COMBINATION OF MASKED CTLA4 AND PD1/PDL1 ANTIBODIES FOR TREATING CANCER

Information

  • Patent Application
  • 20220340662
  • Publication Number
    20220340662
  • Date Filed
    March 01, 2022
    2 years ago
  • Date Published
    October 27, 2022
    2 years ago
  • Inventors
  • Original Assignees
    • Xilio Development, Inc. (Waltham, MA, US)
Abstract
The invention provides activatable masked anti-CTLA4 binding proteins (e.g., antibodies, bispecific antibodies, and chimeric receptors) in combination with PD-1 signaling agents inhibitors or PD-Li inhibitors) for use in treating cancer, as well as compositions and kits comprising the activatable masked anti-CTLA4 binding proteins and PD-1 signaling agents.
Description
SEQUENCE LISTING

The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Mar. 18, 2022, is named XTX_CTLA4_05_US1_SL.txt and is 590,463 bytes in size.


FIELD OF THE INVENTION

This invention relates to activatable masked anti-cytotoxic T-lymphocyte-associated protein 4 (CTLA4) binding proteins (e.g., anti-CTLA4 antibodies) and methods related to use of the same in combination with a PD-1 signaling agents (e.g., PD-1 inhibitors or PD-L1 inhibitors).


BACKGROUND OF THE INVENTION

Cancer is the second leading cause of death in the United States, accounting for more deaths than the next five leading causes (chronic respiratory disease, stroke, accidents, Alzheimer's disease and diabetes). While great strides have been made especially with targeted therapies, there remains a great deal of work to do in this space Immunotherapy and a branch of this field, immuno-oncology, is creating viable and exciting therapeutic options for treating malignancies. Specifically, it is now recognized that one hallmark of cancer is immune evasion and significant efforts have identified targets and developed therapies to these targets to reactivate the immune system to recognize and treat cancer. The anti-cytotoxic T-lymphocyte-associated protein 4 (CTLA4) antibody, ipilimumab, has led to long-term survival of patients suffering from stage III/IV malignant melanoma. Ipilimumab is an immune checkpoint antagonist that interrupts the inhibition of T cells by blocking CTLA4, and may lead to the depletion of T Regulatory cells (Treg). [Korman, A., et al., 2005. Tumor immunotherapy: preclinical and clinical activity of anti-CTLA4 antibodies. Current Opinion in Investigational Drugs 6:582-591; Quezada et al., J. Exp. Med., 206(8):1717-1725, 2009; Selby et al. Cancer Immunol Res., 1(1); 32-42, 2013.] Unfortunately, ipilimumab causes generalized (not tumor-specific) activation of T-cell dependent immune responses that leads to immune-related adverse effects which can be life-threatening and are often dose and treatment duration-limiting (Weber, J. S., et al., 2008. Phase I/II study of ipilimumab for patients with metastatic melanoma. Journal of Clinical Oncology 26:5950-5956). These include enterocolitis, dermatitis, hypophysitis, uveitis, hepatitis, nephritis and death. Enterocolitis is the most common major toxicity (affecting approximately 20% of patients). The severe safety risks related to immune-mediated adverse reactions prompted the FDA to approve ipilimumab with a Risk Evaluation and Mitigation Strategy (REMS). Recently, coadministration of ipilimumab and a second immune checkpoint modulator targeting PD1 (e.g., nivolumab) has been shown to significantly increase efficacy of immunotherapy of melanoma when compared to ipilimumab alone. This gain, however, was associated with increased frequencies of grade 3/4 adverse effects, which affected more than 50% of patients receiving combination treatment (Wolchok, J. D., et al. 2013. Nivolumab plus Ipilimumab in Advanced Melanoma. N Engl J Med).


These findings illustrate the need for developing anti-CTLA4 protein therapeutics that effectively target tumors without the side effects associated with systemic immune activation. Provided herein are anti-CTLA binding proteins, compositions thereof and methods of use thereof for addressing this need.


All references cited herein, including patent applications, patent publications, and scientific literature, are herein incorporated by reference in their entirety, as if each individual reference were specifically and individually indicated to be incorporated by reference.


SUMMARY OF THE INVENTION

Provided herein are methods of using activatable masked anti-cytotoxic T-lymphocyte-associated protein 4 (CTLA4) binding proteins in combination with PD-1 signaling agents (e.g., PD-1 or PD-L1 inhibitors), and compositions comprising the same.


In one aspect, the present invention provides a method of treating cancer in a subject, comprising administering to the subject an effective dose of: (a) a masked anti-CTLA4 antibody comprising a masking peptide selected from the group consisting of SEQ ID NOs: 1-46 and a cleavable peptide linker; and (b) a PD-1 or PD-L1 inhibitor.


In some embodiments, masked anti-CTLA4 antibody comprises a cleavable peptide linker comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 47-88, 464-469, and 479-508.


In some embodiments, cleavable peptide linker comprises a spacer selected from the group consisting of SEQ ID NOs: 89-112 and 415-420 linked to the amino-terminus of the cleavable peptide linker, and a spacer selected from the group consisting of SEQ ID NOs: 89-112 and 415-420 linked to the carboxy-terminus of the cleavable peptide linker.


In some embodiments, the cleavable peptide linker comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 454-462.


In some embodiments, the masked anti-CTLA4 antibody comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 113-231 and 444-453.


In some embodiments, the masked anti-CTLA4 antibody is a humanized antibody, a chimeric antibody, a human antibody or antigen-binding fragment thereof.


In some embodiments, the masked anti-CTLA4 antibody comprises a heavy chain variable region (vH) CDR1 comprising NYFMN (SEQ ID NO: 441), a vH CDR2 comprising RVDPEQGRADYAEKFKK (SEQ ID NO: 442), a vH CDR3 comprising RAMDNYGFAY (SEQ ID NO: 443); a light chain variable region (vL) CDR1 comprising SANSALSYMY (SEQ ID NO: 438), a vL CDR2 comprising GTSNLAS (SEQ ID NO: 439), a vL CDR3 comprising HHWSNTQWT (SEQ ID NO: 440).


