact immunoglobulin molecules and those portions of an immunoglobulin molecule that contains the paratope, including those portions known as Fab, Fab′, F(ab′)2, Fc and F(v), dAb.


The antibodies can be IgG, IgM, IgE, IgA or IgD. The molecules interacting with TLR9 or CD32 can be of any origin, preferably of mammalian origin, preferably of human, mouse, camel, dog or cat origin or humanized. Preferably the molecules are antibodies, preferably human or humanized antibodies.


As used herein, if the molecule or molecule complex of the invention is a fusion protein, it can be expressed in host cells which cover any kind of cellular system which can be modified to express the fusion protein. Within the scope of the invention, the term “cells” means individual cells, tissues, organs, insect cells, avian cells, mammalian cells, hybridoma cells, primary cells, continuous cell lines, stem cells and/or genetically engineered cells, such as recombinant cells expressing an antibody according to the invention.


Cells can be bacterial cells, fungal cells yeast cells, insect cells, fish cells and plant cells.


Preferably the cells are animal cells, more preferably mammalian cells. These can be for example BSC-1 cells, LLC-MK cells. CV-1 cells, CHO cells, COS cells, PerC6 cells, murine cells, human cells, HeLa cells, 293 cells, VERO cells, MDBK cells, MDCK cells, MDOK cells, CRFK cells, RAF cells, TCMK cells, LLC-PK cells, PK15 cells, WI-38 cells, MRC-5 cells, T-FLY cells, BHK cells, SP2/0, NS0 cells or derivatives thereof.


Preferably the binding structures of the molecule or the molecule complex of the invention recognizing TLR9 and CD32 are small mutated immunoglobulin domains, being for example an Fab fragment in which one binding site (either specific for CD32 or for TLR9) is formed by VH/VL, and is combined with a second binding site (either specific for TLR9 or for CD32 respectively) which can be an engineered CL or an engineered CH1, CH2, CH3, CH4, VL or VH domain according to PCT/EP/2006/050059; or a complete antibody in which one binding site is formed by VH/VL, and is combined with a second binding site which can be an engineered CL, CH1, CH2, CH3, CH4, VL or VH domain according to PCT/EP/2006/050059.


According to the invention, the molecule or molecule complex contains at least one structure that specifically binds to CD32.


An anti-CD32 antibody can be derived by known methods (such as hybridoma technology, B-cell cloning and antibody library screening). For selection, cells displaying CD32 in a natural format can be used or a recombinant extracellular part of CD32 can be used or synthetic peptides selected from the CD32 amino acid sequence can be used. Selection criteria are that the binding structure recognizes CD32a. In case also CD32b is recognized it is preferred that the affinity for CD32a≧CD32b


As an example, the Fab fragment from the anti-CD32 IV.3 antibody derived from the cell line HB-217 can be used. Using the method e.g. described by Orlandi et al16, the Fab fragment is cloned from the cell line HB-217. Alternatively, other formats such as scFv can be constructed of the known V-gene sequences. However, for optimal combination with an anti-TLR9 antibody or Fab fragment or Fv fragment it is preferred to select specific binders using one or more of the small mutated immunoglobulin domain libraries from CH1, CH2 CH3, CH4, CL, VL or VH.


Selected CH1, CH2, CH3, CH4, CL, VL or VH domains can then be cloned into the existing sequence of an anti-TLR9 antibody or a Fab or an Fv fragment thereof thus generating a bi-specific antibody or Fab fragment.


The selected CD32 binding entities should preferably have the following characteristics:

    • 1. Interaction with CD32a leads to internalization of the receptor-binding-structure complex, activation of the antigen presenting cell through the ITAM motiv in the cytoplasmic tail of the receptor and antigen presentation of the linked/fused T cell epitopes
    • 2. Interaction with CD32b leads to negative signaling of the receptor through the ITIM motiv
    • 3. Interaction should show cross reactivity between human and monkey CD32 (for testing of efficacy in a relevant in vivo model)
    • 4. Interaction should show cross reactivity with mouse CD32 (for testing in an established in vivo model for allergy)


For obtaining a binding structure that specifically binds to TLR9, several procedures can be used (such as hybridoma technology, B-cell cloning and antibody library screening). For selection, cells expressing TLR9 in a natural format can be used to isolate natural TLR9 or a recombinant TLR9 can be used or synthetic peptides selected from the TLR9 amino acid sequence can be used. Alternatively, purified TLR9 or TLR9 expressed by cell lines can be used. Antibody genes coding for VL and VH respectively can be extracted after selection for binding to TLR9 and be used to design a recombinant antibody or Fab fragment specific for human TLR9. Alternatively, a single-chain Fv can also be made and fused with the anti-CD32 scFv mentioned above. However, for optimal combination with the anti-CD32 antibody or scFv or Fab fragment it is preferred to select specific binders using one or more of the small mutated immunoglobulin domain libraries from CH1, CH2 CH3, CH4, CL, VH or VL. Selected CH1, CH2, CH3, CH4, CL, VL or VH domains can then be cloned into the existing antibody or Fab fragment or scFv of anti-CD32 antibody thus generating a bi-specific Fab fragment. The selected TLR9 binding entities should preferably have the following characteristics:

    • 1. Interaction with TLR9 leads to signal transduction and cytokine production
    • 2. Interaction may show cross reactivity between human and monkey TLR9 (for testing of efficacy in a relevant in vivo model)
    • 3. Interaction may show cross reactivity with mouse TLR9 (for testing in an established in vivo model for allergy) and CD32


Of course the fusion protein can similarly be made using the Fab part of an existing aTRL9 monoclonal antibody. Using the method e.g. described by Orlandi et al16, the Fab fragment is cloned from e.g. clone 26C593 available from Imgenex Corp., as described above for the fab fragment of the aCD32 Ab IV.3. Again for optimal combination with the anti-TLR9 Fab fragment it is best to select specific binders for CD32 using one or more of the small mutated immunoglobulin domain libraries from CH1, CH2, CH3, CH4, CL, VL or VH. Selected CH1, CH2, CH3, CH4, CL, VL or VH domains can then be cloned into the existing Fab fragment of anti-TLR9 antibody thus generating a bi-specific molecule.


Finally, e.g. in the absence of available suitable existing Ab's for both CD32 and TLR9, it is also possible to construct a bi-specific molecule using the small mutated immunoglobulin domain libraries from CH1. CH2 CH3 or CL to select specific binders for both CD32 and TLR9 which are subsequently combined to form new structures existing of at least 1 binding structure specific for CD32 and 1 binding structure specific for TLR9 derived from any of the possible libraries in any of the possible combinations (CH1-CH1 or CH1-CH2 or CH1 CH3 or CH2-CH4, or CH3-CH4, or CH1-CH4 or or CH2-CH3 etc).


Alternatively, a single variable domain of the immunoglobulin superfamily may be selected for binding to TLR9 or CD32 with CDR-loops. The selected binder is then randomized at non-structural loop positions to generate a library of variable domains which is selected for the respective other antigen, ie. in case of a variable domain binding with CDR loops to TLR9 the selection is for binding to CD32 and vice versa. It is also possible to select a library of a V-domain which contains variations in the CDR loops at the same time as variations in the non-CDR-loops for binding to TLR9 and CD32 sequentially or simultaneously.


Such bispecific V-domains may also be part of antibodies or antibody fragments such as single-chain-Fvs. Fabs or complete antibodies.


Selection of a suitable TLR9 epitope:


Sequence 244-256 (SEQ ID No 1) of the mature TLR9 protein in amino acid 1 letter code:











CPRHFP QLHPDTFS



244    250    257







will fulfill criterion 1 and 2 but not 3, whereas


Sequence 176-191 (SEQ ID No 2) of the mature protein TLR9 in amino acid 1 letter code











LTHL SLKYNNLTVV PR



176  180        191







and


Sequence 216-240 of the mature protein TLR9 (SEQ ID No 3) in amino acid 1 letter code











ANLT ALRVLDVGGN CRRCDHAPNP C



216  220        230        240







will fulfill all three criteria and are thus preferred for use in this invention.


The process for producing the molecule or molecule complex is carried out according to known methods, e.g. by using recombinant cloning techniques or by chemical cross linking.


A product as described in this invention can be produced in the following way:


The obtained VH and VL of the anti-CD32 antibody are fused to CH1 and CL respectively. The CL has previously been engineered using SMID technology (PCT/EP2006/050059) and selected using phage display to bind to TLR9 as described below. CH1 is fused at its C-terminus to a sequence encoding the selected T cell epitopes. These two fusion-protein encoding genes are cloned into an expression vector allowing the expression of two independent genes (or into two independent expression vectors) and are co-expressed in bacteria, yeast or animal cells or any other suitable expression system. Thus, an Fab with the desired characteristics, i.e. binding to CD32, binding to TLR9 and carrying the relevant T-cell epitopes is produced.


Alternative examples applying SMID technology:

    • An scFv against TLR9 is derived from a phage display library or from an existing hybridoma, and a CD32 binding molecule is derived from a CH2-CH4, or CH3-CH4, or CH1-CH4 or small mutated immunoglobulin domain library. These two coding sequences are ligated together and a sequence coding for T cell epitopes is attached. The fusion protein is then expressed in bacteria, yeast or animal cells or any other suitable expression system
    • Alternatively, TLR9-specificity and CD32-specificity are swapped: An scFv against CD32 is derived e.g. from a phage display library or from an existing hybridoma, and a TLR9-binding molecule is derived from a CH2-CH4, or CH3-CH4, or CH1-CH4 or small mutated immunoglobulin domain library. These two coding sequences are ligated together and a sequence coding for T cell epitopes is attached. The fusion protein is then expressed in bacteria, yeast or animal cells or any other suitable expression system
    • VH and VL of an anti-TLR9 antibody are fused to CH1 and CL respectively. CL has previously been engineered and selected using phage display to bind to CD32 (SMID). CH1 is fused at its C-terminus to a sequence encoding the T cell epitopes. These two fusion-protein encoding genes are cloned into an expression vector allowing the expression of two independant genes (or into two independent expression vectors) and are coexpressed in bacteria, yeast or animal cells or any other suitable expression system. (again, anti-TLR9 and anti-CD32 can be swapped. CH1 and CL can also be swapped)
    • Heavy and light chain genes of an anti-TLR9 antibody are taken as a whole. In the heavy chain gene, the CH2 (or CH1 or CH3 or CH4) region is replaced by a CH2 (or CH1 or CH3 or CH4 or CL or VH or VL) region which has previously been engineered and selected using phage display to bind to CD32 (small mutated immunoglobulin domain). CH1, CH2, CH3 or CH4 is fused at its C-terminus to a sequence encoding the T cell epitopes. These two genes are again cloned in expression vectors and expressed in animal cells.
    • 2 small mutated immunoglobulin domains, one specific for TLR9, the other specific for CD32 are fused and combined with T-cell epitopes
    • 1 small mutated immunoglobulin domain with 2 different specificities (TLR9 and CD32) is combined with T-cell epitopes


Antigens and Epitopes

The antigens that are part of the molecule or molecule complex according to the invention can be complete allergens, denatured allergens or any antigens that are treated in any possible way to prevent binding to IgE. Such treatment may consist of epitope shielding of the antigenic protein using high affinity IgM, IgD, IgA or IgG antibodies directed to the same epitopes as the patient's IgE antibodies as described by Leroy at al [20]. Such antibodies may also bind close to the IgE specific epitopes thus preventing binding of the IgE antibodies by sterical hindrance


Allergens are generally defined as antigens to which atopic patients respond with IgE antibody responses subsequently leading to allergic reactions. Antigens used in the molecule or the molecule complex of the invention can be environmental allergens (e.g. house dust mite, birch pollen, grass pollen, cat antigens, cockroach antigens), or food allergens (e.g. cow milk, peanut, shrimp, soya), or a combination of both. Also non relevant antigens such as HSA can be part of the molecule or molecule complex according to the invention. The antigen can be a complete allergen, exemplary an allergen for which patients with atopic dermatitis, allergic asthma, allergic rhinitis or allergic conjunctivitis are allergic. Preferably the allergen use in the molecule or molecule complex according of the Invention does not bind to IgE from the patient in need of treatment


The antigens and/or epitopes used in the invention can be from natural sources or be produced by recombinant technology or be produced synthetically. Antigens and/or epitopes of the invention may contain ligand structures which facilitate incorporation of antigens and/or epitopes into molecule complexes of the invention via ligand/receptor interactions or antibody binding. Antigens and/or epitopes of the invention may contain chemical groups which facilitate covalent linkage of the antigens and/or epitopes to the CD32- and/or TLR9-binding structures of the molecule of the invention.


