Blocking reagent compositions and methods of making and using the same

Information

  • Patent Grant
  • 9758588
  • Patent Number
    9,758,588
  • Date Filed
    Monday, September 29, 2014
    11 years ago
  • Date Issued
    Tuesday, September 12, 2017
    8 years ago
Abstract
Blocking reagent compositions, as well as methods of making and using the same, are provided. Aspects of the composition include a blocking reagent that binds to the cell surface but does not specifically bind to a targeted first cell surface antigen. Also provided are system and kits that include the compositions.
Description
INTRODUCTION

Antibodies are commonly used to detect antigens on the surface of cells. Many antibodies (e.g., polyclonal antibodies) are “sticky” and bind non-specifically to multiple targets (which may be non-target cell surface antigens), generally creating undesirable background signal. Such background signal can, in turn, lead to alterations in the measurable concentration of an antigen of interest, producing substandard assay results.


Blocking reagents may be employed to at least inhibit non-specific binding (e.g., passive or covalent) of assay components to cell surfaces or solid assay surfaces. Blocking agents may also be employed to inhibit non-specific protein-protein interactions. Importantly, useful blocking agents lack cross reactivity with assay components, and therefore do not disrupt the bonds of the specific interactions that are to be evaluated in the assay.


Blocking reagents finding use in various assays include: detergents, e.g., polysorbate 20 (sold under the trademark TWEEN 20) and polyethylene glycol p-(1,1,3,3-tetramethylbutyl)-phenyl ether (sold under the trademark TRITON X-100); proteins, e.g., bovine serum albumin and whole sera; and polymer based blockers, e.g., polyethylene glycol, polyvinyl and polyvinyl alcohol.


SUMMARY

Blocking reagent compositions, as well as methods of making and using the same, e.g., in immunoassays to reduce background staining, are provided. Also provided are systems and kits that include the compositions.





BRIEF DESCRIPTION OF THE FIGURES


FIG. 1 provides a flow chart for one method for producing a blocking reagent according to one embodiment.



FIG. 2 provides a representative flow cytometry analysis of lysed human whole blood and populations of cells.



FIG. 3 depicts results from flow cytometry assays. (A-E) Titration of different amounts of a representative anti-human CD88 parental reference monoclonal antibody to the native CD88 antigen expressed on granulocytes; (F) Negative control: non-specific binding of secondary anti-rabbit phycoerythrin (PE) conjugated antibody on cells alone (primary antibody absent). (G) Negative control: background autofluorescence of unstained cells.



FIG. 4: Titration of a mutant recombinant mAb which lacks binding to CD88 (A-E). This particular antibody has a mutation (R116A) in the heavy chain binding region which removed binding specificity. (F) Negative control: non-specific binding of secondary anti rabbit phycoerythrin (PE) conjugated antibody on the granulocytes alone (primary antibody absent). (G) Negative control: background autofluorescence of unstained cells.



FIG. 5: Titration of a mutant recombinant mAb which has negligible binding to CD88 (A-E) This particular antibody has a mutation in the light chain binding region (Y51A) which removed binding specificity. (F) Negative control: non-specific binding of secondary anti rabbit PE-conjugated antibody on the granulocytes alone (primary antibody absent). (G) Negative control: background autofluorescence of unstained granulocytes.



FIG. 6: Titration of a mutant recombinant mAb which has removed binding to CD88 (A-E). This particular antibody has a mutation in both the heavy chain and light binding region which removed binding specificity (R116A in the heavy chain CDR and Y51A). (F) Negative control: non-specific binding of secondary anti rabbit PE-conjugated antibody on the granulocytes alone (primary antibody absent). (G) Negative control: background autofluorescence of unstained granulocytes.



FIG. 7: Titration of a mutant recombinant mAb which has removed binding to CD88 (A-E). This particular antibody is another double mutant that has mutation in both the heavy chain and light binding region which removed binding specificity (R116A in the heavy chain CDR and Y51F). (F) Negative control: non-specific binding of secondary anti rabbit PE-conjugated antibody on the cells alone (primary antibody absent). (G) Negative control: background autofluorescence by unstained cells.



FIG. 8: Confirmation that the mutant antibodies do not bind non-specifically to lymphocytes as a result of the mutational changes made to the antibody binding regions. Two fold serial dilutions of mutant mAbs that were titrated on lymphocytes (A-D) show the absence of non-specific binding to this population of cells.



FIG. 9: This figure depicts the nucleic acid sequence (SEQ ID NO:03) and the encoded amino acid sequence (SEQ ID NO:04) of the light chain of a representative monoclonal antibody. The amino acid sequence present within a CDR of the light chain of the anti-CD88 mAb (QSVYNNNLL) (SEQ ID NO:05; FIG. 9) is indicated, where amino acid residues were mutated to residues not typically found to be key in antibody antigen interactions. The boxed sequence indicates the position of amino acids that may be mutated to generate a blocking reagent; highlighted residue provides an example where a single substitution can be made.



FIG. 10: This figure depicts the nucleic acid sequence (SEQ ID NO:06) and the encoded amino acid sequence (SEQ ID NO:07) of the heavy chain of a representative monoclonal antibody. The amino acid sequence present within a CDR of the heavy chain of the anti-CD88 mAb (TYFCRIGSNI) (SEQ ID NO:08; FIG. 10) is indicated, where amino acid residues were mutated to residues not typically found to be key in antibody antigen interactions. The boxed sequence indicates the position of amino acids that may be mutated to generate a blocking reagent; highlighted residue provides an example where a single substitution can be made.



FIG. 11 shows an SDS-PAGE analysis and coomassie staining of the parental (reference) and mutant antibodies described above.





DETAILED DESCRIPTION

Blocking reagent compositions, as well as methods of making and using the same, are provided. Aspects of the compositions include a blocking reagent that binds to the cell surface but does not specifically bind to a targeted first cell surface antigen. Also provided are systems and kits that include the compositions.


Before the present invention is described in greater detail, it is to be understood that this invention is not limited to particular embodiments described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.


Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges and are also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.


Certain ranges are presented herein with numerical values being preceded by the term “about.” The term “about” is used herein to provide literal support for the exact number that it precedes, as well as a number that is near to or approximately the number that the term precedes. In determining whether a number is near to or approximately a specifically recited number, the near or approximating unrecited number may be a number which, in the context in which it is presented, provides the substantial equivalent of the specifically recited number.


Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention, representative illustrative methods and materials are now described.


All publications and patents cited in this specification are herein incorporated by reference as if each individual publication or patent were specifically and individually indicated to be incorporated by reference and are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed.


It is noted that, as used herein and in the appended claims, the singular forms “a”, “an”, and “the” include plural referents unless the context clearly dictates otherwise. It is further noted that the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as “solely,” “only” and the like in connection with the recitation of claim elements, or use of a “negative” limitation.


It is appreciated that certain features of the invention, which are, for clarity, described in the context of separate embodiments, may also be provided in combination in a single embodiment. Conversely, various features of the invention, which are, for brevity, described in the context of a single embodiment, may also be provided separately or in any suitable sub-combination. All combinations of the embodiments are specifically embraced by the present invention and are disclosed herein just as if each and every combination was individually and explicitly disclosed, to the extent that such combinations embrace operable processes and/or devices/systems/kits. In addition, all sub-combinations listed in the embodiments describing such variables are also specifically embraced by the present invention and are disclosed herein just as if each and every such sub-combination of chemical groups was individually and explicitly disclosed herein.


As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present invention. Any recited method can be carried out in the order of events recited or in any other order which is logically possible.


Blocking Compositions and Methods of Making the Same


Aspects of the disclosure include a blocking composition for use with a first specific binding member, e.g., which is known to provide background signal in addition to specific target signal, where the first specific binding member specifically binds to a first cell surface antigen (e.g., a target cell surface antigen for an immunoassay); and the blocking composition includes a blocking reagent. Blocking compositions may include one or more blocking reagents present in a suitable medium, e.g., an aqueous medium, such as described in greater detail below.


Blocking Reagent


As summarized above, blocking compositions of the invention include one or more blocking reagents. The blocking reagents present in the composition may be monoclonal or polyclonal, and in some instances are monoclonal. While a given blocking composition may include 2 or more distinct blocking agents of differing chemical formula, e.g., sequence, such as 3 or more, 4 or more, 5 or more, etc., in some instances a given composition includes a single type of blocking reagent.