In some embodiments, the effective dose of the masked anti-CTLA4 antibody is between about 0.1-10 mg/kg, 0.1-15 mg/kg, 0.1-20 mg/kg, 0.3-10 mg/kg, 0.3-15 mg/kg, 0.3-20 mg/kg.


In some embodiments, the effective dose of the masked anti-CTLA4 antibody is selected from 0.1 mg/kg, 0.3 mg/kg, 1 mg/kg, 3 mg/kg 10 mg/kg and 20 mg/kg.


In some embodiments, the effective dose of the masked anti-CTLA4 antibody is 1-100 mg, 10-100 mg, 20-100 mg, 30-100, 50-100, 4-100 mg, 4-200 mg, 4-300 mg, 4-400 mg, 4-500 mg, 4-600 mg, 4-700 mg, 4-800 mg, 4-900 mg, 10-100 mg, 10-200 mg, 10-300 mg, 10-400 mg, 10-500 mg, 10-600 mg, 10-700 mg, 10-800 mg, 10-900 mg, 10-1000 mg, 100-300 mg, 300-500 mg, 500-700 mg, 700-900 mg, or 800-1000 mg.


In some embodiments, the masked anti-CTLA4 antibody is administered at a low dose. In some embodiments, the masked anti-CTLA4 antibody is administered at a dose between 0.01-1 mg/kg. In some embodiments, the masked anti-CTLA4 antibody is administered at a dose between 0.01-3 mg/kg. In some embodiments, the masked anti-CTLA4 antibody administered at a dose selected from 0.01 mg/kg, 0.03 mg/kg, 0.05 mg/kg, 0.06 mg/kg, 0.07 mg/kg, 0.08 mg/kg, 0.09 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.7 mg/kg, 0.8 mg/kg, 0.9 mg/kg, 1 mg/kg, 3 mg/kg.


In some embodiments, the masked anti-CTLA4 antibody comprises a heavy chain constant domain comprising amino acid substitutions S239D or I332E or both, wherein the amino acid residues are numbered according to the EU index as in Kabat.


In some embodiments, the masked anti-CTLA4 antibody comprises a vH that is at least 90% identical to SEQ ID NO: 324.


In some embodiments, the masked anti-CTLA4 antibody comprises a vL that is at least 90% identical to SEQ ID NO: 322.


In some embodiments, the masked anti-CTLA4 antibody is afucosylated or fucose-deficient.


In some embodiments, the anti-CTLA4 antibody or antigen-binding fragment thereof is conjugated to an agent. In some embodiments, the agent is an inhibitor of tubulin polymerization, a DNA damaging agent, or a DNA synthesis inhibitor. In some embodiments, the agent is a maytansinoid, an auristatin, a pyrrolobenzodiazepine (PBD) dimer, a calicheamicin, a duocarmycin, an indo-linobenzodiazepine dimer, or exatecan derivative Dxd.


In some embodiments, the PD-1 or PD-L1 inhibitor is an antibody.


In some embodiments, the PD-1/PD-L1 inhibitor is a PD-1 antibody.


In some embodiments, the anti-PD-1 antibody is selected from nivolumab, pembrolizumab, cemiplimab, dostarlimab.


In some embodiments, the effective dose of the PD-1 antibody is between 1-10 mg/kg.


In some embodiments, the effective dose of the PD-1 antibody is 10 mg/kg.


In some embodiments, the anti-PD-1 antibody is administered at an effective dose of 4-400 mg, 4-500 mg, 4-600 mg, 4-700 mg, 4-800 mg, 4-900 mg, or 4-1000 mg.


In some embodiments, the anti-PD-1 antibody is administered at an effective dose of 200 mg.


In some embodiments, the anti-PD-1 antibody is administered at an effective dose of 1000 mg.


In some embodiments, the anti-PD-1 antibody is administered weekly, every other week, every 3 weeks, every 4 weeks, every 6 weeks or monthly.


In some embodiments, the anti-PD-1 antibody is administered every 3 weeks.


In some embodiments, the PD-1/PD-L1 inhibitor is a PD-L1 antibody.


In some embodiments, the anti-PD-L1 antibody is selected from atezolizumab, avelumab, durvalumab.


In some embodiments, the anti-PD-L1 antibody is administered at an effective dose of between 200-2000 mg.


In some embodiments, the anti-PD-L1 antibody is administered weekly, every other week, every 3 weeks, every 4, weeks, every 6 weeks or monthly.


In some embodiments, the PD1 or PD-L1 inhibitor and the masked anti-CTLA4 antibody are formulated for intravenous administration.


In some embodiments, the PD1 or PD-L1 inhibitor and the masked anti-CTLA4 antibody are formulated together.


In some embodiments, the PD1 or PD-L1 inhibitor and the masked anti-CTLA4 antibody are formulated separately.


In some embodiments, the PD1 or PD-L1 inhibitor is administered concurrently with the masked anti-CTLA4 antibody.


In some embodiments, the cancer is leukemia, lymphoma, head and neck cancer, colorectal cancer, prostate cancer, pancreatic cancer, melanoma, myeloma, breast cancer, neuroblastoma, lung cancer, ovarian cancer, osteosarcoma, bladder cancer, cervical cancer, liver cancer, kidney cancer, skin cancer, testicular cancer, or cutaneous squamous cell carcinoma (CSCC).


In some embodiments, the cancer is small-cell lung carcinoma (SCLC) or non-small-cell lung carcinoma (NSCLC).


In some embodiments, the cancer melanoma, non-small cell lung cancer (NSCLC), pleural mesothelioma, kidney cancer, liver cancer, or colorectal cancer.