In one embodiment of the invention the antigens and epitopes of the molecule or molecule complex of the invention may be covalently linked to the CD32 binding structure and/or to the TLR9 binding structure.


In one embodiment antigens and/or epitopes may also be linked by a ligand/receptor interaction such as biotin and avidin to the molecule or molecule complex of the invention. For example, the antigens or epitopes to be used in the molecule of the invention may be produced with biotin or a biotin mimetic attached to it. The CD32 binding structure and/or the TLR9 binding structure may be produced with avidin or another biotin-specific ligand attached to it. After mixing of these molecules with the different attachments, a stable molecule complex is formed according to the invention. Alternatively, an antibody/antigen binding can be used to form a molecule complex of the invention. High affinity interactions are preferred for these embodiments (e.g. high affinity anti-digoxigenin antibody and digoxigenin labeled antigens and/or epitopes).


In one embodiment of the invention the antigens and/or epitopes are genetically fused to the CD32-binding structure and/or to the TLR9-binding structure.


If the molecule of the invention is a fusion protein, the antigen is preferably produced from at least one T-cell epitope-containing DNA-subsequence of an allergen. The T cell epitopes can alternatively be from one or more related and/or unrelated allergens.


Preferably, the T cell epitopes comprise a new protein, which is not as such a naturally existing protein and therefore is not recognized by existing IgE or IgG antibodies in the patient. Therefore, instead of selecting short T cell epitopes which are cut apart and fused together again in a different order, one could also select a larger stretch of T cell epitopes (>28 AA) which are still in their natural order but which have been previously selected not to bind to allergen specific IgE [21].


In principle all known antigens can be used for incorporation into the molecule or molecule complex of the invention to which allergic patients respond with IgE mediated hypersensitivity reactions. The most common environmental allergens in the developed countries are: House dust mite, birch pollen, grass pollen, cat, and cockroach. Each of these allergens has one or more “major allergens” (e.g. house dust mite: major allergen=Der P1; Der F1, birch pollen: major allergen=Bet V1). However, complete antigens, though possible, are not necessary, because the molecule or molecule complex should only induce T cell responses, and T cells respond to small (ca. 12-28 aminoacid long) peptides presented in MHC Class II molecules. The selection of T cell epitopes should be designed in such a way that expression on HLA class II molecules of possibly all patients is guaranteed. Some HLA class II molecules are more frequently expressed than others. A good example for such a HLA class II molecule with wide expression is HLA DPw4, which is expressed on approximately 78% of the Caucasian population [22]. Therefore a selection of T cell epitopes could be included in the molecule or molecule complex for each allergen, thus reducing the size and molecular weight of the complex. If overlapping cross-reactive epitopes between allergens from different genetically related organisms, such as Dermatophagoides pteronyssinus (Der P1) and Dermatophagoides farinae, (Der F1), are present, they are preferred.


To allow for correct antigen processing, DNA coding for stretches slightly longer then the actual T cell epitope should be included in the molecule or molecule complex and/or the epitopes can be separated from each other by introducing stretches of spacer DNA preferably containing (hydrophobic) epitopes recognized by major protein processing enzymes in antigen presenting cells such the asparagine-specific endopeptidase (AEP) or cathepsin S, cathepsin D or cathepsin L [23].


For fusion to the genes coding for the binding structures specific for TLR9 and CD32, preferably short DNA sequences of major allergens are used such as house dust mite major allergen I (Der P1, Der F1), house dust mite major allergen II (Der P2, Der F2), or birch pollen allergen (Bet V1). These short DNA sequences contain the genetic code for one or more T cell epitopes, which after processing, appear on the surface of antigen presenting cells and therefore induce an immune response in the responding allergen specific T cells. Not only T cell epitopes from Der P1 and Der P2 but also Der P3, Der P4, Der P5, Der P6, Der P7 etc. and Der F3, Der F4, Der F5, Der F6, Der F7 etc can be used in a molecule or molecule complex of the invention. T cell epitopes from these allergens may be selected by classical epitope mapping using T cell clones [24] or by using modern HLA Class II predicting software such as the Tepitope program [25; 26]. For the molecule or molecule complexes, which can be formulated as vaccine, it is not necessary to combine T cell epitopes from a single allergen source only; to the contrary it is preferred to include as many T cell epitopes derived from different allergen sources produced by one or many different species, e.g a combination of allergens from house dust mites and of allergens from grass pollen, cats and/or birch pollen.


As an example for Der P1 the majority of the T cell epitopes can be found in the following sequences 101-143 of the mature protein in amino acid 1 letter code (SEQ ID No 4):










QSCRRPNAQ RFGISNYCQI YPPNANKIRE ALAQPQRYCR HYWT



101       110        120        130       140 143






Especially the amino acid sequence 101-131 contains at least 3 T cell epitopes24, which bind to a number of HLA class II molecules in amino acid 1 letter code (SEQ ID No 5):












QSCRRPNAQ RFGISNYCQI YPPNANKIRE AL




101       110        120         131






The sequence 107-119 contains an important T cell epitope that binds to HLA DPw4 as well as HLA DPw524. These HLA Class II molecules are expressed by the majority of the population. The epitope in amino acid 1 letter code (SEQ ID No 6):











NAQ RFGISNYCQI



107 110      119






Other important T cell epitopes which in addition are shared between Der P1 and Der F1 are found in the sequences 20-44 and 203-226 of the mature protein in amino acid 1 letter code:











(SEQ ID No 7)




RTVTPIRMQ GCGSCWAFSG VAATE




20        30         40  44



and







(SEQ ID NO 8)



YDGRTII QRDNGYQPN HAVNIVGY



203     210       220    227






Examples of T cells epitopes shared between Der P2 and Der F2 are found in the sequence 26-44, 89-107 and 102-123











(SEQ ID No 9)



PCII HRGKPFQLEA VFEAN



26   30         40  44







(SEQ ID No 10)



K YTWNVPKIAP KSENVVVT



89           100     107







(SEQ ID No 11)



ENVVVTVK VMGDDGVLAC AIAT



102      110        123 127






From the above mentioned T cell epitopes of Der P1/F1 and Der P2/F2 one can design several functional molecule or molecule complexes, e.g:


By taking from Der P1 the following sequences:











(Sequence A, SEQ ID No 12)




QSCRRPNAQ RFGISNYCQI YPP




101       110        120







(Sequence B, SEQ ID No 13)



CQI YPPNANKIRE AL



117 120        130







(Sequence C, SEQ ID No 14)



IRE ALAQPQRYCR HYWT



127 130        140 143







(Sequence D, SEQ ID No 7)




RTVTPIRMQG GCGSCWAFSG VAATE




20         30         40   44







(Sequence E, SEQ ID No 8)



YDGRTII QRDNGYQPNY HAVNIVGY



203     210        220     227






And from Der P 2











(Sequence F, SEQ ID No 9)



PCII HGKPFQLEA VFEAN



26   30        40   44







(Sequence G, SEQ ID No 10)



K YTWNVPKIAP KSENVVVT 



89           100    107







(Sequence H, SEQ ID No 11)



ENVVVTVK VMGDDGVLAC AIAT



102      110        120 123






One can design a cDNA with the order B,A,E,H,G,C,F,D or H,A,D,C,F,G,E,B, but any possible combination of the selected sequences will do. The preferred order of the epitopes will largely be determined on the basis of expression efficiency of the complete recombinant molecule. Also duplications of sequences are allowed e.g. B,B,A,E,A,E,G,C,G,F,A,D etc. The T cell epitope part may of course also contain the genetic codes for shorter peptides or longer peptides for more and for fewer peptides, as long as one or more T cell epitopes from one or more different allergens/antigens are included.


Epitopes from other allergens such as Bet V1, LoI P1, FeI d1 with similar characteristics will be preferred for inclusion in the molecule or molecule complex according to the invention.


The invention also concerns a method of treating diseases, especially allergies, which comprises administering to a subject in need of such treatment a prophylactically or therapeutically effective amount of a molecule or molecule complex according to the invention for use as a pharmaceutical, especially as an agent against allergies.


The molecule or molecule complex may be admixed with conventional pharmaceutically acceptable diluents and carriers and, optionally, other excipients and administered parenterally intravenously or enterally, e.g. intramuscularly and subcutaneously. The concentrations of the molecule or molecule complex will, of course, vary depending i.a. on the compound employed, the treatment desired and the nature of the form.


For different Indications the appropriate doses will, of course, vary depending upon, for example, the molecule or molecule complex used, the host, the mode of application and the intended indication. However, in general, satisfactory results are indicated to be obtained with 1 to 4 vaccinations in 1-2 years, but if necessary repeated additional vaccination can be done. It is indicated that for these treatments the molecule or molecule complex of the invention may be administered in 2-4 doses and with an application schedule similar as conventionally employed.


It further concerns a molecule or molecule complex according to the invention for use as a pharmaceutical, particularly for use in the treatment and prophylaxis of allergies.


The pharmaceutical composition prepared according to the present invention for use as vaccine formulation can (but does not have to) contain at least one adjuvant commonly used in the formulation of vaccines apart from the molecule or molecule complex. It is possible to enhance the immune response by such adjuvants. As examples of adjuvants, however not being limited to these, the following can be listed: aluminium hydroxide (Alu gel), QS-21, Enhanzyn, derivatives of lipopolysaccharides, Bacillus Calmette Guerin (BCG), liposome preparations, formulations with additional antigens against which the immune system has already produced a strong immune response, such as for example tetanus toxoid, Pseudomonas exotoxin, or constituents of influenza viruses, optionally in a liposome preparation, biological adjuvants such as Granulocyte Macrophage Stimulating Factor (GM-CSF), interleukin 2 (IL-2) or gamma interferon (IFNγ).


Aluminium hydroxide is the most preferred vaccine adjuvant.


Summary of a possible mode of action of the fusion protein according to the invention:


The fusion protein according to the present invention, can be formulated in any of the available acceptable pharmaceutical formulations, but is preferably formulated as a vaccine. The aCD32 binding portion of the fusion protein according to the invention selects the relevant cells. Triggering of CD32 on these cells will actively induce internalization of the receptor plus the attached fusion protein and by doing so facilitates the interaction of the TLR9 binding portion of the fusion protein with the TLR9, which is expressed within the cytoplasm of the relevant antigen presenting cells [10;11].