As used herein, the term “blocking”, “to block” (e.g., as in the phrase “blocking reagent”) refers to preventing non-specific binding from occurring, to a target other than the intended target, when using a one or more (e.g., a cocktail) of antibodies and allowing the specific binding to occur. For example, many antibodies bind to non-target antigens (secondary antigens) (e.g., with lower affinity) in addition to the target antigen (the primary antigen) to which they specifically bind with high affinity. Some species of antibody and individual antibodies can have sticky binding characteristics and thus increase background signal. A subject “blocking reagent” is an antibody or binding fragment thereof to be used in conjunction with a specific binding member, where the specific binding member (e.g., an antibody) specifically binds an antigen of interest (a first cell surface antigen). A subject blocking reagent no longer binds to the surface of a cell but is free to bind through its other sticky natural properties and in the case of flow cytometry is unlabeled. This blocker can coat and hence block the cell from being able to be sticky with specific labeled antibody.


As used herein, the term “antigen” includes, but is not limited to, proteins (e.g., peptides), sugars, lipids, glycolipids, etc. An “antigen of interest”, “target antigen”, and “first cell surface antigen” are herein used interchangeably to refer to an antigen to be detected (e.g., using a first specific binding member).


The terms “specific binding,” “specifically binds,” and the like, refer to the preferential binding of a molecule (e.g., one binding pair member to the other binding pair member of the same binding pair) relative to other molecules or moieties in a solution or reaction mixture. The term “specific binding member” refers to a member of a specific binding pair. Exemplary specific binding members include, but are not limited to ligand/receptor; antibody/antigen; and the like. Specific binding members can be proteins (e.g., peptides, polypeptides, etc.), fusion proteins, antibodies, etc. In some embodiments, the affinity between a pair of specific binding members when they are specifically bound to each other in a binding complex is characterized by a KD (dissociation constant) of 10−5 M or less, 10−6 M or less, such as 10−7 M or less, including 10−8 M or less, e.g., 10−9 M or less, 10−10 M or less, 10−11 M or less, 10−12 M or less, 10−13 M or less, 10−14 M or less, 10−15 M or less, including 10−16 M or less. “Affinity” refers to the strength of binding, increased binding affinity being correlated with a lower Kd.


In some cases, the first specific binding member is an antibody (e.g., monoclonal antibody, polyclonal antibody, etc.) that specifically binds a cell surface antigen (e.g., a cell surface protein). The term “antibody” is used herein in the broadest sense and encompasses monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multi-specific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired biological activity. “Antibodies” (Abs) and “immunoglobulins” (Igs) are glycoproteins having the same structural characteristics. Antibodies include immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, namely, molecules that contain an antigen binding site. Immunoglobulin molecules can be of any type (for example, IgG, IgE, IgM, IgD, IgA and IgY), class (for example, IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass.


“Antibody fragment”, and all grammatical variants thereof, as used herein are defined as a portion of an intact antibody comprising the antigen binding site and/ror variable region of the intact antibody. Examples of antibody fragments include Fab, Fab′, Fab′-SH, F(ab′)2, and scFv fragments; diabodies; any antibody fragment that is a polypeptide having a primary structure consisting of one uninterrupted sequence of contiguous amino acid residues (referred to herein as a “single-chain antibody fragment” or “single chain polypeptide”), including without limitation (1) single-chain Fv (scFv) molecules; (2) single chain polypeptides containing only one light chain variable domain, or a fragment thereof that contains the three CDRs of the light chain variable domain, without an associated heavy chain moiety; (3) single chain polypeptides containing only one heavy chain variable region, or a fragment thereof containing the three CDRs of the heavy chain variable region, without an associated light chain moiety; (4) nanobodies comprising single Ig domains from non-human species or other specific single-domain binding modules; and (5) multi-specific or multivalent structures formed from antibody fragments. In an antibody fragment comprising one or more heavy chains, the heavy chain(s) can contain any constant domain sequence (e.g., CH1 in the IgG isotype) found in a non-Fc region of an intact antibody, and/or can contain any hinge region sequence found in an intact antibody.


As used herein, the term “epitope” or “epitopes” refers to sites or fragments of a polypeptide or protein having antigenic or immunogenic activity in a subject. An epitope having immunogenic activity is a site or fragment of a polypeptide or protein that elicits an antibody response in an animal. An epitope having antigenic activity is a site or fragment of a polypeptide or protein to which an antibody (e.g, via the antigen binding site) specifically binds. Epitopic determinants can consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.


Suitable antibodies can be generated by any animal (e.g., a bird (e.g., duck, chicken, goose, etc.); a shark; a fish (e.g., zebrafish); a mammal (e.g., a non-primate, e.g., cow, pig, camel, llama, horse, goat, rabbit, sheep, hamster, guinea pig, pig, cat, dog, rat, mouse, etc.; a non-human primate, e.g., monkey, cynomolgus monkey, chimpanzee, etc; a human; etc.), and the like. Similarly suitable blocking reagents with specific binding removed, can be made as blockers for each species.


Antibodies can be humanized. The term “humanized” antibody refers to an immunoglobulin variant or fragment thereof, which is capable of binding to an antigen and which comprises framework regions having substantially the amino acid sequence of a human immunoglobulin and CDRs having substantially the amino acid sequence of a non-human antibody. A humanized antibody can be fully or partially humanized.


Reference Antibody


Blocking reagents of interest include antibodies or binding fragments thereof that are variants of a reference antibody. Thus, in some instances a blocking reagent is an antibody or binding fragment thereof that includes at least one mutation (e.g., deletion, insertion, substitution, etc.) in at least one of: a heavy chain complementary determining (“CDR”) region (for example, the heavy chain CDR 1, heavy chain CDR 2, and/or heavy chain CDR 3); and a light chain CDR region (for example, the light chain CDR 1, light chain CDR 2, and/or light chain CDR 3) when compared to the amino acid sequence of the reference antibody. Moreover, a subject blocking reagent may also contain one or more other mutations (e.g., deletion, insertion, substitution, etc.) in a part or portion other than a CDR region (e.g., in a framework region). Methods for creating such derivatives (i.e., variants of a reference antibody) include the use of site-directed mutagenesis and PCR-mediated mutagenesis, or gene construction from a suitable commercial supplier (e.g., GenArt), which will be discussed in more detail below.


The reference antibody specifically binds a second cell surface antigen (an antigen other than the antigen of interest) and the blocking reagent binds with reduced affinity to the second cell surface antigen (reduced relative to the affinity with which the reference antibody binds the second cell surface antigen), and in some instances does not specifically bind to the second cell surface antigen.


Therefore, in some embodiments, at least one CDR of a subject blocking reagent is a variant of the corresponding CDR of a reference antibody, where the reference antibody specifically binds to a second cell surface antigen (i.e., the reference antibody binds to a different cell surface antigen than is specifically bound by first the specific binding member). In some cases, a subject blocking reagent does not specifically bind to the second cell surface antigen (the antigen bound by the reference antibody). In some cases, a subject blocking reagent binds to the second cell surface antigen (the antigen bound by the reference antibody), but binds to the second cell surface antigen with reduced affinity compared to the affinity with which the reference antibody binds to the second cell surface antigen.


In some cases, at least one CDR of the blocking reagent has an amino acid sequence that is 60% or more identical (e.g., 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, or 100% identical) to the corresponding CDR amino acid sequence of the reference antibody.


In some cases, the first, second, and third heavy chain CDRs, and the first, second, and third light chain CDRs of the blocking reagent each has an amino acid sequence that is 60% or more identical (e.g., 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, etc.) to the corresponding CDR amino acid sequence of the reference antibody.