Provided herein is a masked antibody containing an antibody or antigen-binding fragment thereof that binds to CTLA4, wherein the antibody or antigen-binding fragment thereof containing a first chain and a second chain, and a masking peptide comprising an amino acid sequence selected from SEQ ID NOs:1-46, wherein the masking peptide is linked via a linker comprising a cleavable peptide to an amino-terminus or carboxy-terminus of the first chain or the second chain of the antibody or antigen-binding fragment thereof. In some embodiments, the first chain is a light chain; and the second chain is a heavy chain.


In some embodiments, the antibody or antigen-binding fragment thereof containing two first chains and two second chains. In some embodiments, the first chain is or comprises a light chain variable domain; and the second chain is or comprises a heavy chain variable domain. In some of any such embodiments, the antigen-binding fragment is a dAb, Fab, Fab′-SH, Fv, scFv, or (Fab′)2 fragment. In some of any such embodiments, the amino-terminus or carboxy-terminus of the masking peptide is linked to the linker comprising a cleavable peptide. In some of any such embodiments the linker comprising a cleavable peptide containing a spacer linker and a cleavable peptide. In some of any such embodiments, the cleavable peptide containing an amino acid sequence selected from SEQ ID NOs:47-88, 464-469, and 479-508. In some of any such embodiments, the spacer linker is directly linked to the N-terminus and/or the C-terminus of the cleavable peptide. In some of any such embodiments, the spacer linker containing an amino acid sequence is selected from SEQ ID NOs:89-112 and 415-420. In some of any such embodiments, at least one amino acid but no more than 20 amino acids is directly linked to the N-terminus of the masking peptide. In some of any such embodiments, at least one amino acid is alanine (A) or glycine-alanine (GA).


In some of any such embodiments, the masked antibody containing in an N-to C-terminal or in a C-to N-terminal direction: a) a masking peptide; b) a cleavable peptide; and c) an antibody or antigen-binding fragment thereof that binds CTLA4. In some of any such embodiments, the masked antibody containing a spacer linker between the masking peptide and the cleavable peptide; and the masked antibody containing a spacer linker between the cleavable peptide and the antibody or antigen-binding fragment thereof that binds to CTLA4.


In some of any such embodiments, the antibody is a murine antibody. In some of any such embodiments, the antibody is a humanized antibody, a chimeric antibody, or a human antibody. In some of any such embodiments, the antibody has an IgG1, IgG2, IgG3 or IgG4 isotype. In some of any such embodiments, the IgG1 contain the amino acid substitutions, S298A, E333A, and K334A; S239D and I332E; S239D, A330L, and I332E; P247I and A339D or A339Q; D280H, K290S with or without S298D or S298V; F243L, R292P, and Y300L; F243L, R292P, Y300L, and P396L; F243L, R292P, Y300L, V305I, and P396L; G236A, S239D, and I332E; K326A and E333A; K326W and E333S; or K290E or K290N, S298G, T299A, and/or K326E; wherein the amino acid residues are numbered according to the EU index as in Kabat.


In some of any such embodiments, the antibody or antigen-binding fragment thereof containing a light chain variable region and a heavy chain variable region, wherein the light chain variable region containing (i) CDR-L1 comprising the amino acid sequence of SEQ ID NO:402 or 408, (ii) CDR-L2 comprising the amino acid sequence of SEQ ID NO:403 or 409, and (iii) CDR-L3 comprising the amino acid sequence of SEQ ID NO:404 or 410; and/or wherein the heavy chain variable region containing (i) CDR-H1 comprising the amino acid sequence of SEQ ID NO:405 or 411, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO:406 or 412, and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO:407 or 413. In some of any such embodiments, the antibody or antigen-binding fragment containing a light chain variable region comprising the amino acid sequence of SEQ ID NO:232; and/or a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:233.


In some of any such embodiments, the antibody or antigen-binding fragment comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:402, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:403, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:404; and/or wherein the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:405, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:406, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:407. In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:402, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:403, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:404; and the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:405, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:406, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:407.


In some of any such embodiments, the antibody or antigen-binding fragment comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:432, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:433, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:444; and/or wherein the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:435, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:436, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:437. In some of any such embodiments, the antibody or antigen-binding fragment comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:432, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:433, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:434; and the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:435, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:436, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:437.


In some of any such embodiments, the antibody or antigen-binding fragment comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:408, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:409, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:410; and/or wherein the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:411, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:412, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:413. In some of any such embodiments, the antibody or antigen-binding fragment comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:408, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:409, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:410; and the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:411, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:412, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:413.


In some of any such embodiments, the antibody or antigen-binding fragment comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:438, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:439, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:440; and/or wherein the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:441, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:442, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:443. In some of any such embodiments, the antibody or antigen-binding fragment comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:438, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:439, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:440; and the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:441, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:442, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:443.


In some of any such embodiments, the antibody containing a light chain comprising the amino acid sequence selected from SEQ ID NOs:237-318; and/or a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:319 or 320. In some of any such embodiments, the antibody or antigen-binding fragment containing a light chain variable region comprising the amino acid sequence selected from SEQ ID NOs:321 or 322; and/or a heavy chain variable region comprising the amino acid sequence selected from SEQ ID NOs:323 or 324. In some of any such embodiments, the antibody or antigen-binding fragment thereof comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 321, and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 323. In some of any such embodiments, the antibody or antigen-binding fragment thereof comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 322, and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 324.


In some of any such embodiments, the antibody containing a light chain comprising the amino acid sequence selected from SEQ ID NOs:327-341; and/or a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:366-380, 421, and 478. In some of any such embodiments, the antibody containing a light chain comprising the amino acid sequence selected from SEQ ID NOs:327, 334, or 342-365; and/or a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:366 or 380-397. In some of any such embodiments, the antibody or antigen binding fragment thereof comprises a light chain comprising the amino acid sequence of SEQ ID NO: 327, and a heavy chain comprising the amino acid sequence of SEQ ID NO: 366. In some of any such embodiments, the antibody or antigen binding fragment thereof comprises a light chain comprising the amino acid sequence of SEQ ID NO: 327, and a heavy chain comprising the amino acid sequence of SEQ ID NO: 478. In some of any such embodiments, the antibody or antigen binding fragment thereof comprises a light chain comprising the amino acid sequence of SEQ ID NO: 334, and a heavy chain comprising the amino acid sequence of SEQ ID NO: 380. In some of any such embodiments, the antibody or antigen binding fragment thereof comprises a light chain comprising the amino acid sequence of SEQ ID NO: 334, and a heavy chain comprising the amino acid sequence of SEQ ID NO: 421.