As a consequence of the CD32 mediated internalization, the subsequent processing and presentation of the selected T cell epitopes on MHC Class II molecules, combined with the specific activation of cytoplasmic TRL9 in the antigen presenting cells, allergen specific T cells will be (re-)programmed to become Th1 memory cells. These allergen specific Th1 memory cells at a later time point will induce allergen specific IgG production when encountering the same epitopes derived from the natural allergens presented by naturally exposed allergen specific 8 cells. These Th1 cells thus are necessary for rebalancing the immune system from IgE to IgG dominated antibody production.


EXAMPLES

The following examples shall explain the present invention in more detail, without, however, restricting it.


Example 1

Panning of the human CL—phage library on a TLR-9 peptide e.g. sequence 216-240 of the mature protein TLR9 (SEQ ID No 3) in amino acid 1 letter code











ANLT ALRVLDVGGN CRRCDHAPNP C



216  220        230        240






3 panning rounds shall be performed according to standard protocols. Briefly, the following method can be applied. Maxisorp 96-well plates (Nunc) are coated with the (synthetic) peptide representing part of the sequence of the TLR-9. For coating the peptides in the wells, 200 μl of the following solution are added per well: 0.1M Na-carbonate buffer, pH 9.6, with the following concentrations of dissolved peptide:

    • 1st panning round: 1 mg/ml TLR-9 peptide
    • 2nd panning round: 500 μg/ml TLR-9 peptide
    • 3rd panning round: 100 μg/ml TLR-9 peptide


Incubation is for 1 hour at 37° C., followed by blocking with 2% dry milk (M-PBS) with 200 μl per well for 1 hour at room temperature. The surface display phage library is then allowed to react with the bound peptide by adding 100 μl phage suspension and 100 μl 4% dry milk (M-PBS), followed by incubation for 45 minutes with shaking and for 90 minutes without shaking at room temperature. Unbound phage particles are washed away as follows. After the 1st panning round: 10×300 μl T-PBS, 5×300 μl PBS; after the 2nd panning round: 15×300 μl T-PBS, 10×300 μl PBS; after the 3rd panning round: 20×300 μl T-PBS, 20×300 μl PBS. Elution of bound phage particles is performed by adding 200 μl per well of 0.1 M glycine, pH 2.2, and incubation with shaking for 30 minutes at room temperature. Subsequently, the phage suspension is neutralized by addition of 60 μl 2M Tris-Base, followed by infection into E. coli TG1 cells by mixing 10 ml exponentially growing culture with 0.5 ml eluted phage and incubation for 30 minutes at 37° C. Finally, infected bacteria are plated on TYE medium with 1% glucose and 100 μg/ml Ampicillin, and incubated at 30° C. overnight.


Example 2
Cloning of Selected Clones of Human CL Mutants Selected Against TLR-9 for Soluble Expression

Phagemid DNA from the phage selected through the 3 panning rounds is isolated with a midi-prep. DNA encoding mutated CL-regions is batch-amplified by PCR and cloned NcoI-NotI into the vector pNOTBAD/Myc-His, which is the E. coli expression vector pBAD/Myc-His (Invitrogen) with an inserted NotI restriction site to facilitate cloning. Ligated constructs are transformed into E. coli LMG194 cells (Invitrogen) with electroporation, and grown at 30° C. on TYE medium with 1% glucose and ampicillin overnight. Selected clones are inoculated into 200 μl 2×YT medium with ampicillin, grown overnight at 30° C., and induced by adding L-arabinose to an end concentration of 0.1%. After expression at 16° C. overnight, the cells are harvested by centrifugation and treated with 100 μl Na-borate buffer, pH 8.0, at 4° C. overnight for preparation of periplasmic extracts. 50 μl of the periplasmic extracts were used in ELISA (see below).


Example 3
ELISA of Human CL Mutants Selected Against TLR-9

Selected clones are assayed for specific binding to the TLR-9 peptide by ELISA.


Coating: Microtiter plate (NUNC, Maxisorp), 100 μl per well, 20 μg TLR-9 peptide/ml 0.1 M Na-carbonate buffer, pH 9.6, 1 h at 37° C.


Wash: 3×200 μl PBS
Blocking: 1% BSA-PBS, 1 h at RT
Wash: 3×200 μl PBS

Periplasmic extract binding: 50 μl periplasmic extract


50 μl 2% BSA-PBS, at room temperature overnight


Wash: 3×200 μl PBS

1st antibody: anti-His4 (Qiagen), 1:1000 in 1% BSA-PBS, 90 min at RT, 100 μl per well


Wash: 3×200 μl PBS

2nd antibody: goat anti mouse*HRP (SIGMA), 1:1000 in 1% BSA-PBS, 90 min at RT, 100 μl per well


Wash: 3×200 μl PBS

Detection: 3 mg/ml OPD in Na-citrate/phosphate buffer, pH 4.5, 0.4 μl 30% H2O2


Stopping: 100 ml 3M H2SO4

Absorbance read: 492/620 nm


Clones that give a high signal in this first, preliminary ELISA are cultured in a 20-ml volume at the same conditions as described above. Their periplasmic extracts are isolated in 1/20 of the culture volume as described above and tested with ELISA (as described above) for confirmation.


Example 4
Cloning of the Anti-CD32 Variable Domains from HB-217

mRNA is isolated from the cell line HB-217 (ATCC, antiCD32 antibody IV.3) and is used to prepare cDNA according to established routine protocols. The cDNA is further used as a template to amplify the regions of the genes coding for the of the light and the heavy chain of the Fab fragment of antibody IV.3 respectively. Upstream PCR primers, which prime from the 5′ end of the variable regions, used for this amplification are derived from the published sequences of mouse variable regions (IMGT, the international ImMunoGeneTics information System® http://imgt.cines.fr). Degenerate primers and/or mixtures of different primers are used as upstream primers. Downstream primers are designed such as to prime from the 3′ end of the CL or the CH1 domains respectively.


In a next step, the CL domain of the antibody IV.3 is removed and replaced by a selected CL domain modified by SMID technology which has binding affinity to TLR9, and which is selected as described above in examples 1-3. For this replacement, overlapping PCR can be used according to standard protocols. Alternatively, for joining VL to the SMID modified CL a uniquely cutting restriction site can be used which is either naturally occurring in the sequence or which is artificially introduced by site directed mutagenesis (as a silent mutation which does not change the amino acid sequence). For example, a BstAPI site can be generated in the hinge region between VL and CL by changing the sequence from:










 K  R  A  D  A  A  P  T  V  S  I  F
(SEQ ID No 65)


AAACGGGCTGATGCTGCACCAACTGTATCCATCTTC
(SEQ ID No 66)







to:










 K  R  A  D  A  A  P  T  V  S  I  F
(SEQ ID No 65)


AAACGGGCAGATGCTGCACCAACTGTATCCATCTTC
(SEQ ID No 15)







the newly created BstAPI site is highlighted in the above sequence. The new sequence is introduced in the coding regions by amplifying the VL part and the CL part respectively with appropriately designed PCR primers, cutting the PCR products with BstAPI, ligating them, and amplifying the complete resulting ligation product with PCR primers as used initially for amplifying the original light chain part of the Fab fragment.


For expression of the modified Fab fragment, the genes coding for the heavy and the light chains are subsequently cloned in appropriate expression vectors, or together in one expression vector which allows the expression of two independent genes. As an expression system, bacteria, yeast, animal cells or any other suitable expression system can be used. For this example here, expression from one vector in the methylotrophic yeast Pichia pastoris will be shown:


The light chain part of the modified PCR fragment is cloned EcoRI/Kpn1 in the Pichia pastoris expression vector pPICZalphaA in the correct reading frame such as to fuse it functionally with the alpha-factor secretion signal sequence provided by the vector. Similarly, the heavy chain part of the Fab fragment is cloned in pPICZalphaA. In order to prepare the inserts for this cloning procedure, appropriately designed PCR primers are used which attach the needed restriction sites to the genes. At the 3′ ends of both coding regions, a stop codon has to be inserted and provided by the PCR primers as well. The light chain expression cassette is then cut out from the vector with restriction enzymes BglII and BamHI, and the ends of the DNA are made blunt by treatment with Klenow fragment of DNA polymerase. The vector containing the inserted heavy chain part of the Fab is opened by a partial digest with restriction enzyme BglII, the DNA is made blunt by treatment with Klenow fragment of DNA polymerase, and the expression cassette coding for the light chain part is inserted. The partial digest of the heavy chain vector is necessary since the inserted heavy chain gene contains a BglII site. For screening of the final construct, care has to be taken that this internal BglII site has remained intact. The final construct has one PmeI site which is used for linearizing the construct prior to transformation into Pichia pastoris. This linearization is advantageous for efficient integration of the expression vector in the host genome by homologous recombination. Pichia pastoris is transformed with the linearized expression vector using electroporation, transformed clones are selected with the antibiotic Zeocin for which the vector confers resistance, and supernatants of randomly picked clones are screened for expression of the Fab construct after induction of expression with methanol. For screening, e.g. a Fab-specific ELISA can be used. Production of the recombinant protein is achieved by culturing the transformed selected Pichia clone in a larger scale, preferable in shake flasks or in a fermenter, inducing expression by addition of methanol and purifying the recombinant protein by a chromatographic method. For these latter steps, routine protocols are used.


Example 5
Cloning of the Der P1I/F1 and Der P2/F2 Derived T Cell Epitopes

The combination of the selected T cell epitopes formed by sequences B,A,E,H,G,C,F,D looks a follows (SEQ ID No 16):











CQIYPPNANKIREAL
QSCRRPNAQRFGISNYCQIYPP



     (Seq: B)            (Seq. A)







YDGRTIIQRDNGYPQNYHAVNIVGY
ENVVVTVKVMGDDGVLACAIAT



          (Seq. E)                (Seq. H)







KYTWNVPKIAPKSENVVVT
IREALAQPQRYCRHYWT



        (Seq. G)       (Seg. C)







PCIIHRGKPFQLEAVFEAN
RTVTPIRMQGGCGSCWAFSGVAATE



      (Seq. F)                 (Seq. D)






In order to construct a synthetic gene coding for this amino acid sequence, in silico reverse translation can be used. Computer programs are available for this purpose, such as e.g. DNAWORKS (http:/molbio.info.nih.gov/dnaworks/). In order to clone the synthetic gene coding for the epitopes in frame with the gene coding for the heavy chain part of the framework, two restriction sites are selected which cut neither on this coding region nor on the vector pPICZalphaA. For example, AccIII and SpeI can be used for this purpose. These two restriction sites are attached to the gene coding for the heavy chain part of the Fab by using appropriately designed PCR primers for the cloning procedure as described above. Furthermore, care has to be taken not to have a stop codon at the end of the coding region of the heavy chain part of the Fab, as the stop codon will be provided at the 3′ end of the synthetic gene coding for the epitopes. Again, this construct with the two additional restriction sites located at its 3′ end is cloned EcoRI/KpnI in the Pichia pastoris expression vector pPICZalphaA. The construct is then opened with the restriction enzymes AccIII and SpeI and the insert coding the epitopes in inserted. This insert is generated as follows:


The chosen amino acid sequence









(SEQ ID No. 16)




CQIYPPNANKIREAL
QSCRRPNAQRFGISNYCQIYPPYDGRTIIQRDN








GYQPNYHAVNIVGY
ENVVVTVKMGDDGVLACAIATKYTWNVPKIAPKS








ENVVVT
IREALAQPQRYCRHYWTPCIIHRGKPFQLEAVFEAN







RTVTPIRMQGGCGSCWAFSGVAATE








together with the chosen restriction sites, in this example Accill at the 5′ end and SpeI at the 3′ end are used as input in the publicly available computer program DNAWORKS. In addition, a stop codon is added between the end of the epitope sequence and the SpeI site.