In some cases, at least one CDR of the blocking reagent has an amino acid sequence that includes 10 or fewer, such as 9 or fewer, 8 or fewer, 7 or fewer 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer amino acid changes, where there may be just a single amino acid change, as compared to the corresponding CDR amino acid sequence of the reference antibody. In some cases, the first, second, and third heavy chain CDRs, and the first, second, and third light chain CDRs of the blocking reagent each has an amino acid sequence having an amino acid sequence that includes 10 or fewer, such as 9 or fewer, 8 or fewer, 7 or fewer 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer amino acid changes, where there may be just a single amino acid change, compared to the corresponding CDR amino acid sequence of the reference antibody. However, in all cases, a subject blocking reagent has at least 1 amino acid change (deletion, insertion, substitution) in at least one CDR amino acid sequence compared to the corresponding CDR amino acid sequence of the reference antibody. For example, the amino acid change in at least one CDR can be the substitution of 10 or fewer amino acids provided in a region of at least one heavy chain CDR corresponding to SEQ ID NO:7 shown in FIG. 10. SEQ ID NO:07 is the heavy chain from a reference rabbit anti-human CD88 antibody: MACPGFLWAL VISTCLEFSM AQSVKESEGG LFKPADTLTL TCTVSGFSVN NKGVMWVRQA PGNGLEWIGS IGISGRVTYA TWAKSRSTIT RDTNLNTVTL KVTSLTVADT ATYFCRIGSN IWGPGTLVTV SSGQPKAPSV FPLAPCCGDT PSSTVTLGCL VRGYLPEPVT VTWNSGTLTN GVRTFPSVRQ SSGLYSLSSV VSVTSSSQPV TCNVAHPATN TKVDKTVAPS TCSKPTCPPP ELLGGPSVFI FPPRPKDTLM ISRTPEVTCV WDVSQDDPE VQFTWYINNE QVRTARPPLR EQQFNSTIRV VSTLPIAHQD WLRGKEFKCK VHNKALPAPI EKTISKARGQ PLEPKVYTMG PPREELSSRS VSLTCMINGF YPSDISVEWE KNGKAEDNYK TTPAVLDSDG SYFLYSKLSV PTSEWQRGDV FTCSVMHEAL HNHYTQKSIS RSPGK (SEQ ID NO:7). The 7 or fewer amino acids can be encompassed in a region within SEQ ID NO:7 e.g., TYFCRIGSNI (SEQ ID NO: 08). The boxed sequence is within CDR-H3


In another example, the amino acid change in at least one CDR can be the substitution of 7 or fewer amino acids provided in a region of at least one light chain CDR corresponding to SEQ ID NO:4 shown in FIG. 9. SEQ ID NO:04 is the light chain from a reference rabbit anti-human CD88 antibody: MACPGFLWALVISTCLEFSM AELVLTQTPSSVSAAVGGTVTINCQSSQSV YNNNLLAWYQQKPGQPPKLLIYQASTLDSG VPSRFKGSGT GTHFTLTISD LECDDAATYY CQGGYNGNGIAAFGGGTEVVVDGDPVAPTVLIFPPSADLV ATGTVTIVCVANKYFPDVTVTWEVDGTTQTTGIENSKTPQNSADCTYNLS STLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC (SEQ ID NO:04). The 7 or fewer amino acids can be encompassed in a region within SEQ ID NO:04 e.g., QSVYNNNLL (SEQ ID NO: 05). The boxed sequence is within CDR-L1.


In yet another example, at least one amino acid change in at least one CDR can be a substitution of 7 or fewer amino acids provided in at least one heavy chain CDR corresponding to SEQ ID NO:07 shown in FIG. 10, in combination with the substitution of 7 or fewer amino acids provided in a region of at least one light chain CDR corresponding to SEQ ID NO:04 shown in FIG. 9. In some cases, the combination of at least one substitution in at least one CDR heavy chain and at least one CDR light chain can be made in SEQ ID NO:08 and SEQ ID NO:05, respectively. The effect of at least one amino acid substitution in one or both heavy and light CDRs of a representative blocking reagent are illustrated in FIGS. 4-8. In some cases, the amino acid changes within CDR regions can be combined with amino acid changes outside of the CDR domains.


In some cases, a single amino acid substitution is made in the heavy chain CDR. In other cases, a single amino acid substitution is made in the light chain CDR. In yet other cases, a single amino acid substitution is made in the heavy chain CDR in combination with a single amino acid substitution that is made in the light chain CDR. For example, an amino acid corresponding to R116 of the heavy chain CDR (FIG. 10) can be made alone or in combination with an amino acid substitution of an amino acid corresponding to Y51 of the light chain CDR (FIG. 9). An example of a blocking reagent is a rabbit anti human CD88 antibody comprising a heavy chain CDR having at least one amino acid substitution. Alternatively, the rabbit anti human CD88 antibody blocking reagent comprises a light chain CDR having at least one amino acid substitution. In some cases, the recombinant rabbit anti human CD88 antibody blocking reagent comprises at least one amino acid substitution in at least one light chain CDR and at least one amino acid substitution in at least one heavy chain CDR. The at least one amino acid substitutions can be made for example, within the amino acid sequence of SEQ ID NO:5 of the light chain CDR, and/or the amino acid sequence of SEQ ID NO:8 of the heavy chain CDR. In some cases, the rabbit anti human CD88 antibody blocking reagent comprises the amino acid substitution R116A in the heavy chain CDR shown in FIG. 10. In other cases, the rabbit anti human CD88 antibody comprises the amino acid substitution Y51A in the light chain CDR shown in FIG. 9. Alternatively, the substitution of the Y51 is made to Y51F. In other cases, the rabbit anti human CD88 antibody blocking reagent comprises the R116A substitution in the CDR of the heavy chain and the Y51A or Y51F substitution in the light chain CDR. The rabbit anti human CD88 antibody blocking reagent can further comprise one or more mutations e.g. amino acid substitutions that lie outside of the CDR domains.


In some cases, the non-CDR regions of one of the heavy and light chains of the blocking reagent has an amino acid sequence that is 75% or more identical to the non-CDR regions of the corresponding chain of the reference antibody (e.g., 80% or more identical, 85% or more identical, 90% or more identical, 95% or more identical, 98% or more identical, 99% or more identical, 99.5% or more identical, or 100% identical).


In some cases, the blocking reagent has an amino acid sequence that is 75% or more identical to the non-CDR regions of the corresponding heavy and light chains of the reference antibody (e.g., 80% or more identical, 85% or more identical, 90% or more identical, 95% or more identical, 98% or more identical, 99% or more identical, 99.5% or more identical, or 100% identical). The terms “identical” or percent “identity,” in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides (or amino acid residues) that are the same, when compared and aligned for maximum correspondence over a comparison window, as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection.


For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithms test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated or default program parameters. A “comparison window”, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 25 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Natl. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Ausubel et al., supra).


One example of a useful algorithm is PILEUP. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments to show relationship and percent sequence identity. It also plots a tree or dendrogram showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng & Doolittle, J. Mol. Evol. 35:351-360 (1987). The method used is similar to the method described by Higgins & Sharp, CABIOS 5:151-153 (1989). The program can align up to 300 sequences, each of a maximum length of 5,000 nucleotides or amino acids. The multiple alignment procedure begins with the pairwise alignment of the two most similar sequences, producing a cluster of two aligned sequences. This cluster is then aligned to the next most related sequence or cluster of aligned sequences. Two clusters of sequences are aligned by a simple extension of the pairwise alignment of two individual sequences. The final alignment is achieved by a series of progressive, pairwise alignments. The program is run by designating specific sequences and their amino acid or nucleotide coordinates for regions of sequence comparison and by designating the program parameters. Using PILEUP, a reference sequence (e.g., a TERT promoter sequence of the invention as set forth by. e.g., SEQ ID NO: 1 or SEQ ID NO: 2) is compared to another sequence to determine the percent sequence identity relationship (i.e., that the second sequence is substantially identical and within the scope of the invention) using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps. PILEUP can be obtained from the GCG sequence analysis software package, e.g., version 7.0 (Devereaux (1984) Nuc. Acids Res. 12:387-395).


Another example of algorithm that is suitable for determining percent sequence identity (i.e., substantial similarity or identity) is the BLAST algorithm, which is described in Altschul (1990) J. Mol. Biol. 215:403-410. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/). This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul (1990) supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues, always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. In one embodiment, to determine if a nucleic acid sequence is within the scope of the invention, the BLASTN program (for nucleotide sequences) is used incorporating as defaults a wordlength (W) of 11, an expectation (E) of 10, M=5, N=4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as default parameters a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see, e.g., Henikoff (1989) Proc. Natl. Acad. Sci. USA 89:10915).