In some of any such embodiments, the cleavable peptide is a substrate for a protease that is co-localized in a region with a cell or a tissue expressing CTLA4. In some of any such embodiments, the cleavable peptide is cleaved by one or more enzyme selected from the group consisting of: ABHD12, ADAM12, ABHD12B, ABHD13, ABHD17A, ADAM19, ADAM20, ADAM21, ADAM28, ADAM30, ADAM33, ADAMS, ABHD17A, ADAMDEC1, ADAMTS1, ADAMTS10, ADAMTS12, ADAMTS13, ADAMTS14, ADAMTS15, ADAMTS16, ADAMTS17, ADAMTS18, ADAMTS19, ADAMTS2, ADAMTS20, ADAMTS3, ADAMTS4, ABHD17B, ADAMTS5, ADAMTS6, ADAMTS7, ADAMTS8, ADAMTS9, ADAMTSL1, ADAMTSL2, ADAMTSL3, ABHD17C, ADAMTSL5, ASTL, BMP1, CELA1, CELA2A, CELA2B, CELA3A, CELA3B, ADAM10, ADAM15, ADAM17, ADAMS, ADAMTS4, CTSE, CTSF, ADAMTSL4, CMA1, CTRB1, CTRC, CTSO, CTR1, CTSA, CTSW, CTSB, CTSC, CTSD, ESP1, CTSG, CTSH, GZMA, GZMB, GZMH, CTSK, GZMM, CTSL, CTSS, CTSV, CTSZ, HTRA4, KLK10, KLK11, KLK13, KLK14, KLK2, KLK4, DPP4, KLK6, KLK7, KLKB1, ECE1, ECE2, ECEL1, MASP2, MEP1A, MEP1B, ELANE, FAP, GZMA, MMP11, GZMK, HGFAC, HPN, HTRA1, MMP11, MMP16, MMP17, MMP19, HTRA2, MMP20, MMP21, HTRA3, HTRA4, KEL, MMP23B, MMP24, MMP25, MMP26, MMP27, MMP28, KLK5, MMP3, MMP7, MMP8, MMP9, LGMN, LNPEP, MASP1, PAPPA, PAPPA2, PCSK1, NAPSA, PCSK5, PCSK6, MME, MMP1, MMP10, PLAT, PLAU, PLG, PRSS1, PRSS12, PRSS2, PRSS21, PRSS3, PRSS33, PRSS4, PRSS55, PRSS57, MMP12, PRSS8, PRSS9, PRTN3, MMP13, MMP14, ST14, TMPRSS10, TMPRSS11A, TMPRSS11D, TMPRSS11E, TMPRSS11F, TMPRSS12, TMPRSS13, MMP15, TMPRSS15, MMP2, TMPRSS2, TMPRSS3, TMPRSS4, TMPRSS5, TMPRSS6, TMPRSS7, TMPRSS9, NRDC, OVCH1, PAMR1, PCSK3, PHEX, TINAG, TPSAB1, TPSD1, and TPSG1.


In some of any such embodiments, the cleavable peptide is cleaved by one or more enzyme selected from the group consisting of: ADAM17, HTRA1, PRSS1, FAP, GZMK, NAPSA, MMP1, MMP2, MMP9, MMP10, MMP7, MMP12, MMP28, ADAMTS9, HGFAC, and HTRA3. In some of any such embodiments, the antibody or antigen-binding fragment thereof is conjugated to an agent. In some of any such embodiments, the agent is an inhibitor of tubulin polymerization, a DNA damaging agent, or a DNA synthesis inhibitor. In some of any such embodiments, the agent is a maytansinoid, an auristatin, a pyrrolobenzodiazepine (PBD) dimer, a calicheamicin, a duocarmycin, a indo-linobenzodiazepine dimer or exatecan derivative Dxd.


In some of any such embodiments, the masked antibody provided herein exhibits an optimal occlusion ratio of about 20 to about 10,000. In a further embodiment, the optimal occlusion ratio is about 20 to about 1,000. In a further embodiment, the optimal occlusion ratio is about 80 to about 100.


In some of any such embodiments, the masked antibody comprises the amino acid sequence of SEQ ID NO: 421, and comprises an amino acid sequence that is selected from the group consisting of SEQ ID NOs: 358 and 422-431.


Also provide herein is a masked bispecific antibody containing a light chain and a heavy chain of a first pair that specifically binds to CTLA4, light chain and a heavy chain of a second pair that specifically binds to an antigen, and a masking peptide comprising an amino acid sequence selected from SEQ ID NOs:1-46, wherein the masking peptide is linked via a linker comprising a cleavable peptide to an amino-terminus or carboxy-terminus of the light chain or the heavy chain of the first pair. In some embodiments, the amino-terminus or carboxy-terminus of the masking peptide is linked to the linker comprising a cleavable peptide. In some of any such embodiments, the linker comprising a cleavable peptide containing a spacer linker and a cleavable peptide.


In some of any such embodiments, the cleavable peptide containing an amino acid sequence selected from SEQ ID NOs:47-88, 464-469, and 479-508. In some of any such embodiments, a spacer linker is directly linked to the N-terminus or the C-terminus of the cleavable peptide. In some of any such embodiments, the spacer linker containing an amino acid sequence is selected from SEQ ID NOs:89-112 and 415-420. In some of any such embodiments, at least one amino acid but no more than 20 amino acids is directly linked to the N-terminus of the masking peptide. In some of any such embodiments, the at least one amino acid is alanine (A) or glycine-alanine (GA).