The parameters which the program uses for designing the oligonucleotides are left at the proposed standard values, and the program is instructed to avoid the sequences of the restriction sites which are necessary for the cloning and transformation steps, such as AccIII, SpeI and PmeI.


AccIII: tccgga


SpeI: actagt


PmeI: gtttaaac


DNAWORKS generates a set of oligonucleotides which are overlapping and which represent both strands of the desired coding regions.


For example, the following set of 24 oligonucleotides is generated, from which the synthetic gene coding for the allergen epitopes is generated:

















 1
TCCGGATGCCAAATTTACCCGCCAAACG
28
(SEQ ID No 17)





 2
AGCCTCTCTGATCTTGTTCGCGTTTGGCGGGTAAATTTGG
40
(SEQ ID No 18)





 3
CGAACAAGATCAGAGAGGCTTTGCAATCTTGCAGGAGGCC
40
(SEQ ID No 19)





 4
TATGCCGAATCTCTGCGCATTGGGCCTCCTGCAAGATTGC
40
(SEQ ID No 20)





 5
GCGCAGAGATTCGGCATATCCAACTACTGCCAGATCTACC
40
(SEQ ID No 21)





 6
GTACGCCCATCGTATGGGGGGTAGATCTGGCAGTAGTTGG
40
(SEQ ID No 22)





 7
CCCATACGATGGGCGTACAATCATACAGCGTGATAACGGC
40
(SEQ ID No 23)





 8
GCGTGGTAGTTAGGCTGATAGCCGTTATCACGCTGTATGA
40
(SEQ ID No 24)





 9
TATCAGCCTAACTACCACGCCGTGAACATCGTCGGCTACG
40
(SEQ ID No 25)





10
TCACAGTAACCACGACATTCTCGTAGCCGACGATGTTCAC
40
(SEQ ID No 26)





11
AGAATGTCGTGGTTACTGTGAAGGTAATGGGCGATGACGG
40
(SEQ ID No 27)





12
AGCTATGGCGCAAGCTAGAACCCCGTCATCGCCCATTACC
40
(SEQ ID No 28)





13
TCTAGCTTGCGCCATAGCTACCAAGTACACTTGGAACGTA
40
(SEQ ID No 29)





14
TTTTCGGCGCAATTTTGGGTACGTTCCAAGTGTACTTGGT
40
(SEQ ID No 30)





15
CCCAAAATTGCGCCGAAAAGTGAAAACGTCGTAGTGACCA
40
(SEQ ID No 31)





16
TGAGCCAATGCCTCCCTTATGGTCACTACGACGTTTTCAC
40
(SEQ ID No 33)





17
AGGGAGGCATTGGCTCAACCTCAAAGATACTGCAGACACT
40
(SEQ ID No 33)





18
TTATGCAGGGCGTCCAGTAGTGTCTGCAGTATCTTTGAGG
40
(SEQ ID No 34)





19
ACTGGACGCCCTGCATAATCCACCGTGGTAAACCCTTTCA
40
(SEQ ID No 35)





20
CTTCGAACACTGCCTCAAGTTGAAAGGGTTTACCACGGTG
40
(SEQ ID No 36)





21
ACTTGAGGCAGTGTTCGAAGCTAACAGGACGGTAACGCCA
40
(SEQ ID No 37)





22
CCGCACCCACCTTGCATACGAATTGGCGTTACCGTCCTGT
40
(SEQ ID No 38)





23
TGCAAGGTGGGTGCGGGTCTTGTTGGGCTTTTTCTGGTGT
40
(SEQ ID No 39)





24
ACTAGTTTATTCAGTAGCAGCCACACCAGAAAAAGCCCA
42
(SEQ ID No 40)



ACA









These 24 oligonucleotides are dissolved, mixed together, boiled for several minutes and then cooled down to room temperature slowly to allow annealing. In a subsequent PCR steps using large amounts of the two bordering primers (primers #1 and #24), the annealed gene is amplified, the PCR product is then cleaved with the chosen restriction enzymes (AccIII and SpeI in this example), and cloned into the expression vector as described above, which contains as an insert the gene coding for the heavy chain part of the modified Fab. Preparation of the final expression vector containing both chains, transformation of Pichia pastoris, selection of clones and screening for producing clones is done as described above. Expression and purification of the recombinant protein is performed by following standard protocols.


Example 6

Fusion of VH and VL of the Anti-CD32 Antibody IV.3 Fusion with Anti-TLR9 CH3 Domains (SMIDS)


All molecular modeling was done with Swiss-PdbViewer 3.7 (http://swissmodel.expasy.org/spdbv/)


As a homology model for a mouse Fab fragment, the structure file 2BRR.pdb from the Protein Data Bank (www.pdb.org) is used, and 1OQO.pdb is used as a source for the structure of a human IgG CH3 domain.


Molecular models of VH and VL of the IV.3 antibody are made with the “first approach mode” of Swissmodel http://swissmodel.expasy.org/SWISS-MODEL.html) using the amino acid sequences of VH and VL respectively.


Using the “magic fit” function of the Swiss-PdbViewer, two copies of the CH3 domain structure from 1OQO.pdb are fitted onto the CH1 and the CL domain respectively of 2BRR.pdb. Subsequently, the molecular models of the IV.3 VH and VL respectively are fitted (again using “magic fit”) onto VH and VL of 28RR.pdb.


For construction of an Fab-like protein in which CH1 and CL are both replaced by a CH3 domain, it is necessary to decide at which point the sequence of VH should be ended and connected to the sequence of CH3, and at which point the sequence of VL should be ended and connected to the sequence of CH3. For both constructs, a point is chosen at which the main chain of the superimposed structures and models (see above) shows an optimal overlap.


For the light chain, it was found that the sequence up to Ala114 (numbering from 2BRR.pdb) will be used an connected to Pro343 (numbering from 1OQO.pdb) of the CH3 domain. The point of connection between these two sequences therefore reads as follows (VL part is underlined):


- - - Lys112-Arg113-Ala114-Pro343-Arg344-Glu345 - - -

In order to allow joining of the two coding sequences using restriction enzyme sites and DNA ligation, the sequence near the point of connection is changed by silent mutation to introduce a unique XhoI site (ctcgag, underlined) as follows:











(SEQ ID No 41)



 K  R  A  P  R  E







(SEQ ID No 42)



AAACCGGCTCCTCGAGAA






For later insertion of the allergen epitopes, an AscI site (ggcgcgcc) is introduced just before the stop codon of the construct plus an extra base for maintenance of the reading frame:


ggg cgc gcc


Gly Arg Ala

Furthermore, for cloning into the expression vector pPICZalphaA (Pichia pastoris expression system, Invitrogen), an EcoRI site (gaattc) is added to the 5′-end (N-terminus) and a KpnI site (ggtacc) to the 3′-end (C-terminus) of the construct.


The CH3 domain to be fused to VH and VL respectively selected as part of the construct can be a wildtype human IgG CH3 domain which can serve as a negative control, or a CH3 domain previously engineered by SMID technology and selected to bind specifically to TLR9. In this example here, the sequence of done A23, which binds specifically to TLR9 and which was described in the patent application PCT/EP2006/050059 is fused to both, VH and VL.


Therefore, the complete sequence of the VL-CH3 fusion protein has the following amino acid sequence (VL part is underlined), (SEQ ID No 43):












DIVMTQAAPS VPVTPGESVS ISCRSSKSLL HTNGNTYLHW









FLQRPGQSPQ LLIYRMSVLA SGVPDRFSGS GSGTAFTLSI









SRVEAEDVGV FYCMQHLEYP LTFGAGTKLE LKRAPREPQV








YTLPPSRDEL GIAQVSLTCL VKGFYPSDIA VEWESNGQPE







NNYKTTPPVL DSFGSFFLYS KLTVLGRRWT LGNVFSCSVM







HEALHNHYTQ KSLSLSPGK&






Nucleic acid sequence of the VL-CH3 fusion protein (restriction sites are underlined). (SEQ ID No 44):










gaattcGACA TTGTGATGAC CCAGGCTGCA CCCTCTGTAC 






CTGTCACTCC TGGAGAGTCA GTATCCATCT CCTGCAGGTC 





TAGTAAGAGT CTCCTGCATA CTAATGGCAA CAGTTACTTG 





CATTGGTTCC TACAGAGGCC AGGCCAGTCT CCTCAGCTCC 





TGATATATCG GATGTCCGTC CTTGCCTCAG GAGTCCCAGA





CAGGTTCAGT GGCAGTGGGT CAGGAACTGC TTTCACACTG 





AGCATCAGTA GAGTGGAGGC TGAGGATGTG GGTGTTTTTT 





ACTGTATGCA ACATCTAGAA TATCCGCTCA CGTTCGGTGC 





TGGGACCAAG CTGGAACTGA AACGGGCTCCTCGAGAACCA 





CAGGTGTACA CCCTGCCCCC ATCCCGGGAC GAGCTCGGCA





TCGCGCAAGT CAGCCTGACC TGCCTGGTCA AAGGCTTCTA 





TCCCAGCGAC ATCGCCGTGG AGTGGGAGAG CAACGGGCAG 





CCGGAGAACA ACTACAAGAC CACGCCTCCC GTGCTGGACT 





CCGACGGCTC TTTCTTCCTC TACAGCAAGC TTACCGTGTT 





GGGCCGCAGG TGgACCCTGG GGAACGTCTT CTCATGCTCC





GTGATGCATG AGGCTCTGCA CAACCACTAC ACACAGAAGA 





GCCTCTCCCT GTCTCCGGGT AAATGAgggc gcgccggtac c






For the heavy chain, it was found that the sequence up to Thr123 (numbering from 28RR.pdb) should be used an connected to Arg344 (numbering from 1OQO.pdb) of the CH3 domain. The point of connection between these two sequences therefore reads as follows (VH part is underlined):


- - - Ala121-Lys122-Thr123-Arg344-Glu345-Pro346 - - -

In order to allow joining of the two coding sequences using restriction enzyme sites and DNA ligation, the sequence near the point of connection was changed by silent mutation to introduce a unique XhoI site (ctcgag, underlined) as follows:











(SEQ ID No 45)



 A  K  T  R  E  P







(SEQ ID No 48)



GCCAAPACTCGAGAACCA






Furthermore, for cloning into the expression vector pPICZalphaA (Pichia pastoris expression system, Invitrogen), an EcoRI site (gaattc) is added to the 5′-end (N-terminus) and an XbaI site (tctaga) to the 3′-end (C-terminus) of the construct. No stop codon is added to this sequence and the XbaI site is placed in the correct reading frame so as to fuse the construct to the Hexa-His-tag provided by the vector for later purification of the protein using immobilized metal affinity chromatography.