The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin (1993) Proc. Nat'l. Acad. Sci. USA 90:5873-5787). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.


Anti-CD88 Antibody


In some cases, the second cell surface antigen (that cell surface antigen to which the reference antibody specifically binds) is CD88. CD88 is a cell surface protein also known as “complement component 5a receptor 1” (C5AR1). Human CD88 has an amino acids sequence:









(SEQ ID NO: 01)


MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVV





FLVGVLGNALVVWVTAFEAKRTINAIWFLNLAVADFLSCLALPILFT





SIVQHHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFKP





IWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLC





GVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRAT





RSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLNKLD





SLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVV





RESKSFTRSTVDTMAQKTQAV.






The human DNA nucleotide sequence for an mRNA that encodes the CD88 protein is (the open reading frame is underlined):










(SEQ ID NO: 02)



CTTGGGCAGGAGGGACCTTCGATCCTCGGGGAGCCCAGGAGACCAGAACATG







AACTCCTTCAATTATACCACCCCTGATTATGGGCACTATGATGACAAGGATACC







CTGGACCTCAACACCCCTGTGGATAAAACTTCTAACACGCTGCGTGTTCCAGAC







ATCCTGGCCTTGGTCATCTTTGCAGTCGTCTTCCTGGTGGGAGTGCTGGGCAA







TGCCCTGGTGGTCTGGGTGACGGCATTCGAGGCCAAGCGGACCATCAATGCC







ATCTGGTTCCTCAACTTGGCGGTAGCCGACTTCCTCTCCTGCCTGGCGCTGCC







CATCTTGTTCACGTCCATTGTACAGCATCACCACTGGCCCTTTGGCGGGGCCG







CCTGCAGCATCCTGCCCTCCCTCATCCTGCTCAACATGTACGCCAGCATCCTG







CTCCTGGCCACCATCAGCGCCGACCGCTTTCTGCTGGTGTTTAAACCCATCTG







GTGCCAGAACTTCCGAGGGGCCGGCTTGGCCTGGATCGCCTGTGCCGTGGCT







TGGGGTTTAGCCCTGCTGCTGACCATACCCTCCTTCCTGTACCGGGTGGTCCG







GGAGGAGTACTTTCCACCAAAGGTGTTGTGTGGCGTGGACTACAGCCACGACA







AACGGCGGGAGCGAGCCGTGGCCATCGTCCGGCTGGTCCTGGGCTTCCTGTG







GCCTCTACTCACGCTCACGATTTGTTACACTTTCATCCTGCTCCGGACGTGGAG







CCGCAGGGCCACGCGGTCCACCAAGACACTCAAGGTGGTGGTGGCAGTGGTG







GCCAGTTTCTTTATCTTCTGGTTGCCCTACCAGGTGACGGGGATAATGATGTCC







TTCCTGGAGCCATCGTCACCCACCTTCCTGCTGCTGAATAAGCTGGACTCCCT







GTGTGTCTCCTTTGCCTACATCAACTGCTGCATCAACCCCATCATCTACGTGGT







GGCCGGCCAGGGCTTCCAGGGCCGACTGCGGAAATCCCTCCCCAGCCTCCTC







CGGAACGTGTTGACTGAAGAGTCCGTGGTTAGGGAGAGCAAGTCATTCACGCG







CTCCACAGTGGACACTATGGCCCAGAAGACCCAGGCAGTGTAGGCGACAGCC






TCATGGGCCACTGTGGCCCGATGTCCCCTTCCTTCCCGGCCATTCTCCCTCTT





GTTTTCACTTCACTTTTCGTGGGATGGTGTTACCTTAGCTAACTAACTCTCCTCC





ATGTTGCCTGTCTTTCCCAGACTTGTCCCTCCTTTTCCAGCGGGACTCTTCTCA





TCCTTCCTCATTTGCAAGGTGAACACTTCCTTCTAGGGAGCACCCTCCCACCCC





CCACCCCCCCCACACACACCATCTTTCCATCCCAGGCTTTTGAAAAACAAACAG





AAACCCGTGTATCTGGGATATTTCCATATGGCAATAGGTGTGAACAGGGAACTC





AGAATACAGACAAGTAGAAAGATTCTCGCTTAAAAAAAATGTATTTATTTTATGG





CAAGTTGGAAAATATGTAACTGGAATCTCAAAAGTTCTTTGGGACAAAACAGAA





GTCCATGGAGTTATCTAAGCTCTTGTAAGTGAGTTAATTTAAAAAAGAAAATTAG





GCTGAGAGCAGTGGCTCACGCCTGTAATCCCAGAACTTTGGGAGGCTAAGGTG





GGTGGATCACCTGAGGTCAAGAGTTCCAGACCAGGCTGGCCAGCATGGTGAA





ACCCCGTCTGTACTAAAAATACAAAAAATTAACTGGGCATGGTAGTGGGTGCCT





GTAATCCCAGCTACTTGGGAGGCTGAGGTGGGAGAATTGCTCGAACTTGGAGG





TGGAGGTTGTGGTGAGCCATGATCGCACCACTGCACTCTAGCCTGGGTGACCG





AGGGAGGCTCTGTCTCAAAAGCAAAGCAAAAACAAAAACAAAAACACCTAAAAA





ACCTGCAGTTTTGTTTGTACTTTGTTTTTAAATTATGCTTTCTATTTTGAGATCAT





TGCAAACTCAACACAATTGTAAGTAATGATACAGAGGGATCTTGTGTACCCTTC





ACCCAGCCTCCCCCAATGGCAACATCTTGCAAAACTACAATGTAGTCTCATAAC





CAGGATATTGACATTGATACAGTGAAGATACAGGACATTCTCATCACCACAGGG





ATCCCCAGGATGCCCACTTCCCTCCACCCCCACACCCCAGCCGTGTCCCTAAC





CCCTGGCAACCAGGAATCCACTCTCCATTTCTATAATGTTGTCATTTCAAGAATG





TTATTCAATGGAATCATATAGTATGTAACCTGTTTTGAGCTTAAAAAAAAAGTATACAT





GACTTTAATGAGGAAAATAAAAATGAATATTGAAATGTT.






In some embodiments, a first cell surface antigen and/or a second cell surface antigen is CD88. As such, in some cases, a specific binding member (e.g., a first specific biding member, a reference antibody, etc.) specifically binds to CD88. In other words, in some cases, a specific binding member specifically binds to at least a portion (i.e., a fragment, an epitope) of CD88.


In some cases, the reference antibody specifically binds CD88; and has the light and heavy chain amino acid sequences that can be readily determined from the amino acid sequence provided in FIGS. 8 and 9.


In some embodiments, the first heavy chain CDR of the blocking reagent can have an amino acid sequence that is 60% or more identical (e.g., 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, but less than 100% identical) to a reference sequence. In some embodiments, the second heavy chain CDR of the blocking reagent can have an amino acid sequence that is 60% or more identical (e.g., 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, but less than 100% identical) to a reference sequence. In some embodiments, the third heavy chain CDR of the blocking reagent can have an amino acid sequence that is 60% or more identical (e.g., 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, but less than 100% identical) to a reference sequence.


In some embodiments, the first light chain CDR of the blocking reagent can have an amino acid sequence that is 60% or more identical (e.g., 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, but less than 100% identical) to a reference sequence. In some embodiments, the second light chain CDR of the blocking reagent can have an amino acid sequence that is 60% or more identical (e.g., 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, but less than 100% identical) to a reference sequence. In some embodiments, the third light chain CDR of the blocking reagent can have an amino acid sequence that is 60% or more identical (e.g., 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, but less than 100% identical) to a reference sequence.


Examples of specific heavy and light chain sequences of interest are provided in FIGS. 10 and 9 (SEQ ID NOs:07 & 04, respectively).


Binding and Affinity


As mentioned above, a subject blocking reagent may be a variant of a reference antibody. In some cases, the reference antibody specifically binds the first cell surface antigen. In some cases, the reference antibody specifically binds to a second cell surface antigen (i.e., a different antigen than the antigen of interest), and the blocking reagent binds with reduced affinity to the second cell surface antigen (reduced affinity relative to the affinity of the reference antibody for the second cell surface antigen), where in some instances the blocking reagent does not specifically bind to the second cell surface antigen.