In some of any such embodiments, the light chain or heavy chain of the first pair containing in an N-to C-terminal or in a C-to N-terminal direction: a) a masking peptide; b) a cleavable peptide; and c) a light chain or heavy chain. In some of any such embodiments, the first pair containing a spacer linker between the masking peptide and the cleavable peptide; and the first pair containing a spacer linker between the cleavable peptide and the light chain or heavy chain.


In some of any such embodiments, the bispecific antibody is a murine antibody. In some of any such embodiments, the bispecific antibody is a humanized antibody, a chimeric antibody, or a human antibody. In some of any such embodiments, the bispecific antibody has an IgG1, IgG2, IgG3 or IgG4 isotype. In some of any such embodiments, the IgG1 contain the amino acid substitutions, such as S298A, E333A, and K334A; S239D and I332E; S239D, A330L, and I332E; P247I and A339D or A339Q; D280H, K290S with or without S298D or S298V; F243L, R292P, and Y300L; F243L, R292P, Y300L, and P396L; F243L, R292P, Y300L, V305I, and P396L; G236A, S239D, and I332E; K326A and E333A; K326W and E333S; or K290E or K290N, S298G, T299A, and/or K326E, wherein the amino acid residues are numbered according to the EU index as in Kabat.


In some of any such embodiments, the first pair containing a light chain variable region and a heavy chain variable region, wherein the light chain variable region containing (i) CDR-L1 comprising the amino acid sequence of SEQ ID NO:402 or 408, (ii) CDR-L2 comprising the amino acid sequence of SEQ ID NO:403 or 409, and (iii) CDR-L3 comprising the amino acid sequence of SEQ ID NO:404 or 410; and/or wherein the heavy chain variable region containing (i) CDR-H1 comprising the amino acid sequence of SEQ ID NO:405 or 411, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO:406 or 412, and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO:407 or 413.


In some of any such embodiments, the first pair comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:402, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:403, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:404; and/or wherein the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:405, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:406, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:407. In some embodiments, the first pair comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:402, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:403, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:404; and the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:405, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:406, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:407.


In some of any such embodiments, the first pair comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:432, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:433, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:444; and/or wherein the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:435, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:436, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:437. In some of any such embodiments, the first pair comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:432, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:433, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:434; and the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:435, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:436, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:437.


In some of any such embodiments, the first pair comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:408, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:409, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:410; and/or wherein the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:411, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:412, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:413. In some of any such embodiments, the first pair comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:408, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:409, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:410; and the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:411, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:412, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:413.


In some of any such embodiments, the first pair comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:438, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:439, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:440; and/or wherein the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:441, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:442, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:443. In some of any such embodiments, the first pair comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:438, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:439, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:440; and the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:441, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:442, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:443.


In some of any such embodiments, the first pair containing a light chain variable region comprising the amino acid sequence of SEQ ID NO:232; and/or a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:233. In some of any such embodiments, the first pair containing a light chain comprising the amino acid sequence selected from SEQ ID NOs:237-318; and/or a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:319 or 320. In some of any such embodiments, the first pair containing a light chain variable region comprising the amino acid sequence selected from SEQ ID NOs:321 or 322; and/or a heavy chain variable region comprising the amino acid sequence selected from SEQ ID NOs:323 or 324. In some of any such embodiments, the first pair comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 321, and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 323. In some of any such embodiments, the first pair comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 322, and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 324.


In some of any such embodiments, the first pair containing a light chain comprising the amino acid sequence selected from SEQ ID NOs:327-341; and/or a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:366-380, 421, and 478. In some of any such embodiments, the first pair containing a light chain comprising the amino acid sequence selected from SEQ ID NOs:327, 334, or 342-365; and/or a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:366 or 380-397. In some of any such embodiments, the first pair comprises a light chain comprising the amino acid sequence of SEQ ID NO: 327, and a heavy chain comprising the amino acid sequence of SEQ ID NO: 366. In some of any such embodiments, first pair comprises a light chain comprising the amino acid sequence of SEQ ID NO: 327, and a heavy chain comprising the amino acid sequence of SEQ ID NO: 478. In some of any such embodiments, the first pair comprises a light chain comprising the amino acid sequence of SEQ ID NO: 334, and a heavy chain comprising the amino acid sequence of SEQ ID NO: 380. In some of any such embodiments, the first pair comprises a light chain comprising the amino acid sequence of SEQ ID NO: 334, and a heavy chain comprising the amino acid sequence of SEQ ID NO: 421.