Therefore, the complete sequence of the VH—CH3 fusion protein has the following amino acid sequence (VH part is underlined). (SEQ ID No 47):












EVQLQQSGPE LKKPGETVKI SCKASGYTFT NYGHNWVKQA









PGKGLKWMGW LNTYTGESIY PDDFKGRFAF SSETSASTAY









LQINSLKNED MATYFCARGD YGYPDPLPYW GQGTSVTVSS









AKTREPQVYT LPPSRDELGI AQVSLTCLVK GFYPSDIAVE








WESNGQPENN YKTTPPVLDS DGSFFLYSKL TVLGRRWTLG







NVFSCSVMHE ALHNHYTQKS LSLSPGKSLE QKLISEEDLN







SAVDHHHHHH&






Nucleic acid sequence of the VH—CH3 fusion protein (restriction sites are underlined). (SEQ ID No 48):










GAATTCGAGG TTCAGCTTCA GCAGTCTGGA CCTGAGCTGA 






AGAAGCCTGG AGAGACAGTC AAGATCTCCT GCAAGGCTTC 





TGGGTATACC TTCACAAACT ATGGAATGAA CTGGGTGAAG 





CAGGCTCCAG GAAAGGGTTT AAAGTGGATG GGCTGGTTAA





ACACCTACAC TGGAGAGTCA ATATATCCTG ATGACTTCAA





GGGACGCTTT GCCTTCTCTT CGGAAACCTC TGGCAGCACT 





GCCTATTTGC AGATCAACAA CCTCAAAAAT GAGGACATGG 





CTAGATATTT CTGTGCAAGA GGGGACTATG GTTACGACGA 





CCCTTTGGAC TACTGGGGTC AAGGAACCTC AGTCACCGTC 





TCCTCAGCCA AAACTCGAGA ACCACAGGTG TACACCCTGC 





CCCCATCCCG GGACGAGCTC GGCATCGCGC AAGTCAGCCT 





GACCTGCCTG GTCAAAGGCT TCTATCCCAG CGACATCGCC 





GTGGAGTGGG AGAGCAACGG GCAGCCGGAG AACAACTACA 





AGACCACGCC TCCCGTGCTG GACTCCGACG GCTCTTTCTT 





CCTCTACAGC AAGCTTACCG TGTTGGGCCG CAGGTGGACC





CTGGGGAACG TCTTCTCATG CTCCGTGATG CATGAGGCTC 





TGCACAACCA CTACACACAG AAGAGCCTCT CCCTGTCTCC 





GGGTAAATCT CTAGAACAAA AACTCATCTC AGAAGAGGAT 





CTGAATAGCG CCGTCGACCA TCATCATCAT CATCATTGA






Detailed Cloning Plan
Heavy Chain:

The VH region of antibody IV.3 is PCR-amplified with primers 4.3HupEco and 4.3HdownXho, and subsequently digested with EcoRI and XhoI. The CH3 SMID-engineered clone A23 is PCR-amplified with primers CH3upXhoA and CH3XBA2 and subsequently digested with XhoI and XbaI. The VH sequence and the CH3 sequence are ligated together via the XhoI site and then ligated into pPICZalphaA (Invitrogen), which was previously digested with EcoRI and XbaI. The resulting vector is named pPICHA23.


Primer List:











4.3HUPECO
cagagaattc gaggttcagc ttcagcagtc (SEQ ID No 49)






4.3HDOWNXHO
gatgctcgag ttttggctga ggagacggtg (SEQ ID No 50)





CH3UPXHOA
aaaactcgag aaccacaggt gtacaccctg cc (SEQ ID No 51) 





CH3XBA2
actgatctag acctttaccc ggagacaggg agag (SEQ ID No 52)






Light Chain:

The VL region of antibody IV.3 is PCR-amplified with primers 4.3LupEco and 4.3LdownXho, and subsequently digested with EcoRI and XhoI. The CH3 SMID-engineered clone A23 is PCR-amplified with primers CH3upXhoB and CH3StopKpn and subsequently digested with XhoI and KpnI. The VL sequence and the CH3 sequence are ligated together via the XhoI site and then ligated into pPICZalphaA (Invitrogen), which was previously digested with EcoRI and KpnI. The resulting vector is named pPICLA23.


Primer List











4.3LUPECO
gatagaattc gacattgtga tgacccaggc tg (SEQ ID No 53)






4.3LDOWNXHO
attactcgag gagcccgttt cagttccagc t (SEQ ID No 54)





CH3UPXHOB
gctcctcgag aaccacaggt gtacaccctg cc (SEQ ID No 55)





CH3STOPKPN
acgtggtacc tcaggcgcgc cctttacccg gagacaggga gag (SEQ ID No 56)






Combination of the Two Expression Cassettes in One Vector

The light chain cassette is cut out with BgIII (pos. 1) and BamHI (pos. 2319) from pPICLA23 (4235 bp), and the 2319 bp fragment is purified via preparative gele electrophoresis. The 1916 bp fragment is discarded. The vector pPICHA23 (4219 bp) is digested with BamHI, and the previously purified 2319 bp fragment from pPICLA23 is inserted. The resulting Pichia pastoris expression vector, which carries two expression cassettes, one for the VL-CH3 fusion protein and on for the VH—CH3 fusion protein is screened so that both inserts that have same direction of transcription. The resulting vector pPICHLA23 (6537 bp) is then linearized before transformation into Pichia pastoris e.g. with BamHI or with BssSI, transformed into Pichia pastoris by electroporation, and positive transformants are selected with Zeocin. Several clones are screened for expression of the recombinant protein. A clone is then selected for large scale production, and the recombinant fusion protein is purified by immobilized-metal-affinity chromatography using standard procedures. All Pichia manipulation, culturing and expression is done by following standard protocols (Invitrogen).


Insertion of Allergen Epitopes into the Vector pPICHLA23 and Expression of the Recombinant Fusion Protein


The sequence encoding the allergen epitopes as described in example 5 is inserted into the vector pPICHLA23 as follows:


The vector is digested with AscI (4174-4182) which leads to its linearization. In this AscI site, the DNA sequence encoding the allergen epitopes is inserted. The sequence encoding the allergen epitopes is amplified with primers EpiTLR1 and EpiTLR2 in order to attach AscI sites to both ends of the sequence.











Primer list



EPiTLR1



(SEQ ID No 57)



TAAAGGGCGC GCCTCCGGAT GCCAAATTTA CC







EpiTLR2



(SEQ ID No 58)



TACCTCAGGC GCGCCTTATT CAGTAGCAGC CACAC






The resulting PCR product is digested with AscI and ligated into the previously digested vector. The resulting vector is named pHLA23EP (7046 bp). Pichia transformation, expression and purification of the recombinant fusion protein is performed as described above for the construct that has no epitopes inserted.


VL of antibody IV.3:









amino acid sequence:


(SEQ ID No 59)


DIVMTQAAPS VPVTPGESVS ISCRSSKSLL HTNGNTYLHW 


FLQRPGQSPQ LLIYRMSVLA SGVPDRFSGS GSGTAFTLSI 


SRVEAEDVGV EYCMQHLEYP LTFGAGTKLE LKRA 





nucleic acid sequence:


(SEQ ID No 60)


GACATTGTGA TGACCCAGGC TGCACCCTCT GTACCTGTCA 





CTCCTGGAGA GTCAGTATCC ATCTCCTGCA GGTCTAGTAA 





GAGTCTCCTG CATACTAATG GCAACACTTA CTTGCATTGG 





TTCCTACAGA GGCCAGGCCA GTCTCCTCAG CTCCTGATAT 





ATCGGATGTC CGTCCTTGCC TCAGGAGTGC CACACAGGTT





GAGTGGCAGT GGGTCAGGAA CTGGTTTGAC ACTGAGCATG 





AGTAGAGTGG AGGCTGAGGA TGTGGGTGTT TTTTACTGTA 





TGGAACATCT AGAATATCCG CTCACGTTCG GTGCTGGGAC 





CAAGCTGGAA CTGAAACGGG CT






VH of Antibody IV.3:









amino acid sequence:


(SEQ ID No 61)


EVQLOQSGPE LKKPGETVKI SCKASGYTFT NYGMNWVQA


PGKGLKWMGW LNTYTGESIY PDDFKGRFAF SSETSASTAY


LQINNLKNED MATYFCARGD YGYDDPLDYW GQGTSVTVSS AKT





nucleic acid sequence:


(SEQ ID No 62)


GAGCTTCAGC TTCAGCAGTC TGGACCTGAG CTGAAGAAGC





CTGGAGAGAC AGTCAAGATC TGCTGCAAGG CTTGTGGGTA





TACCTTCACA AAGTATGGAA TGAACTGGGT GAAGCAGGCT





CCAGGAAAGG GTTTAAAGTG GATGGGCTGG TTAAACACCT





ACACTGGAGA GTCAATATAT CCTGATGACT TCAAGGGACG





GTTTGCCTTC TCTTCGGAAA CCTCTGCCAG CACTGCCTAT





TTGCAGATCA ACAACCTCAA AAATGAGGAC ATGGCTACAT





ATTTCTGTGC AAGAGGGGAC TATGGTTACG ACGACCCTTT





GGACTACTGG GGTCAAGGAA CCTCAGTCAC CGTCTCCTGA





GCCAAAACA







Final Expression Vector pPICHCLA23.seq. (SEQ ID No 63) Containing TLR9 and CD32 Binding Regions