In some cases, binding affinity can be relative binding affinity. For example, in some cases a blocking reagent binds a cell surface antigen with reduced affinity relative to the affinity with which a reference antibody binds the cell surface antigen. Relative affinity (e.g., the affinity of a blocking reagent for an antigen compared to the affinity of a specific binding member (e.g., an antibody) for the antigen) can be measured using any convenient immune assay (e.g., flow cytometry, radioimmunoassays, enzyme-linked immunosorbent assays (ELISA), Western Blot, assays based on surface plasmon resonance (SPR), Kinetic Exclusion Assay (KinExA), biolayer interferometry (e.g., Octet QKe), and the like). Relative binding can be determined without necessitating the measurement of affinity values.


In some cases, affinity can be measured to obtain a measured value for binding affinity using any convenient assay. For example, binding affinity can be measured using by assays (e.g., label free assays) based on surface plasmon resonance (SPR) (e.g., BIACORE SPR), Kinetic Exclusion Assay (KinExA), biolayer interferometry (e.g., Octet QKe), and the like. Association and dissociation rate constants can also be measured using such assays.


In some embodiments, the affinity of a subject blocking reagent for a cell surface antigen is reduced by 10% or more relative to the affinity of a specific binding member (e.g., a first specific binding member and/or a reference antibody) for the cell surface antigen (e.g., 15% or more, 20% or more, 25% or more, 30% or more, 35% or more, 40% or more, 35% or more, 50% or more, 55% or more, 60% or more, 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, or 98% or more). In other words, in some embodiments, the affinity a subject blocking reagent for a cell surface antigen is 90% or less the affinity of a specific binding member (e.g., a first specific binding member and/or a reference antibody) for the cell surface antigen (e.g., 85% or less, 80% or less, 75% or less, 70% or less, 65% or less, 60% or less, 55% or less, 50% or less, 45% or less, 40% or less, 35% or less, 30% or less, 25% or less, 20% or less, 15% or less, 10% or less, 5% or less, or 2% or less).


As mentioned above, a subject blocking reagent is a variant of a reference antibody, where the reference antibody specifically binds a second cell surface antigen (a cell surface antigen that is different than the target antigen, i.e., different than the antigen specifically bound by the first specific binding member). In some cases, a subject blocking reagent binds to the surface of a cell but: (i) does not specifically bind the second cell surface antigen; or (ii) binds the second cell surface antigen with reduced affinity (reduced affinity compared to the affinity with which the reference antibody binds the second cell surface antigen). In some cases, the binding affinity of the blocking reagent for the second cell surface antigen is 10% or more reduced (e.g., 15% or more, 20% or more, 25% or more, 30% or more, 35% or more, 40% or more, 45% or more, 50% or more, 55% or more, 60% or more, 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, or 98% or more) compared to the affinity with which the reference antibody binds the second cell surface antigen.


As mentioned above, in some cases, a subject blocking reagent is a variant of an anti-CD88 antibody (a reference antibody that specifically binds CD88). In some cases, a subject blocking reagent does not specifically bind to CD88. In some cases, a subject blocking reagent binds to CD88 with a reduced affinity compared to the affinity with which a reference antibody (e.g., an anti-CD88 antibody) binds to CD88. In some cases, the binding affinity of the blocking reagent for CD88 is 10% or more reduced (e.g., 15% or more, 20% or more, 25% or more, 30% or more, 35% or more, 40% or more, 45% or more, 50% or more, 55% or more, 60% or more, 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, or 98% or more) compared to the binding affinity of a reference antibody (e.g., an anti-CD88 antibody) for CD88.


In some embodiments, a subject blocking reagent does not specifically bind to a specified cell surface antigen (e.g., a cell surface antigen that is specifically bound by a first specific biding member, a cell surface antigen that is specifically bound by a reference antibody, etc.). In some embodiments, a subject blocking reagent does not detectably bind to a specified cell surface antigen (e.g., a cell surface antigen that is specifically bound by a first specific biding member, a cell surface antigen that is specifically bound by a reference antibody, etc.).


Blocking compositions may include a blocking reagent, e.g., as described above, present in a suitable medium, such as a liquid medium, e.g., an aqueous medium. Where the blocking composition is a liquid, the concentration of the blocking reagent in the liquid medium may vary. Blocking composition may include only the blocking reagent and a solvent, e.g., water, or may include one or more additional components, e.g., buffering agents, preservatives, etc., as desired.


Methods for Preparing a Blocking Reagent


A blocking reagent as described herein can be prepared by recombinant expression of light and heavy chain genes in a host cell. To express a blocking reagent, a host cell is transfected with one or more recombinant expression vectors having nucleic acid sequences encoding the light and heavy chain variable regions of the blocking reagent such that at least the light and heavy chain variable regions are expressed in the host cell (e.g., any convenient cell that can be used to secret antibodies into the culture medium) and secreted into the medium. The blocking reagent can be recovered from the culture medium. Standard recombinant nucleic acid (DNA) methodologies can be used to obtain nucleic acids having sequences encoding the heavy and light chain variable regions, incorporate these nucleic acids into recombinant expressions vectors, and introduce the vectors into host cells (e.g., CHO cells, NSO myeloma cells, COS cells, HEK-293 cells, SP2 cells, E. coli, and the like), such as those described in Sambrook, Fritsch and Maniatis (eds), Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, New Your, (1989), Ausubel, F. M. et al. (eds.) Current Protocols in Molecular Biology, Greene Publishing Associates (1989) and in U.S. Pat. No. 4,816,397 by Boss et al.


Nucleic Acids and Genetically Modified Cells


Aspects of the disclosure include nucleic acids encoding a subject blocking reagent. A subject nucleic acid includes a first nucleotide sequence that encodes at least one of: (i) a heavy chain variable region comprising 3 heavy chain complementarity determining regions (CDRs) of a blocking reagent; and (ii) a light chain variable region comprising 3 light chain complementarity determining regions (CDRs) of a blocking reagent. In some cases, the nucleic acid is an expression vector in which the nucleotide sequence encoding the blocking reagent is operably linked to a promoter.


Aspects of the disclosure also include genetically modified cells. In some cases, the genetically modified cell has an expression vector having a nucleotide sequence that encodes the heavy chain variable region of a subject blocking reagent. In some cases, the genetically modified cell has an expression vector having a nucleotide sequence that encodes the light chain variable region of a subject blocking reagent. In some cases, the genetically modified cell has two expression vectors, one encoding the heavy chain variable region of a subject blocking reagent, and the other encoding the light chain variable region of the blocking reagent. In some cases, the genetically modified cell has an expression vector having both (i) a nucleotide sequence that encodes the heavy chain variable region of a subject blocking reagent, and (ii) a nucleotide sequence that encodes the heavy chain variable region of the blocking reagent.


A cell has been “genetically modified” or “transformed” or “transfected” by exogenous DNA, e.g. a recombinant expression vector, when such DNA has been introduced inside the cell. The presence of the exogenous DNA results in permanent or transient genetic change. The transforming DNA may or may not be integrated (covalently linked) into the genome of the cell. The transforming DNA may be maintained on an episomal element such as a plasmid. A stably transformed cell is one in which the transforming DNA has become integrated into a chromosome so that it is inherited by daughter cells through chromosome replication. This stability is demonstrated by the ability of the eukaryotic cell to establish cell lines or clones that comprise a population of daughter cells containing the transforming DNA.


Suitable methods of genetic modification (also referred to as “transformation”) include e.g., viral infection, transfection, lipofection, electroporation, calcium phosphate precipitation, polyethyleneimine (PEI)-mediated transfection, DEAE-dextran mediated transfection, liposome-mediated transfection, particle gun technology, calcium phosphate precipitation, direct micro injection, nanoparticle-mediated nucleic acid delivery (see, e.g., Panyam et., al Adv Drug Deliv Rev. 2012 Sep. 13. pii: 50169-409X(12)00283-9. doi: 10.1016/j.addr.2012.09.023), and the like. The choice of method of genetic modification is generally dependent on the type of cell being transformed and the circumstances under which the transformation is taking place (e.g., in vitro, ex vivo, or in vivo).