In some of any such embodiments, the cleavable peptide is a substrate for a protease that is co-localized in a region with a cell or a tissue expressing CTLA4. In some of any such embodiments, the cleavable peptide is cleaved by one or more enzyme selected from the group consisting of: ABHD12, ADAM12, ABHD12B, ABHD13, ABHD17A, ADAM19, ADAM20, ADAM21, ADAM28, ADAM30, ADAM33, ADAMS, ABHD17A, ADAMDEC1, ADAMTS1, ADAMTS10, ADAMTS12, ADAMTS13, ADAMTS14, ADAMTS15, ADAMTS16, ADAMTS17, ADAMTS18, ADAMTS19, ADAMTS2, ADAMTS20, ADAMTS3, ADAMTS4, ABHD17B, ADAMTS5, ADAMTS6, ADAMTS7, ADAMTS8, ADAMTS9, ADAMTSL1, ADAMTSL2, ADAMTSL3, ABHD17C, ADAMTSL5, ASTL, BMP1, CELA1, CELA2A, CELA2B, CELA3A, CELA3B, ADAM10, ADAM15, ADAM17, ADAMS, ADAMTS4, CTSE, CTSF, ADAMTSL4, CMA1, CTRB1, CTRC, CTSO, CTR1, CTSA, CTSW, CTSB, CTSC, CTSD, ESP1, CTSG, CTSH, GZMA, GZMB, GZMH, CTSK, GZMM, CTSL, CTSS, CTSV, CTSZ, HTRA4, KLK10, KLK11, KLK13, KLK14, KLK2, KLK4, DPP4, KLK6, KLK7, KLKB1, ECE1, ECE2, ECEL1, MASP2, MEP1A, MEP1B, ELANE, FAP, GZMA, MMP11, GZMK, HGFAC, HPN, HTRA1, MMP11, MMP16, MMP17, MMP19, HTRA2, MMP20, MMP21, HTRA3, HTRA4, KEL, MMP23B, MMP24, MMP25, MMP26, MMP27, MMP28, KLK5, MMP3, MMP7, MMP8, MMP9, LGMN, LNPEP, MASP1, PAPPA, PAPPA2, PCSK1, NAPSA, PCSK5, PCSK6, MME, MMP1, MMP10, PLAT, PLAU, PLG, PRSS1, PRSS12, PRSS2, PRSS21, PRSS3, PRSS33, PRSS4, PRSS55, PRSS57, MMP12, PRSS8, PRSS9, PRTN3, MMP13, MMP14, ST14, TMPRSS10, TMPRSS11A, TMPRSS11D, TMPRSS11E, TMPRSS11F, TMPRSS12, TMPRSS13, MMP15, TMPRSS15, MMP2, TMPRSS2, TMPRSS3, TMPRSS4, TMPRSS5, TMPRSS6, TMPRSS7, TMPRSS9, NRDC, OVCH1, PAMR1, PCSK3, PHEX, TINAG, TPSAB1, TPSD1, and TPSG1. In some of any such embodiments, the cleavable peptide is cleaved by one or more enzyme selected from the group consisting of: ADAM17, HTRA1, PRSS1, FAP, GZMK, NAPSA, MMP1, MMP2, MMP9, MMP10, MMP7, MMP12, MMP28, ADAMTS9, HGFAC, and HTRA3. In some of any such embodiments, the bispecific antibody is conjugated to an agent. In some of any such embodiments, the agent is an inhibitor of tubulin polymerization, a DNA damaging agent, or a DNA synthesis inhibitor. In some of any such embodiments, the agent is a maytansinoid, an auristatin, a pyrrolobenzodiazepine (PBD) dimer, a calicheamicin, a duocarmycin, a indo-linobenzodiazepine dimer or exatecan derivative Dxd. 172. In some of any such embodiments, the first pair and the second pair of the masked bispecific antibody provided herein each exhibit an optimal occlusion ratio which may be the same or different from each other. In some embodiments, the optimal occlusion ratio is about 20 to about 10,000. In a further embodiment, the optimal occlusion ratio is about 20 to about 1,000. In a further embodiment, the optimal occlusion ratio is about 80 to about 100.


Also provided herein is a masked chimeric receptor, contain, a ligand-binding domain comprising a first chain and a second chain that binds to CTLA4; a masking peptide comprising an amino acid sequence selected from SEQ ID NOs:1-46, a transmembrane domain; and an intracellular signaling domain comprising a signaling domain, wherein the masking peptide is linked via a linker comprising a cleavable peptide to an amino-terminus or carboxy-terminus of the first chain or the second chain of the ligand-binding domain.


In some embodiments, the first chain is a light chain variable domain; and the second chain is a heavy chain variable domain. In some embodiments, the amino-terminus or carboxy-terminus of the masking peptide is linked to the linker comprising a cleavable peptide. In some of any such embodiments, the linker comprising a cleavable peptide containing a spacer linker and a cleavable peptide. In some of any such embodiments, the cleavable peptide containing an amino acid sequence selected from SEQ ID NOs:47-88, 464-469, and 479-508. In some of any such embodiments, a spacer linker is directly linked to the N-terminus or the C-terminus of the cleavable peptide. In some of any such embodiments, the spacer linker containing an amino acid sequence is selected from SEQ ID NOs:89-112 and 415-420. In some of any such embodiments, at least one amino acid but no more than 20 amino acids is directly linked to the N-terminus of the masking peptide. In some of any such embodiments, the at least one amino acid is alanine (A) or glycine-alanine (GA). In some of any such embodiments, the first chain or the second chain of the ligand binding domain containing in an N-to C-terminal or in a C-to N-terminal direction: a) a masking peptide; b) a cleavable peptide; and c) the first chain or the second chain. In some of any such embodiments, the ligand-binding domain containing a spacer linker between the masking peptide and the cleavable peptide; and the ligand-binding domain containing a spacer linker between the cleavable peptide and the first chain or second chain.


In some of any such embodiments, the ligand-binding domain containing a first chain and a second chain, wherein the first chain containing (i) CDR-L1 comprising the amino acid sequence of SEQ ID NO:402 or 408, (ii) CDR-L2 comprising the amino acid sequence of SEQ ID NO:403 or 409, and (iii) CDR-L3 comprising the amino acid sequence of SEQ ID NO:404 or 410; and/or wherein the second chain containing (i) CDR-H1 comprising the amino acid sequence of SEQ ID NO:405 or 411, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO:406 or 412, and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO:407 or 413.


In some of any such embodiments, the first chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:402, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:403, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:404; and/or the second chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:405, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:406, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:407. In some embodiments, the first chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:402, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:403, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:404; and the second chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:405, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:406, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:407.


In some of any such embodiments, the first chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:432, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:433, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:444; and/or the second chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:435, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:436, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:437. In some of any such embodiments, the first chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:432, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:433, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:434; and the second chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:435, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:436, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:437.


In some of any such embodiments, the first chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:408, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:409, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:410; and/or the second chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:411, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:412, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:413. In some of any such embodiments, the first chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:408, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:409, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:410; and the second chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:411, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:412, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:413.


In some of any such embodiments, the first chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:438, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:439, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:440; and/or the second chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:441, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:442, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:443. In some of any such embodiments, the first chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:438, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:439, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:440; and the second chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:441, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:442, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:443.