6537 bp











   1
agatctaaca tccaaagacg aaaggttgaa tgaaaccttt ttgccatccg acatccacag






  61
gtccattccc acacataagt gccaaacgca acaggagggg atacactagc agcagaccgt





 121
tgcaaacgca ggacctccac tcctcttctc ctcaacaccc acttttgcca tcgaaaaacc





 181
agcccagtta ttgggcttga ttggagctcg ctcattccaa ttccttctat taggctacta





 241
acaccatgac tttattagcc tgtctatcct ggcccccctg gcgaggttca tgtttgttta





 301
tttccgaatg caacaagctc cgcactacac ccgaacatca ctccagatga gggctttctg





 361
agtgtggggt caaatagttt catgttcccc aaatggccca aaactgacag tttaaacgct





 421
gtcttggaac ctaatatgac aaaagcccga tctcatccaa gatgaactaa gtttggttcg





 481
ttgaaatgct aacggccagc tggtcaaaaa gaaacttcca aaagtcggca taccgtttgt





 541
cttgtttggt attgattgac gaatgctcaa aaataatctc attaatgctt agcgcagtct





 601
ctctatcgct tctgaacccc ggtgcacctg tgccgaaacg caaatgggga aacacccgcc





 561
ttttggatga ttatgcattg tctccacatc gtatgcttcc aagattctgg tgggaatact





 721
gctgatagcc taacgttcat gatcaaaatt taactgttct aacccctact tgacagcaat





 781
atataaacag aaggaagctg ccctgtctta aacctttttt tttatcatca ttattagctt





 841
actttcataa ttgcgactgg ttccaattga caagcttttg attttaacga cttttaacga





 901
caacttgaga agatcaaaaa acaactaatt attcgaaacg atgagatttc cttcaatttt





 961
tactgctgtt ttattcgcag catcctccgc attagctgct ccagtcaaca ctacaacaga





1021
agatgaaacg gcacaaattc cggctgaagc tgtcatcggt tactcagatt tagaagggga





1081
tttcgatgtt gctgttttgc cattttccaa cagcacaaar aacgggttat tgtttataaa





1141
tactactatt gccagcattg ctgctaaaga agaaggggta tctctcgaga aaagagaggc





1201
tgaagctgaa ttcgaggttc agcttcaqca gtctggacct gagctgaaga agcctggaga





1261
gacagtcaag atctcctgca aggcttctgg gtataccttc acaaactatg gaaugaactg





1321
ggtgaagcag gctccaggaa agggtttaaa gtggatgggc tggttaaaca cctacactgg





1361
agagtcaata tatcctgatg acttcaaggg acggtttgcc ttctcttcgg aaacctctgc





1441
cagcactgcc tatttgcaga tcaacaacct caaaaacgag gacatggcca catatttctg





1501
tgcaagaggg gactatggtt acgacgaccc tttggactac tggggtcaag gaacctcagt





1561
caccgtctcc tcagccaaaa ctcgagaacc acaggtgtac accctgcccc catcccggga





1621
tgagctgggc atcgcgcaag tcagcctgac ctgcctggtc aaaggcttct atcccagcga





1681
catcgccgtg gagtgggaga gcaacgggca gccggagaac aactacaaga ccacgcctcc





1741
cgtgctggac tccgacggct ctttcttcct ctacagcaag cttaccgtgt tgggccgcag





1801
gtggaccctg gggaacgtct tctcatgctc cgtgatgcat gaggctctgc acaaccacta





1861
cacgcagaag agcctctccc tgtctccggg taaatctcta gaacaaaaac tcatctcaga





1921
agaggatctg aatagcgccg tcgaccatca tcatcatcat cattgagttt gtagccttag





1981
acatgactgt tcctcagttc aagttgggca cttacgagaa gaccggtctt gctagattct





2041
aatcaagagg atgtcagaat gccatttgcc tgagagatgc aggcttcatt tttgatactt





2101
ttttatttgt aacctatata gtataggatt ttttttgtca ttttgtttct tctcgtacga





2161
gcttgctcct gatcagccta tctcgcagct gatgaatatc ttgtggtagg ggtttgggaa





2221
aatcattcga gtttgatgtt tttcttggta tttcccactc ctcttcagag tacagaagat





2231
taagtgagac cttcgtttgt gcagatccaa catccaaaga cgaaagcttg aatgaaacct





2341
ttttgccatc cgacatccac aggtccattc tcacacataa gtgccaaacg caacaggagg





2401
ggatacacta gcagcagacc gttgcaaacg caggacctcc actcctcttc tcctcaacac





2461
ccacttttgc catcgaaaaa ccagcccagt tattgggctt gattggagct cgctcattcc





2521
aattccttct attaggctac taacaccatg actttattag cctgtctatc ctggcccccc





2581
tggcgaggtt catgtttgtt tatttccgaa tgcaacaagc tccgcattac acccgaacat





2641
cactccagat gagggctttc tgagtgtggg gtcaaatagt ttcatgttcc ccaaatggcc





2701
caaaactgac agtttaaacg ctgtcttgga acctaatatg acaaaagcgt gatctcatcc





2761
aagatgaact aagtttggtt cgttgaaatg ctaacggcca gttggtcaaa aagaaacttc





2821
caaaagtcgg cataccgttt gtcttgtttg gtattgattg acgaatgctc aaaaataatc





2881
tcattaatgc ttagcgcagt ctctctatcg cttctgaacc ccggtgcacc tgtgccgaaa





2941
cgcaaatggg gaaacacccg ctttttggat gattatgcat tgtctccaca ttgtatgctt





3001
ccaagattct ggtgggaata ctgctgatag cctaacgttc atgatcaaaa tttaactgtt





3061
ctaaccccta cttgacagca atatataaac agaaggaagc tgccctgtct taaacctttt





3121
tttttatcat cattattagc ttactttcat aattgcgact ggttccaatt gacaagcttt





3181
tgattttaac gacttttaac gacaacttga gaagatcaaa aaacaactaa ttattcgaaa





3241
cgatgagatt tccttcaatt tttactgctg ttttattcgc agcatcctcc gcattagctg





3301
ctccagtcaa cactacaaca gaagatgaaa cggcacaaat tccggctgaa gctgtcatcg





3361
gttactcaga tttagaaggg gatttcgatg ttgctgtttt gccattttcc aacagcacaa





3421
ataacgggtt attgtttata aatactacta ttgccagcat tgctgctaaa gaagaagggg





3481
tatctctcga gaaaagagag gctgaagctg aattcgacat tgtgatgacc caggctgcac





3541
cctctgtacc tgtcactcct ggagagtcag tatccatctc ctgcaggtct agtaagagtc





3601
tcctgcatac taatggcaac acttacttgc attggttcct acagaggcca ggccagtctc





3661
ctcagctcct gatatatcgg atgtccgtcc ttgcctcagg agtcccagac aggttcagtg





3721
gcagtgggtc aggaactgct ttcacactga gcatcagtag agtggagget gaggatgtgg





3781
gtgtttttta ctgtatgcaa catctagaat atccgctcac gttcggtgct gggaccaagc





3841
tggaaccgaa acgggctcct cgagaaccac aggtgtacac cctggcccca tcccgggatg





3901
agcagggcat cgcgcaagtc agcctgacct gcctggtcaa aggcttctat cccagcgaaa





3961
tcgccgtgga gtgggagagc aacgggcagc cggagaacaa ctacaagacc acgcctcccg





4021
tgctggactc cgacggctct ttcttcctct acagcaagct taccgtgttg ggccgcaggt





4081
ggaccctggg gaacgtcttc tcatgctccg tgatgcatga ggctctgcac aaccactaca





4141
cgcagaagag cctctccctg tctccgggta aagggcgcgc ctgaggtacc tcgagccgcg





4201
gcggccgcca gctttctaga acaaaaactc atctcagaag aggatctgaa tagcgccgtc





4261
gaccatcatc atcatcatca ttgagtttgt agccttagac atgactgttc ctcagttcaa





4321
gttgggcact tacgagaaga ccggtcttgc tagattctaa tcaagaggat gtcagaatgc





4381
catttgcctg agagatgcag gcttcatttt tgatactttt ttatttgtaa cctatatagt





4441
ataggatttt ttttgtcatt ttgtttcttc tcgtacgagc ttgctcctga tcagcctatc





4501
tcgcagctga tgaatatctt gtggtagggg tttgggaaaa tcattcgagt ttgatgtttt





4561
tcttggtatt tcccactcct cttcagagta cagaagatta agtgagacct tcgtttgtgc





4621
ggatccccca cacaccatag cttcaaaatg tttctactcc ttttttactc ttccagattt





4681
tctcggactc cgcgcatcgc cgtaccactt caaaacaccc aagcacagca tactaaattt





4741
tccctctttc ttcctctagg gtgtcgttaa ttacccgtac taaaggtttg gaaaagaaaa 





4801
aagagaccgc ctcgtttctt tttcttcgtc gaaaaaggca ataaaaattt ttatcacgtt





4861
tctttttctt gaaatttttt tttttagttt ttttctcttt cagtgacctc cattgatatt





4921
taagttaata aacggtcttc aatttctcaa gtttcagttt catttttctt gttctattac





4981
aacttttttt acttcttgtt cattagaaag aaagcatagc aatctaatct aaggggcggt





5041
gttgacaatt aatcatcggc atagtatatc ggcatagtat aatacgacaa ggtgaggaac





5101
taaaccatgg ccaagttgac cagtgccgtt ccggtgctca ccgcgcgcga cgtcgccgga





5161
gcggtcgagt tctggaccga ccggctcggg ttctcccggg acttcgtgga ggacgacttc





5221
gccggtgtgg tccgggacga cgtgaccctg ttcatcagcg cggtccagga ccaggtggtg





5281
ccggacaaca ccctggcctg ggtgtgggtg cgcggcctgg acgagctgta cgccgagtgg





5341
tcggaggtcg tgtccacgaa cttccgggac gcctccgggc cggccatgac cgagatcggc





5401
gagcagccgt gggggcggga gttcgccctg cgcgacccgg ccggcaactg cgtgcacttc





5461
gtggccgagg agcaggactg acacgtccga cggcggccca cgggtcccag gcctcggaga





5521
tccgtccccc ttttcctttg tcgatatcat gtaattagtt atgtcacgct tacattcacg





5581
ccctcccccc acatccgctc taaccgaaaa ggaaggagtt agacaacctg aagtctaggt





5641
ccctatttat ttttttatag ttatgttagt attaagaacg ttatttatat ttcaaatttt





5701
tctttttttt ctgtacagac gcgtgtacgc atgtaacatt atactgaaaa ccttgcttga





5761
gaaggttttg ggacgctcga aggctttaat ttgcaagctg gagaccaaca tgtgagcaaa





5821
aggccagcaa aaggccagga accgtaaaaa ggccgcgttg ctggcgtttt tccataggct





5881
ccgcccccct gacgagcatc acaaaaatcg acgctcaagt cagaggtggc gaaacccgac





5941
aggactataa agataccagg gctttccccc tggaagctcc ctcgtgcgct ctcctgttcc





6001
gaccctgccg cttaccggat acctgtccgc ctttctccct tcgggaagcg tggcgctttc





6061
tcaatgctca cgctgtaggt atctcagttc ggtgtaggtc gttcgctcca agctgggctg





6121
tgtgcacgaa ccccccgttc agcccgaccg ctgcgcctta tccggtaact atcgtcttga





6181
gtccaacccg gtaagacacg acttatcgcc actggcagca gccactggta acaggattag





6241
cagagcgagg tatgtaggcg gtgctacaga gttcttgaag tggtggccta actacggcta





6301
cactagaagg acagtatttg gtatctgcgc tctgctgaag ccagttacct tcggaaaaag





6361
agttggtagc tcttgatccg gcaaacaaac caccgctggt agcggtggtt tttttgtttg





6421
caagcagcag attacgcgca gaaaaaaagg atctcaagaa gatcctttga tcttttctac





6481
ggggtctgac gctcagtgga acgaaaactc acgttaaggg attttggtca tgagatc





//








Final Expression Vector pHLA23EP.seq. (SEQ ID No 64) Containing TLR9 and CD32 Binding Regions and Epitope Sequence (See SEQ ID No 16)