Methods of Synthesizing Blocking Reagents from a Reference Antibody


Aspects of the disclosure include methods of producing a cell surface blocking reagent. Aspects of embodiments of the methods include: (a) generating a variant of a reference antibody, (b) assaying the variant antibody to determine whether the variant antibody binds to the cell surface antigen with reduced affinity relative to the affinity with which the reference antibody binds to the cell surface antigen, and (c) determining that the variant antibody is a cell surface blocking reagent when the variant antibody binds to the cell surface antigen with reduced affinity relative to the affinity with which the reference antibody binds to the cell surface antigen.


The step of generating a variant of a reference antibody generally includes introducing at least one mutation in the nucleotide sequence encoding at least one CDR of the reference antibody. Any convenient method can be used to introduce mutations (such as deletions, additions, and/or substitutions) in the nucleic acid molecule encoding a reference antibody, including, for example, site-directed mutagenesis and PCR-mediated mutagenesis. In one aspect, the derivatives include 10 or less amino acid substitutions, 9 or less amino acid substitutions, 8 or less amino acid substitutions, 7 or less amino acid substitutions, 6 or less amino acid substitutions, 5 or less amino acid substitutions, 4 or less amino acid substitutions, 3 or less amino acid substitutions, 2 or less amino acid substitutions, or 1 amino acid substitution relative to the reference antibody. Another method is to generate the whole gene de novo via gene synthesis in its nearly identical but mutated form and put it into a suitable expression vector. Protein expression can be carried out by any suitable means, e.g., mammalian cell expression, E. coli, Baculovirus Plant expression etc., such as described in greater detail above.


Mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened. Following mutagenesis, the encoded variant antibodies can be expressed and the binding affinity (e.g., relative or absolute) of the variant antibodies for the cell surface antigen can be measured and compared to the binding affinity of the reference antibody for the cell surface antigen.


The step of assaying the affinity of the variant antibody for the cell surface antigen, with respect to measuring affinity (e.g., relative affinity), can include measuring the affinity to obtain an affinity value (e.g., using label free assays based on surface plasmon resonance (SPR) (e.g., BIACORE SPR), kinetic exclusion assay (KinExA), biolayer interferometry (e.g., Octet QKe), and the like), and/or measuring a relative affinity (e.g., using any convenient immunoassay method, e.g., ELISA, flow cytometry, Western blot, etc.).


In some embodiments, the method further includes determining the amino acid sequence of at least one CDR of the variant antibody. In some cases, a nucleic acid encoding the variant antibody (one, for example, that has been shown to have a reduced affinity for the antigen), or at least the portion of the nucleic acid encoding the at least one CDR, is sequenced.


Methods of Using Blocking Compositions


Aspects of the disclosure include methods of using blocking compositions, e.g., as described above, such as methods of labeling a cell. In some embodiments, the methods include contacting a cell with (i) a first specific binding member that specifically binds to a first cell surface antigen, and (ii) a blocking composition including a blocking reagent that no longer binds to the surface of a cell via the first cell surface antigen. The methods may further include detecting the presence or absence of the first antibody on the cell. In some embodiments, the blocking reagent binds to the first cell surface antigen with a reduced affinity or no measurable affinity compared to the affinity with which the first specific binding member binds to the first cell surface antigen, e.g., as described above.


As mentioned above, a blocking reagent (e.g. unlabeled) binds to secondary antigens (e.g., “sticky” antigens) in order to block a first specific binding member from binding the secondary antigens, thereby reducing background signal measured when detecting the first specific binding member. In some instances, the first specific binding member includes a label moiety. A “label moiety” is any moiety that provides for signal detection and may vary widely depending on the particular nature of the assay. Label moieties of interest include both directly (e.g., a fluorescent label) and indirectly (e.g., a binding pair member) detectable labels. Suitable detectable (directly or indirectly) label moieties for use in the methods include any moiety that is detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical, chemical, or other means. For example, suitable labels include biotin for staining with labeled streptavidin conjugate; a fluorescent dye (e.g., fluorescein, Texas red, rhodamine, ALEXAFLUOR® labels, and the like); a radiolabel (e.g., 3H, 125I, 35S, 14C, or 32P); an enzyme (e.g., peroxidase, alkaline phosphatase, galactosidase, and others commonly used in an ELISA); a fluorescent protein (e.g., green fluorescent protein, red fluorescent protein, yellow fluorescent protein, and any convenient derivatives thereof); a metal label; a colorimetric label; a binding pair member; and the like. Any binding pair member can be suitable for use as an indirectly detectable label moiety


A given blocking reagent can be unlabeled, or can be labeled with a label moiety that is distinguishable from label moiety of the first specific binding member. In some embodiments, the cell is contacted with the blocking reagent prior to being contacted with the first specific binding member. In some embodiments, the cell is contacted with the blocking reagent and the first specific binding member at the same time.


The step of detecting the presence or absence of the first specific binding member can be performed using any convenient method for detecting the presence or absence of the first specific binding member (e.g., antibody) on the cell. Suitable methods of detecting include, but are not limited to: flow cytometry (e.g., Fluorescence Activated Cell Sorting (FACS)); Western blot; ELISA imaging, immunohistochemistry; and the like.


Flow cytometry is a well-known methodology using multi-parameter data for identifying and distinguishing between different particle types (i.e., particles, such as cells, that vary from one another in terms of label wavelength, label intensity, size, etc.) in a fluid medium. In performing flow cytometry (i.e., flow cytometrically analyzing particles (e.g., cells) of a sample), a liquid sample (containing particles to be analyzed) is first introduced into a sample loading region, which is sometimes referred as a sample injection chamber, of a flow cytometer. During sample acquisition, the chamber of the sample loading region is pressurized to force sample into the flow path of the flow cytometer, toward the particle interrogation region.


When in the flow path, particles are passed substantially one at a time through the particle interrogation region, where each of the particles is exposed individually to an energy source (e.g., a light source) and measurements of light scatter parameters (e.g., forward scatter, side scatter, etc.) and/or fluorescent emissions as desired (e.g., one or more fluorescent emissions) are separately recorded for each particle. The energy source may include an illuminator that emits light of a single wavelength, such as that provided by a laser (e.g., He/Ne or argon) or a mercury arc lamp with appropriate filters. Examples of excitation light sources include lasers, light emitting diodes, and arc lamps. For example, light at 488 nm may be used as a wavelength of emission in a flow cytometer having a single sensing region. For flow cytometers that emit light at two or more distinct wavelengths, additional wavelengths of emission light may be employed, where specific wavelengths of interest typically include, but are not limited to: 535 nm, 635 nm, and the like. A subject flow cytometer can have one or more lasers (e.g., two or more, three or more, four or more, five or more, six or more, etc.).


In the particle interrogation region, detectors (e.g., light collectors, such as photomultiplier tubes (or “PMT”)), are used to record light that passes through each particle (generally referred to as forward light scatter), light that is reflected orthogonal to the direction of the flow of the particles through the sensing region (generally referred to as orthogonal or side light scatter) and fluorescent light emitted from the particles, if it is labeled with fluorescent marker(s), as the particle passes through the sensing region and is illuminated by the energy source. Each of forward light scatter (or FSC), orthogonal light scatter (SSC), and fluorescence emissions (FL1, FL2, etc.) comprise a separate parameter for each particle (or each “event”). Thus, for example, two, three or four parameters can be collected (and recorded) from a particle labeled with two different fluorescence markers.


The data recorded for each particle is analyzed in real time and/or stored in a data storage and analysis device, such as a computer, as desired. Publications from the scientific and patent literature describing various designs, configurations, and uses of flow cytometers include, for example: (i) Jaye et al., J Immunol. 2012 May 15; 188(10):4715-9: Translational applications of flow cytometry in clinical practice; (ii) Krutzik et al., Curr Protoc Cytom. 2011 January; Chapter 6: Unit 6.31: Fluorescent cell barcoding for multiplex flow cytometry; (iii) Black et al., Assay Drug Dev Technol. 2011 February; 9(1):13-20: Cell-based screening using high-throughput flow cytometryl (iv) Abayomi et al., Cytometry B Clin Cytom. 2008; 74 Suppl 1:S80-9: Flow cytometry as the spearhead for delivering sustainable and versatile laboratory services to HIV-burdened health care systems of the developing world: a Caribbean model; (v) Snow et al., Cytometry A. 2004 February; 57(2):63-9: Flow cytometer electronics; (vi) Schmid et al., Cytometry A. 2003 December; 56(2):113-9: Biosafety concerns for shared flow cytometry core facilities; and (vii) U.S. Pat. Nos. 8,502,976, 8,486,371, 8,441,637, 8,441,624, 7,990,525, 8,021,872, 7,611,849, and 7,354,773; all of which citations are hereby incorporated by reference in their entirety.