In some of any such embodiments, the first chain containing the amino acid sequence of SEQ ID NO:232; and/or the second chain containing the amino acid sequence of SEQ ID NO:233. In some of any such embodiments, the first chain containing the amino acid sequence selected from SEQ ID NOs:321 or 322; and/or the second chain containing the amino acid sequence selected from SEQ ID NOs:323 or 324. In some of any such embodiments, the first chain comprises the amino acid sequence of SEQ ID NO: 321, and the second chain comprises the amino acid sequence of SEQ ID NO: 323. In some of any such embodiments, the first chain comprises the amino acid sequence of SEQ ID NO: 322, and the second chain comprises the amino acid sequence of SEQ ID NO: 324. In some of any such embodiments, the cleavable peptide is a substrate for a protease that is co-localized in a region with a cell or a tissue expressing CTLA4.


In some of any such embodiments, the cleavable peptide is cleaved by one or more enzyme selected from the group consisting of: ABHD12, ADAM12, ABHD12B, ABHD13, ABHD17A, ADAM19, ADAM20, ADAM21, ADAM28, ADAM30, ADAM33, ADAMS, ABHD17A, ADAMDEC1, ADAMTS1, ADAMTS10, ADAMTS12, ADAMTS13, ADAMTS14, ADAMTS15, ADAMTS16, ADAMTS17, ADAMTS18, ADAMTS19, ADAMTS2, ADAMTS20, ADAMTS3, ADAMTS4, ABHD17B, ADAMTS5, ADAMTS6, ADAMTS7, ADAMTS8, ADAMTS9, ADAMTSL1, ADAMTSL2, ADAMTSL3, ABHD17C, ADAMTSL5, ASTL, BMP1, CELA1, CELA2A, CELA2B, CELA3A, CELA3B, ADAM10, ADAM15, ADAM17, ADAMS, ADAMTS4, CTSE, CTSF, ADAMTSL4, CMA1, CTRB1, CTRC, CTSO, CTR1, CTSA, CTSW, CTSB, CTSC, CTSD, ESP1, CTSG, CTSH, GZMA, GZMB, GZMH, CTSK, GZMM, CTSL, CTSS, CTSV, CTSZ, HTRA4, KLK10, KLK11, KLK13, KLK14, KLK2, KLK4, DPP4, KLK6, KLK7, KLKB1, ECE1, ECE2, ECEL1, MASP2, MEP1A, MEP1B, ELANE, FAP, GZMA, MMP11, GZMK, HGFAC, HPN, HTRA1, MMP11, MMP16, MMP17, MMP19, HTRA2, MMP20, MMP21, HTRA3, HTRA4, KEL, MMP23B, MMP24, MMP25, MMP26, MMP27, MMP28, KLK5, MMP3, MMP7, MMP8, MMP9, LGMN, LNPEP, MASP1, PAPPA, PAPPA2, PCSK1, NAPSA, PCSK5, PCSK6, MME, MMP1, MMP10, PLAT, PLAU, PLG, PRSS1, PRSS12, PRSS2, PRSS21, PRSS3, PRSS33, PRSS4, PRSS55, PRSS57, MMP12, PRSS8, PRSS9, PRTN3, MMP13, MMP14, ST14, TMPRSS10, TMPRSS11A, TMPRSS11D, TMPRSS11E, TMPRSS11F, TMPRSS12, TMPRSS13, MMP15, TMPRSS15, MMP2, TMPRSS2, TMPRSS3, TMPRSS4, TMPRSS5, TMPRSS6, TMPRSS7, TMPRSS9, NRDC, OVCH1, PAMR1, PCSK3, PHEX, TINAG, TPSAB1, TPSD1, and TPSG1. In some of any such embodiments, the cleavable peptide is cleaved by one or more enzyme selected from the group consisting of: ADAM17, HTRA1, PRSS1, FAP, GZMK, NAPSA, MMP1, MMP2, MMP9, MMP10, MMP7, MMP12, MMP28, ADAMTS9, HGFAC, and HTRA3.


In some of any such embodiments, the masked chimeric receptor provided herein exhibits an optimal occlusion ratio of about 20 to about 10,000. In a further embodiment, the optimal occlusion ratio is about 20 to about 1,000. In a further embodiment, the optimal occlusion ratio is about 80 to about 100.


Also provided is a nucleic acid encoding the masked antibodies, the masked bispecific antibodies, or the masked chimeric receptor of any one the aforementioned embodiments. Also provided is a vector comprising the nucleic acid of the aforementioned embodiments. In some embodiments, the vector is an expression vector. Also provided is a host cell comprising the aforementioned nucleic acid embodiments.


Also provided is a method of producing a masked antibody, a masked bispecific antibody or a masked chimeric receptor comprising culturing the aforementioned host cells under a condition that produces the masked antibody, masked bispecific antibody or masked chimeric receptor. In some embodiments, the host cell has a alpha1,6-fucosyltransferase (Fut8) knockout. In some embodiments, wherein the host cell overexpresses β1,4-N-acetylglycosminyltransferase III (GnT-III). In some embodiments, the host cell additionally overexpresses Golgi μ-mannosidase II (ManII). Some of any such embodiments, further include recovering the masked antibody, masked bispecific antibody or masked chimeric receptor produced by the host cell. In some embodiments, masked bispecific antibody or masked chimeric receptor produced by the aforementioned methods.


Also provided is a composition containing a masked antibody, a masked bispecific antibody, or a masked chimeric receptor of any one of aforementioned embodiments. Some embodiments encompass a composition comprising the masked antibody, masked bispecific antibody or masked chimeric receptor of the aforementioned embodiments. In some embodiments, the composition is a pharmaceutical composition.


Also provided is a kit containing the masked antibody, the masked bispecific antibody, the masked chimeric receptor, or the composition of any one of aforementioned embodiments.