7046 bp










   1
agatctaaca tccaaagacg aaaggttgaa tgaaaccttt ttgccatccg acatccacag






  61
gtccattccc acacataagt gccaaacgca acaggagggg atacactagc agcagaccgt





 121
tgcaaacgca ggacctccac tcctcttctc ctcaacaccc acttttgcca tcgaaaaacc





 181
agcccagtta ttgggcttga ttggagctcg ctcattccaa ttccttctat taggctacta





 241
acaccatgac tttattagcc tgtctatcct ggcccccctg gcgaggttca tgtttgttta





 301
tttccgaatg caacaagctc cgcactacac ccgaacatca ctccagatga gggctttctg





 361
agtgtggggt caaatagttt catgttcccc aaatggccca aaactgacag tttaaacgct





 421
gtcttggaac ctaatatgac aaaagcccga tctcatccaa gatgaactaa gtttggttcg





 481
ttgaaatgct aacggccagc tggtcaaaaa gaaacttcca aaagtcggca taccgtttgt





 541
cttgtttggt attgattgac gaatgctcaa aaataatctc attaatgctt agcgcagtct





 601
ctctatcgct tctgaacccc ggtgcacctg tgccgaaacg caaatgggga aacacccgcc





 561
ttttggatga ttatgcattg tctccacatc gtatgcttcc aagattctgg tgggaatact





 721
gctgatagcc taacgttcat gatcaaaatt taactgttct aacccctact tgacagcaat





 781
atataaacag aaggaagctg ccctgtctta aacctttttt tttatcatca ttattagctt





 841
actttcataa ttgcgactgg ttccaattga caagcttttg attttaacga cttttaacga





 901
caacttgaga agatcaaaaa acaactaatt attcgaaacg atgagatttc cttcaatttt





 961
tactgctgtt ttattcgcag catcctccgc attagctgct ccagtcaaca ctacaacaga





1021
agatgaaacg gcacaaattc cggctgaagc tgtcatcggt tactcagatt tagaagggga





1081
tttcgatgtt gctgttttgc cattttccaa cagcacaaar aacgggttat tgtttataaa





1141
tactactatt gccagcattg ctgctaaaga agaaggggta tctctcgaga aaagagaggc





1201
tgaagctgaa ttcgaggttc agcttcaqca gtctggacct gagctgaaga agcctggaga





1261
gacagtcaag atctcctgca aggcttctgg gtataccttc acaaactatg gaaugaactg





1321
ggtgaagcag gctccaggaa agggtttaaa gtggatgggc tggttaaaca cctacactgg





1361
agagtcaata tatcctgatg acttcaaggg acggtttgcc ttctcttcgg aaacctctgc





1441
cagcactgcc tatttgcaga tcaacaacct caaaaacgag gacatggcca catatttctg





1501
tgcaagaggg gactatggtt acgacgaccc tttggactac tggggtcaag gaacctcagt





1561
caccgtctcc tcagccaaaa ctcgagaacc acaggtgtac accctgcccc catcccggga





1621
tgagctgggc atcgcgcaag tcagcctgac ctgcctggtc aaaggcttct atcccagcga





1681
catcgccgtg gagtgggaga gcaacgggca gccggagaac aactacaaga ccacgcctcc





1741
cgtgctggac tccgacggct ctttcttcct ctacagcaag cttaccgtgt tgggccgcag





1801
gtggaccctg gggaacgtct tctcatgctc cgtgatgcat gaggctctgc acaaccacta





1861
cacgcagaag agcctctccc tgtctccggg taaatctcta gaacaaaaac tcatctcaga





1921
agaggatctg aatagcgccg tcgaccatca tcatcatcat cattgagttt gtagccttag





1981
acatgactgt tcctcagttc aagttgggca cttacgagaa gaccggtctt gctagattct





2041
aatcaagagg atgtcagaat gccatttgcc tgagagatgc aggcttcatt tttgatactt





2101
ttttatttgt aacctatata gtataggatt ttttttgtca ttttgtttct tctcgtacga





2161
gcttgctcct gatcagccta tctcgcagct gatgaatatc ttgtggtagg ggtttgggaa





2221
aatcattcga gtttgatgtt tttcttggta tttcccactc ctcttcagag tacagaagat





2231
taagtgagac cttcgtttgt gcagatccaa catccaaaga cgaaagcttg aatgaaacct





2341
ttttgccatc cgacatccac aggtccattc tcacacataa gtgccaaacg caacaggagg





2401
ggatacacta gcagcagacc gttgcaaacg caggacctcc actcctcttc tcctcaacac





2461
ccacttttgc catcgaaaaa ccagcccagt tattgggctt gattggagct cgctcattcc





2521
aattccttct attaggctac taacaccatg actttattag cctgtctatc ctggcccccc





2581
tggcgaggtt catgtttgtt tatttccgaa tgcaacaagc tccgcattac acccgaacat





2641
cactccagat gagggctttc tgagtgtggg gtcaaatagt ttcatgttcc ccaaatggcc





2701
caaaactgac agtttaaacg ctgtcttgga acctaatatg acaaaagcgt gatctcatcc





2761
aagatgaact aagtttggtt cgttgaaatg ctaacggcca gttggtcaaa aagaaacttc





2821
caaaagtcgg cataccgttt gtcttgtttg gtattgattg acgaatgctc aaaaataatc





2881
tcattaatgc ttagcgcagt ctctctatcg cttctgaacc ccggtgcacc tgtgccgaaa





2941
cgcaaatggg gaaacacccg ctttttggat gattatgcat tgtctccaca ttgtatgctt





3001
ccaagattct ggtgggaata ctgctgatag cctaacgttc atgatcaaaa tttaactgtt





3061
ctaaccccta cttgacagca atatataaac agaaggaagc tgccctgtct taaacctttt





3121
tttttatcat cattattagc ttactttcat aattgcgact ggttccaatt gacaagcttt





3181
tgattttaac gacttttaac gacaacttga gaagatcaaa aaacaactaa ttattcgaaa





3241
cgatgagatt tccttcaatt tttactgctg ttttattcgc agcatcctcc gcattagctg





3301
ctccagtcaa cactacaaca gaagatgaaa cggcacaaat tccggctgaa gctgtcatcg





3361
gttactcaga tttagaaggg gatttcgatg ttgctgtttt gccattttcc aacagcacaa





3421
ataacgggtt attgtttata aatactacta ttgccagcat tgctgctaaa gaagaagggg





3481
tatctctcga gaaaagagag gctgaagctg aattcgacat tgtgatgacc caggctgcac





3541
cctctgtacc tgtcactcct ggagagtcag tatccatctc ctgcaggtct agtaagagtc





3601
tcctgcatac taatggcaac acttacttgc attggttcct acagaggcca ggccagtctc





3661
ctcagctcct gatatatcgg atgtccgtcc ttgcctcagg agtcccagac aggttcagtg





3721
gcagtgggtc aggaactgct ttcacactga gcatcagtag agtggagget gaggatgtgg





3781
gtgtttttta ctgtatgcaa catctagaat atccgctcac gttcggtgct gggaccaagc





3841
tggaaccgaa acgggctcct cgagaaccac aggtgtacac cctggcccca tcccgggatg





3901
agcagggcat cgcgcaagtc agcctgacct gcctggtcaa aggcttctat cccagcgaaa





3961
tcgccgtgga gtgggagagc aacgggcagc cggagaacaa ctacaagacc acgcctcccg





4021
tgctggactc cgacggctct ttcttcctct acagcaagct taccgtgttg ggccgcaggt





4081
ggaccctggg gaacgtcttc tcatgctccg tgatgcatga ggctctgcac aaccactaca





4141
cgcagaagag cctctccctg tctccgggta aagggcgcgc ctccggatgc caaatttacc





4201
cgccaaacgc gaacaagatc agagaggctt tgcaatcttg caggaggccc aatgcgcaga





4261
gattcggcat atccaactac tgccagatct accccccata cgatgggcgt acaatcatac





4321
agcgtgataa cggctatcag cctaactacc acgccgtgaa catcgtcggc tacgagaatg





4381
tcgtggttac tgtgaaggta atgggcgatg acggggttct agcttgcgcc atagctacca





4441
agtacacttg gaacgtaccc aaaattgcgc cgaaaagtga aaacgtcgta gtgaccataa





4501
gggaggcatt ggctcaacct caaagatact gcagacacta ctggacgccc tgcataatcc





4561
accgtggtaa accctttcaa cttgaggcag tgttcgaagc taacaggacg gtaacgccaa





4621
ttcgtatgca aggtgggtgc gggtcttgtt gggctttttc tggtgtggct gctactgaat





4681
aaggcgcgcc tgaggtacct cgagccgcgg cggccgccag ctttctagaa caaaaactca





4741
tctcagaaga ggatctgaat agcgccgtcg accatcatca tcatcatcat tgagtttgta





4801
gccttagaca tgactgttcc tcagttcaag ttgggcactt acgagaagac cggtcttgct





4861
agattctaat caagaggatg tcagaatgcc atttgccctga gagatgcagg cttcatttt





4921
gatacttttt tatttgtaac ctatatagta taggattttt tttgtcattt tgtttcttct





4981
cgtacgagct tgctcctgat cagcctatct cgcagctgat gaatatcttg tggtaggggt





5041
ttgggaaaat cattcgagtt tgatgttttt cttggtattt cccactcctc ttcagagtac





5101
agaagattaa gtgagacctt cgtttgtgcg gatcccccac acaccatagc ttcaaaatgt





5161
ttctactcct tttttactct tccagatttt ctcggactcc gcgcatcgcc gtaccacttc





5221
aaaacaccca agcacagcat actaaatttt ccctctttct tcctctaggg tgtcgttaat





5281
tacccgtact aaaggtttgg aaaagaaaaa agagaccgcc tcgtttcttt ttcttcgtcg





5341
aaaaaggcaa taaaaatttt tatcacgttt ctttttcttg aaattttttt ttttagtttt





5401
tttctctttc agtgacctcc attgatattt aagttaataa acggtcttca atttctcaag





5461
tttcagtttc atttttcttg ttctattaca acttttttta cttcttgttc attagaaaga





5521
aagcatagca atctaatcta aggggcggtg ttgacaatta atcatcggca tagtatatcg





5581
gcatagtata atacgacaag gtgaggaact aaaccatggc caagttgacc agtgccgttc





5641
cggtgctcac cgcgcgcgac gtcgccggag cggtcgagtt ctggaccgac cggctcgggt





5701
tctcccggga cctcgtggag gacgacttcg ccggtgtggt ccgggacgac gtgaccctgt





5761
tcatcagcgc ggtccaggac caggtggtgc cggacaacac cctggcctgg gtgtgggtgc





5821
gcggcctgga cgagctgtac gccgagtggt cggaggtcgt gtccacgaac ttccgggacg





5881
cctccgggcc ggccatgacc gagatcggcg agcagccgtg ggggcgggag ttcgccctgc





5941
gcgacccggc cggcaactgc gtgcacttcg tggccgagga gcaggactga cacgtccgac





6001
ggcggcccac gggtcccagg cctcggagat ccgtccccct tttcctttgt cgatatcatg





6061
taattagtta tgtcacgctt acattcacgc cctcccccca catccgctct aaccgaaaag





6121
gaaggagtta gacaacctga agtctaggtc cctatttatt tttttatagt tatgttagta





6181
ttaagaacgt tatttatatt tcaaattttt cttttttttc tgtacagacg cgtgtacgca





6241
tgtaacatta tactgaaaac cttgcttgag aaggttttgg gacgctcgaa ggctttaatt





6301
tgcaagctgg agaccaacat gtgagcaaaa ggccagcaaa aggccaggaa ccgtaaaaag





6361
gccgcgttgc tggcgttttt ccataggctc cgcccccctg acgagcatca caaaaatcga





6421
cgctcaagtc agaggtggcg aaacccgaca ggactataaa gataccaggc gtttccccct





6481
ggaagctccc tcgtgcgctc tcctgttccg accctgccgc ttaccggata cctgtccgcc





6541
tttctccctt cgggaagcgt ggcgctttct caatgctcac gctgtaggta tctcagttcg





6601
gtgtaggtcg ttcgctccaa gctgggctgt gtgcacgaac cccccgttca gcccgaccgc





6661
tgcgccttat ccggtaacta tcgtcttgag tccaacccgg taagacacga cttatcgcca





6721
ctggcagcag ccactggtaa caggattagc agagcgaggt atgtaggcgg tgctacagag





6781
ttcttgaagt ggtggcctaa ctacggctac actagaagga cagtatttgg tatctgcgct





6841
ctgctgaagc cagttacctt cggaaaaaga gttggtagct cttgatccgg caaacaaacc





6901
accgctggta gcggtggttt ttttgtttgc aagcagcaga ttacgcgcag aaaaaaaaga





6961
tctcaagaag atcctttgat cttttctacg gggtctgacg ctcagtggaa cgaaaactca





7021
cgttaaggga ttttggtcat gagatc





//







All temperatures are in degrees Celsius. The following abbreviations are used:

  • CD32=FcγRII
  • TLR9=Toll like receptor 9
  • Der P1=Dermatophagoides pteronissyus major allergen 1
  • Der P2=Dermatophagoides pteronissyus major allergen 2
  • Der F1=Dermatophagoides farinae major allergen 1


REFERENCES



  • 1. Mudde, G. C., I. G. Reischl, N. Corvaïa, A. Hren, and E.-M. Pöllabauer. 1996. Antigen presentation in allergic sensitization. Immuno. Cell Biol. 74:167-173.