Thus, flow cytometry can be used to detect the presence or absence of the first specific binding member on the surface of a cell, and such detection is enhanced (e.g., signal to noise is increased) when the cell is also contacted with a subject blocking reagent.


Because a subject blocking reagent binds to the cell surface, a subject blocking reagent can be used in conjunction with any specific binding member that specifically binds to any cell surface antigen of interest. In some cases, the species from which the first specific binding member (e.g., an antibody that specifically binds the cell surface antigen of interest) is derived is the same species from which the subject blocking reagent is derived. For example, in some cases, the first specific binding member is a rabbit polyclonal antibody that specifically binds a cell surface antigen of interest and the blocking reagent is an antibody or binding fragment thereof derived from a rabbit (i.e., the non-CDR portions of the blocking reagent have rabbit-derived amino acid sequences).


A subject blocking reagent can be used in conjunction with a first specific binding member to detect an antigen on any cell of interest, as long as the cell has expresses the antigen of interest. Thus, which cell is appropriate will depend on the nature of the first specific binding member (i.e., will depend on what antigen the first specific binding member specifically binds). A “cell” or “target cell” as used herein refers to any desired cell. A subject cell can be of any mammalian species (e.g., human, non-human primate, rat, mouse, pig, sheep, cow, rabbit, camel, etc.), of any cell type (neural, hepatic, hematopoietic, etc.), of any cell line (CHO, HEK293, COS, etc.), etc. In order to detect the presence of a first cell surface antigen on the cell, the cell must have the antigen on the cell surface.


A target cell can be a cell in a biological sample and/or a cell isolated from/extracted from a biological sample. A “biological sample” encompasses a variety of sample types obtained from an organism (or obtained in vitro, e.g., via cell culture) (e.g., in some cases substantially in liquid form) and includes cells of the organism. The definition encompasses blood, blood-derived samples, and other liquid samples of biological origin, solid tissue samples such as a biopsy specimen or tissue cultures or cells derived therefrom and the progeny thereof. The definition also includes samples that have been manipulated in any way after their procurement, such as by treatment with reagents, solubilization, enrichment for certain components, or labeling (e.g., labeling with a label). The term “biological sample” encompasses a clinical sample, and also includes cells in culture, cell supernatants, cell lysates, serum, plasma, cerebrospinal fluid, urine, saliva, biological fluid, and tissue samples. Any convenient method for preparing a biological sample (e.g., a biopsy) for use in a cell labeling method can be used. When performing flow cytometry, particles contained in the biological sample are generally separated from one another to allow for flow through the flow path of a flow cytometer.


Flow Cytometry Systems


Aspects of the present disclosure include flow cytometer systems, where the systems include a sample which includes a blocking reagent, e.g., as described (for sample, the systems include a sample to be analyzed that has been prepared by contacting an initial sample with (i) a first specific binding member that specifically binds to a first cell surface antigen; and (ii) a blocking reagent, e.g., as described above). Flow cytometers of interest include, but are not limited, to those devices described in U.S. Pat. Nos. 4,704,891; 4,727,029; 4,745,285; 4,867,908; 5,342,790; 5,620,842; 5,627,037; 5,701,012; 5,895,922; and 6,287,791; the disclosures of which are herein incorporated by reference. In some instances, the flow cytometer includes: a flow channel; at least a first light source configured to direct light to an assay region of the flow channel (where in some instances the cytometer includes two or more light sources); a first detector configured to receive light of a first wavelength from the assay region of the flow channel; and a second detector configured to receive light of a second wavelength from the assay region of the flow channel. A flow cytometer system in accordance with embodiments of the invention may include a flow cytometer (having a sample loading region and a flow path, etc., as described above) and a cell-containing biological sample in the sample loading region, where the biological sample is contacted with: (i) a first specific binding member that specifically binds to a first cell surface antigen; and (iii) a subject blocking reagent. The sample that includes the blocking reagent may be present in a variety of locations in a flow cytometer, e.g., a sample loading region, an analysis region, e.g., cuvette, etc.


Kits


Aspects of the disclosure further include kits (e.g., a blocking kit) for practicing the subject methods. A subject kit includes a subject blocking reagent and a container, e.g., for use of rabbit polyclonal antibody for immunohistochemical staining or flow cytometry with or without additional monoclonal antibodies. Any convenient container (glass vial, plastic vial, screw-top tube, and the like) can be used and can be made out of any convenient material (e.g., glass, plastic, etc). In some embodiments, kits may further include a first specific binding member (e.g., an antibody of interest), a diluent, a buffer, salts, enzymes, enzyme co-factors, substrates, detection reagents, label moieties, and the like.


Components of the kits may be present in separate containers, or multiple components may be present in a single container. For example, a blocking reagent and an antibody of interest (a first specific binding member) may be present in different containers, or combined in a single container, as desired. In some instances, the container(s) are sterile packaging containers.


In addition to the above-mentioned components, a subject kit may further include instructions for using the components of the kit, e.g., to practice the subject methods. The instructions are generally recorded on a suitable recording medium. For example, the instructions may be printed on a substrate, such as paper or plastic, etc. As such, the instructions may be present in the kits as a package insert, in the labeling of the container of the kit or components thereof (i.e., associated with the packaging or subpackaging) etc. In other embodiments, the instructions are present as an electronic storage data file present on a suitable computer readable storage medium, e.g., portable flash drive, CD-ROM, diskette, Hard Disk Drive (HDD) etc. In yet other embodiments, the actual instructions are not present in the kit, but means for obtaining the instructions from a remote source, e.g. via the internet, are provided. An example of this embodiment is a kit that includes a web address where the instructions can be viewed and/or from which the instructions can be downloaded. As with the instructions, this means for obtaining the instructions is recorded on a suitable substrate.


The following examples are offered by way of illustration and not by way of limitation.


EXPERIMENTAL

To improve the specificity of staining of a rabbit polyclonal antibody (e.g., for flow cytometry), a subject recombinant blocking reagent was produced according to the protocol summarized in FIG. 1. In vitro mutagenesis was carried out focusing on the complementary determining regions (CDRs) of the variable region genes encoding the heavy chain and the light chain of the rabbit anti human CD88 mAb. The mutagenesis was empirically focused on codons encoding key chemical group amino acids commonly found in variable regions to be contact residues.


mRNA encoding the heavy and light chains (CDRs 1-3) of the rabbit anti-human CD88 mAb was isolated from hybridoma cells (hybridoma cell line CD88 clone C85-4124), and was reverse transcribed. The PCR product was sequenced to confirm the sequence of the reference antibody Hc and Lc. In vitro site-directed mutagenesis was performed using the QuikChange II XL Site-Directed Mutagenesis Kit (Catalog #200521, Agilent) to generate variant Hc and Lc that differed from the parental/reference chains by anywhere from 1 to up to 7 amino acid substitutions. Thermal cycling was performed with Dpn I digestion of template. Transformation was carried out in XL 10-Gold Ultra-competent cells (Agilent) in an incubator at 37° C. Single cell colonies were chosen and grown in a shaker overnight at 250 rpm and 37° C. These mutations were made within the boxed sequences indicated in FIGS. 9 and 10. Variant polynucleotides were cloned into plasmids (BD3115, BD3114, BD3113), which were transformed subsequently into E. coli. Cloned plasmid DNA was extracted and the specific mutations of the CD88 heavy and light chains were confirmed by sequencing (FIGS. 9 and 10; FIG. 9 mutations: Y51A, FIG. 10 mutations: R116A in the heavy chain CDR). Following sequencing, protein expression was carried out by transient transfection of 293F mammalian cells (LifeTechnologies) with the mutated DNA molecules. The supernatants of transfected cells were harvested after one week (168 hours) and the secreted mAbs were purified using protein G affinity chromatography. Protein expression was confirmed via SDS-PAGE (FIG. 11) and the reduced binding affinity of the mutant (i.e., variant) antibodies to the CD88 antigen was tested in ELISA and flow cytometry assays (FIGS. 4 to 8), relative to that of the parental CD88 monoclonal reference antibody (FIG. 3). The gating strategy for a typical flow cytometry experiment is shown in FIG. 2 performed on whole human lysed blood.


A. ELISA/Flow Cytometry


Reactivity of the variant mAbs against recombinant CD88 proteins (Rabbit monoclonal antibody) produced in 293F cells was determined by enzyme-linked immunoabsorbent assay (ELISA). 96-well plates were blocked overnight at 4° C. with a relevant and irrelevant control peptide. The next day, plates were washed and incubated with ELISPOT blocking buffer and primary antibody for one hour. After that, secondary antibody (BD Pharmingen HRP Goat Anti-Rabbit Ig (Cat No 554021)) was added for one hour. Plates were washed again and substrate was added. A signal by change in color was detected and the O.D. values were measured in the spectrophotometer at 405 nm.


B. Flow Cytometry


For cell surface staining with the parental rabbit anti-human CD88 mAb, PBMCs in PBS containing 2% BSA were mixed with parental rabbit anti-human CD88 mAbs at concentrations of 1 μg, 0.5 μg, 0.25 μg, 0.125 μg and 0.0625 μg as shown in FIG. 3 (A-E) and incubated for 1 hr at 4° C. The cells were washed with PBS containing 2% BSA and incubated at 4° C. for 30 minutes with BD Pharmingen PE Goat Anti-rabbit IgG (Cat No 558146). The cells were washed with PBS containing 2% BSA, and analyzed with a BD FACS Canto II Flow cytometer. Non-specific binding of the secondary anti-rabbit PE-conjugated antibody on the cells alone (primary antibody absent; FIG. 3F) and background autofluorescence by unstained cells (secondary antibody absent; FIG. 3G) served as negative controls for the assay. The % positive signal was detected.


The binding of the variant rabbit anti-human CD88 mAbs was assayed as for the parental mAb, and the results for four variants are shown in FIGS. 4-7. FIG. 4 (A-E) shows the binding at concentrations of 1 μg, 0.5 μg, 0.25 μg, 0.125 μg and 0.0625 μg of a first variant having a single amino acid substitution R116A in the heavy chain CDR. Panels F and G show fluorescence of the negative controls as described for the parental mAb. FIG. 5 (A-E) shows the binding at concentrations of 1 ug, 0.5 ug, 0.25 ug, 0.125 ug and 0.0625 ug of a second variant mAb having a substitution Y51A in the light chain CDR. Panels F and G show fluorescence of the negative controls as described for the parental mAb. FIG. 6 (A-E) shows the binding at concentrations of 1 ug, 0.5 ug, 0.25 ug, 0.125 ug and 0.0625 ug of a third variant mAb having a substitution R116A in the heavy chain and a substitution Y51A in the light chain CDRs. Panels F and G show fluorescence of the negative controls as described for the parental mAb. FIG. 7 (A-E) show the binding at concentrations of 1 ug, 0.5 ug, 0.25 ug, 0.125 ug and 0.0625 ug of a fourth variant mAb having a substitution R116A in the heavy chain and a substitution Y51F in the light chain CDRs. Panels F and G show fluorescence of the negative controls as described for the parental mAb.


To verify that the variant mAbs do not bind non-specifically to lymphocytes, binding of serially diluted variant mAbs (10 μg to 0.625 μg) of each of the variants was measured. FIG. 7 (A-D) show the lack of binding of the respective first, second, third and fourth variant to lymphocytes, sincelymphocytes do not express CD88. As a control, absence of binding was confirmed in the absence of primary antibody.

















Mutation/Domain



Variant No.
(Hc CDR #, Lc CDR#)









Control
None - parental antibody



Variant 1 (FIG. 4)
R116A, CDR-H3



Variant 2 (FIG. 5)
Y51A, CDR-L1



Variant 3 (FIG. 6)
R116A/Y51A



Variant 4 (FIG. 7)
R116A/Y51F










Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it is readily apparent to those of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.


Accordingly, the preceding merely illustrates the principles of the invention. It will be appreciated that those skilled in the art will be able to devise various arrangements which, although not explicitly described or shown herein, embody the principles of the invention and are included within its spirit and scope. Furthermore, all examples and conditional language recited herein are principally intended to aid the reader in understanding the principles of the invention and the concepts contributed by the inventors to furthering the art, and are to be construed as being without limitation to such specifically recited examples and conditions. Moreover, all statements herein reciting principles, aspects, and embodiments of the invention as well as specific examples thereof, are intended to encompass both structural and functional equivalents thereof. Additionally, it is intended that such equivalents include both currently known equivalents and equivalents developed in the future, i.e., any elements developed that perform the same function, regardless of structure. The scope of the present invention, therefore, is not intended to be limited to the exemplary embodiments shown and described herein. Rather, the scope and spirit of present invention is embodied by the appended claims.

Claims
  • 1. A blocking composition for use with a reference antibody that specifically binds to a CD88 cell surface antigen, the blocking composition comprising: a blocking, reagent, wherein the blocking reagent is variant of an anti-CD38 reference antibody or binding fragment thereof, wherein the reference antibody comprises a heavy chain consisting of SEQ ID NO: 7 and a light chain consisting of SEQ ID NO: 4, wherein the variant antibody comprises at least one single amino acid substitution in at least one CDR of the reference antibody, wherein the at least one single amino acid substitution is selected from the group consisting of R116A, Y51A, Y51F, R116A and Y51A and R116A and Y51F; and wherein the blocking reagent does not specifically bind to the CD88 cell surface antigen.
  • 2. The blocking composition according to claim 1, wherein the variant antibody comprises a R116A substitution.
  • 3. The blocking reagent according to claim 1, wherein the variant antibody comprises a Y51A substitution.
  • 4. The blocking reagent according to claim 1, wherein the variant antibody comprises a Y51F substitution.
  • 5. The blocking reagent according to claim 1, wherein the variant antibody comprises R116A and Y51A substitutions.
  • 6. The blocking reagent according to claim 1, wherein the variant antibody comprises R116A and Y51F substitutions.
  • 7. A kit for use in an immunoassay for detecting the presence of a CD88 antigen on a cell comprising: (a) the blocking reagent of claim 1; and(b) a container for the blocking reagent.
  • 8. The kit according to claim 7, wherein the variant antibody comprises a R116A substitution.
  • 9. The kit according to claim 7, wherein the variant antibody comprises a Y51A substitution.
  • 10. The kit according to claim 7, wherein the variant antibody comprises a Y51F substitution.
  • 11. The kit according to claim 7, wherein the variant antibody comprises R116A and Y51A substitutions.
  • 12. The kit according to claim 7, wherein the variant antibody comprises R116A and Y51F substitutions.
CROSS-REFERENCE TO RELATED APPLICATIONS

Pursuant to 35 U.S.C. §119 (e), this application claims priority to the filing date of U.S. Provisional Patent Application Ser. No. 61/884,595 filed Sep. 30, 2013, and to the filing date of U.S. Provisional Patent Application Ser. No. 61/899,190 filed Nov. 2, 2013; the disclosures of which applications are herein incorporated by reference.

US Referenced Citations (5)
Number Name Date Kind
7387897 Wognum et al. Jun 2008 B2
20060121023 Weiner et al. Jun 2006 A1
20090203038 Brophy et al. Aug 2009 A1
20090286258 Kaur et al. Nov 2009 A1
20100239582 Humphreys et al. Sep 2010 A1
Non-Patent Literature Citations (3)
Entry
Rudikoff et al (Proc Nati Acad Sci USA 1982 Voi 79 p. 1979). Rudikoff et al. (PNAS USA (1982) 79:1979-1983).
Harlow & Lane (“Antibodies: A Laboratory Manual” (1988) ColdSpring Harbor Laboratory Press, Cold Spring Harbor, New York, pp. 25-26).
BD Application Handbook ,2003 retrieved from url://research.missouri.edu/cic/files/Immune—Function—Analysis—Techniques.pdf.
Related Publications (1)
Number Date Country
20150093764 A1 Apr 2015 US
Provisional Applications (2)
Number Date Country
61899190 Nov 2013 US
61884595 Sep 2013 US