  • 2. Bheekha Escura, R., E. Wasserbauer, F. Hammerschmid, A. Pearce, P. Kidd, and G. C. Mudde. 1995. Regulation and targetting of T-cell immune responses by IgE and IgG antibodies. Immunology 86:343-350.

  • 3. Péne, J., F. Rousset, F. Briére, I. Chrétien, J.-Y. Bonnefoy, H. Spits, T. Yokota, K.-I. Arai, J. Banchereau, and J. E. De Vries. 1988. IgE production by normal human lymphocytes is induced by interleukin 4 and suppressed by intetferons gamma and alpha and prostaglandin E2. Proc. Natl. Acad. Sci. USA 85:6880-6884.

  • 4. Ebner, C. 1999. Immunological mechanisms operative in allergen-specific immunotherapy. Int Arch Allergy Immunol 119:1-5.

  • 5. Ferreira, F., C. Ebner. B. Kramer, G. Casari, P. Briza, A. J. Kungl, R. Grimm, B. Jahn-Schmid, H. Breiteneder, D, Kraft, M. Breitenbach, H. J. Rheinberger, and O. Scheiner. 1998. Modulation of IgE reactivity of allergens by site-directed mutagenesis: potential use of hypoallergenic variants for immunotherapy. FASEB Journal 12:231-242.

  • 6. Rissoan, M. C., V. Soumelis, N. Kadowaki, G. Grouard, F. Briere, R. D. Malefyt, and Y. J. Liu. 1999. Reciprocal control of T helper cell and dendritic cell differentiation. Science 283:1183-1186,

  • 7. Kapsenberg, M. L., C. M. Hilkens, E. A. Wierenga, and P. Kalinski. 1999. The paradigm of type 1 and type 2 antigen-presenting cells. Implications for atopic allergy. Clin. Exp. Allergy 29:33-36.

  • 8. Charbonnier, A. S., H. Hammad, P. Gosset, G. A. Stewart, S. Alkan, A. B. Tonnel, and J. Pestel. 2003. Der p1-pulsed myeloid and plasmacytoid dendritic cells from house dust mite-sensitized allergic patients dysregulate the T cell response. J. Leukocyte Biol. 73:91-99.

  • 9. Rothenfusser, S., E. Tuma, S. Endres, and G. Hartmann. 2002. Plasmacytoid dendritic cells: The key to CpG. Hum. Immunol. 63:1111-1119.

  • 10. Latz, E., A. Schoenemeyer, A. Visintin, K. A. Fitzgerald, B. G. Monks. C. F. Knetter, E. Lien, N. J. Nilsen, T. Espevik, and D. T. Golenbock. 2004. TLR9 signals after translocating from the ER to CpG DNA in the lysosome. Nat. Immunol. 5:190-198.

  • 11. Leifer, C. A., M. N. Kennedy, A. Mazzoni, C. W. Lee, M. J. Kruhlak, and D. A. Segal. 2004. TLR9 is localized in the endoplasmic reticulum prior to stimulation. J. Immunol. 173:1179-1183.

  • 12. Wang, W. W., D. Das, X. L. Tang, W. Budzynski, and M. R. Suresh. 2005. Antigen targeting to dendritic cells with bispecific antibodies. J. Immunol. Methods.

  • 13. van Schaijk, F. G., E. Oosterwijk, A. C. Soede, M. Broekema, C. Frielink, W. J. McBride, D. M. Goldenberg, F. H. Corstens, and O. C. Boerman. 2005. Pretargeting of carcinoembryonic antigen-expressing tumors with a biologically produced bispecific anticarcinoembryonic antigen×anti-indium-labeled diethylenetriaminepentaacetic acid antibody. Clin. Cancer Res. 11:7130s-7136s.

  • 14. Le, G. F., U. Reusch, G. Moldenhauer, M. Little, and S. M. Kipriyanov. 2004. Immunosuppressive properties of anti-CD3 single-chain Fv and diabody. J. Immunol. Methods 285:111-127.

  • 15. Schuster, M., P. Umana, C. Ferrara, P. Brunker, C. Gerdes, G. Waxenecker, S. Wiederkum, C. Schwager, H. Loibner, G. Himmler, and G. C. Mudde. 2005. Improved effector functions of a therapeutic monoclonal Lewis Y-specific antibody by glycoform engineering. Cancer Res 65:7934-7941.

  • 16. Orlandi, R., D. H. Gussow, P. T. Jones, and G. Winter. 1989. Cloning immunoglobulin variable domains for expression by the polymerase chain reaction. Proc. Natl. Acad. Sci. U.S.A 86:3833-3837.

  • 17. Barton, G. M., J. C. Kagan, and R. Medzhitov. 2005. Intracellular localization of Toll-like receptor 9 prevents recognition of self DNA but facilitates access to viral DNA. Nat. Immunol.

  • 18. Chen, W. L., J. L. Wang, H. Z. An, J. Zhou, L H. Zhang, and X. T. Cao. 2005. Heat shock up-regulates TLR9 expression in human B cells through activation of ERK and NF-kappaB signal pathways. Immunol. Lett. 98:153-159.

  • 19. Eaton-Bassiri, A., S. B. Dillon, M. Cunningham, M. A. Rycyzyn, J. Mills. R. T. Sarisky, and M. L. Mbow. 2004. Toll-like receptor 9 can be expressed at the cell surface of distinct populations of tonsils and human peripheral blood mononuclear cells. Infect. Immun. 72:7202-7211.

  • 20. Leroy, B. P., J.-M. Lachapelle, M. Jacquemin, and J.-M. Saint-Remy. 1992. Treatment of atopic dermatitis by allergen-antibody complexes: Long-term clinical results and evolution of IgE antibodies. Dermatologica 184:271-274.

  • 21. Chua, K. Y., W. K. Greene, P. Kehal, and W. R. Thomas. 1991. IgE binding studies with large peptides expressed from Der p II cDNA constructs. Clin. Exp. Allergy. 21:161-166.

  • 22. Baselmans, P. J., E. Pollabauer, F. C. Van Reijsen, H. C. Heystek. A. Hren, P. Stumptner, M. G. Tilanus, W. C. Vooijs, and G. C. Mudde. 2000. IgE production after antigen-specific and cognate activation of HLA-DPw4-restricted T-cell clones, by 78% of randomly selected B-cell donors. Hum. Immunol. 61:789-798.

  • 23. Beck, H., G. Schwarz, C. J. Schroter, M. Deeg, D. Baier, S. Stevanovic, E. Weber, C. Driessen, and H. Kalbacher. 2001. Cathepsin S and an asparagine-specific endoprotease dominate the proteolytic processing of human myelin basic protein in vitro. Eur J Immunol 31:3728-3736.

  • 24. Higgins, J. A., C. J. Thorpe, J. D. Hayball, R. E. O'Hehir, and J. R. Lamb. 1994. Overlapping T-cell epitopes in the group I allergen of Dermatophagoides species restricted by HLA-DP and HLA-DR class II molecules. J. Allergy Clin. Immunol. 93:891-899.

  • 25. Bian, H., J. F. Reidhaar-Ofson, and J. Hammer. 2003. The use of bioinformatics for identifying class II-restricted T-cell epitopes. Methods 29:299-309.

  • 26. Sturniolo, T., E. Bono, J. Ding. L. Raddrizzani. O. Tuereci, U. Sahin, M. Braxenthaler, F. Gallazzi, M. P. Protti, F. Sinigaglia, and J. Hammer. 1999. Generation of tissue-specific and promiscuous HLA ligand databases using DNA microarrays and virtual HLA class II matrices. Nat Biotechnol. 17:555-561.


Claims
  • 1. A molecule or molecule complex comprising a TLR9 binding region capable of binding to TLR9, a CD32 binding region capable of binding to CD32, and at least one epitope of at least one antigen.
  • 2. The molecule or molecule complex of claim 1, characterized in that the epitope is a T cell epitope.
  • 3. The molecule or molecule complex of claim 1, characterized in that the epitope is derived from an allergen.
  • 4. The molecule or molecule complex of claim 1, characterized in that at least one epitope is non-covalently linked to the molecule or molecule complex.
  • 5. The molecule or molecule complex of claim 1, characterized in that at least one epitope is non-covalently linked to the TLR9 binding region or the CD32 binding region.
  • 6. The molecule or molecule complex of claim 5, characterized in that at least one epitope is linked to the TLR9 binding region or the CD32 binding region via ligand interaction.
  • 7. (canceled)
  • 8. The molecule or molecule complex of claim 1, characterized in that the epitope is an epitope of an allergen selected from the group consisting of an allergen associated with atopic dermatitis, an allergen associated with allergic asthma, an allergen associated with allergic rhinitis or an allergen associated with allergic conjunctivitis.
  • 9. The molecule or molecule complex according to claim 1, characterized in that the epitope is isolated from a source selected from the group consisting of complete antigens, denatured antigens, and antigens modified to prevent binding to IgE.
  • 10. The molecule or molecule complex of claim 1, characterized in that it comprises at least one antibody.
  • 11. The molecule or molecule complex of claim 10, characterized in that the antibody is selected from the group consisting of IgG, IgM, IgE, IgA and IgD.
  • 12. The molecule or molecule complex of claim 1, characterized in that the antibody is selected from the group consisting of a human antibody and a humanized antibody.
  • 13. The molecule or molecule complex of claim 1, characterized in that at least part of the TLR9 binding region or the CD32 binding region is derived from a mammal selected from the group consisting of a human, a mouse, and a camel.
  • 14. (canceled)
  • 15. The molecule or molecule complex of claim 1, characterized in that it comprises at least one engineered binding scaffold.
  • 16. The molecule or molecule complex of claim 15, characterized in that the binding scaffold is selected from the group consisting of fibronectin III, lipocalins, Protein A, α-amylase inhibitor, Ankyrin Repeat Proteins, a C2 domain, an A-domain, an EGFR like domain, a dab, a chi-bAb, and CTLA-4.
  • 17. The molecule or molecule complex of claim 1, characterized in that it comprises a moiety selected from the group consisting of at least part of a small mutated immunoglobulin domain (SMID) and at least part of an anti-CD32 antibody.
  • 18-20. (canceled)
  • 21. A pharmaceutical composition comprising at least one molecule or molecule complex according to claim 1 and at least one pharmaceutically acceptable carrier or diluent.
  • 22. (canceled)
  • 23. A method of treating allergies comprising the step of administering a prophylactically or therapeutically effective amount of at least one molecule or molecule complex according to claim 1 to a subject in need of such treatment.
  • 24. (canceled)
  • 25. A process for producing a molecule or molecule complex according to claim 1, comprising one of the following series of steps: (1) providing a vector comprising nucleic acid sequences coding for the binding region of TLR9, the binding region of CD32 and the epitope; and recombinantly expressing the vector in a host cell; or(2) providing a TLR9 binding region capable of binding to TLR9, a CD32 binding region capable of binding to CD32, and at least one epitope of at least one antigen; and chemically cross linking the epitope to at least one of the TLR9 binding region or the CD32 binding region.
  • 26. The process of claim 25, wherein the vector comprises a nucleic acid having a nucleic acid sequence selected from the group consisting of SEQ ID No 60, SEQ ID No 62, SEQ ID No 63, and SEQ ID No 64.
  • 27-30. (canceled)
Priority Claims (1)
Number Date Country Kind
06110672.0 Mar 2006 EP regional
Continuations (1)
Number Date Country
Parent 12281504 Sep 2008 US
Child 15248258 US