Also provided is a method of treating or preventing a neoplastic disease in a subject, the method comprising administering to the subject an effective amount of the masked antibody, the masked bispecific antibody, the masked chimeric receptor, or the composition of any one of aforementioned embodiments. In one embodiment, the neoplastic disease is a cancer. In some embodiments, the cancer is leukemia, lymphoma, head and neck cancer, colorectal cancer, prostate cancer, pancreatic cancer, melanoma, breast cancer, neuroblastoma, lung cancer, ovarian cancer, osteosarcoma, bladder cancer, cervical cancer, liver cancer, kidney cancer, skin cancer or testicular cancer.


It is to be understood that one, some, or all of the properties of the various embodiments described herein may be combined to form other embodiments of the present invention. These and other aspects of the invention will become apparent to one of skill in the art. These and other embodiments of the invention are further described by the detailed description that follows.





BRIEF DESCRIPTION OF THE DRAWINGS


FIGS. 1A and 1B show exemplary results of change in tumor volume following administration of isotype control, Antibody A and ipilimumab each at 0.3 mg/kg (FIG. 1A) and 1 mg/kg (FIG. 1B) in mice.



FIGS. 2A and 2B show exemplary results of change in tumor volume (FIG. 2A) and change of body weight percent (FIG. 2B) following administration of isotype control, 0.3 mg/kg Antibody A alone, 10 mg/kg anti-PD-1 alone and 0.3 mg/kg Antibody A in combination with 10 mg/kg anti-PD-1 in mice.



FIGS. 3A and 3B show exemplary results of change in tumor volume (FIG. 3A) and change of body weight percent (FIG. 3B) following administration of isotype control, 1 mg/kg Antibody A alone, 10 mg/kg anti-PD-1 alone and 1 mg/kg Antibody A in combination with 10 mg/kg anti-PD-1 in mice.



FIG. 4A-4D show exemplary results of percent survival in mice following administration of Antibody A, ipilimumab and Antibody A in combination with an anti-PD-1 antibody. Isotype control, Antibody A and ipilimumab each at 0.3 mg/kg (FIG. 4A) or 1 mg/kg (FIG. 4B); isotype control, 0.3 mg/kg Antibody A alone, 10 mg/kg anti-PD-1 alone and 0.3 mg/kg Antibody A in combination with 10 mg/kg anti-PD-1 (FIG. 4C); isotype control, 1 mg/kg Antibody A alone, 10 mg/kg anti-PD-1 alone and 1 mg/kg Antibody A in combination with 10 mg/kg anti-PD-1 (FIG. 4D).



FIG. 5A-5C show exemplary results on immune activation following administration of isotype control, 1 mg/kg Antibody A alone, 10 mg/kg anti-PD-1 alone and 1 mg/kg Antibody A in combination with 10 mg/kg anti-PD-1. CD8/Treg ratio in the tumor (FIG. 5A), CD4+ICOS+ in the tumor draining lymph nodes (TDLNs) (FIG. 5B) and CD4+Ki-67+ in peripheral blood (FIG. 5C) was measured.





DETAILED DESCRIPTION

Therapeutics such as checkpoint inhibitors demonstrates unprecedented responses in cancer but their use is limited by immune-related adverse events (irAEs) and other toxicities (e.g., hypophysitis). Provided herein are protein therapeutics that bind CTLA4 specifically after activation by a protease at a target site, for example in a tumor microenvironment, to achieve increased durable response rates and significantly improved safety profiles. The protein therapeutics provided herein are engineered to precisely target pharmacological activity to the tumor microenvironment by exploiting one of the hallmarks of cancer, high local concentrations of active protease. This feature of the tumor microenvironment is used to transform a systemically inert molecule into a locally active drug. Activation of the drug at the tumor microenvironment significantly reduces systemic toxicities that can be associated with drugs that are administered to a subject in active form.


I. Definitions

Before describing the invention in detail, it is to be understood that this invention is not limited to particular compositions or biological systems, which can, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting. As used in this specification and the appended claims, the singular forms “a”, “an” and “the” include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to “an antibody” optionally includes a combination of two or more such antibodies, and the like.


The term “about” as used herein refers to the usual error range for the respective value readily known to the skilled person in this technical field. Reference to “about” a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se.


It is understood that aspects and embodiments of the invention described herein include “comprising,” “consisting,” and “consisting essentially of” aspects and embodiments.


The term “antibody” includes polyclonal antibodies, monoclonal antibodies (including full length antibodies which have an immunoglobulin Fc region), antibody compositions with polyepitopic specificity, multispecific antibodies (e.g., bispecific antibodies, diabodies, and single-chain molecules, as well as antibody fragments (e.g., Fab, F(ab′)2, and Fv). The term “immunoglobulin” (Ig) is used interchangeably with “antibody” herein.


The basic 4-chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains. An IgM antibody consists of 5 of the basic heterotetramer units along with an additional polypeptide called a J chain, and contains 10 antigen binding sites, while IgA antibodies comprise from 2-5 of the basic 4-chain units which can polymerize to form polyvalent assemblages in combination with the J chain. In the case of IgGs, the 4-chain unit is generally about 150,000 daltons. Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype. Each H and L chain also has regularly spaced intrachain disulfide bridges. Each H chain has at the N-terminus, a variable domain (VH) followed by three constant domains (CH) for each of the α and γ chains and four CH domains for μ and ε isotypes. Each L chain has at the N-terminus, a variable domain (VL) followed by a constant domain at its other end. The VL is aligned with the VH and the CL is aligned with the first constant domain of the heavy chain (CH1). Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains. The pairing of a VH and VL together forms a single antigen-binding site. For the structure and properties of the different classes of antibodies, see e.g., Basic and Clinical Immunology, 8th Edition, Daniel P. Sties, Abba I. Terr and Tristram G. Parsolw (eds), Appleton & Lange, Norwalk, Conn., 1994, page 71 and Chapter 6.


The L chain from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains. Depending on the amino acid sequence of the constant domain of their heavy chains (CH), immunoglobulins can be assigned to different classes or isotypes. There are five classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, having heavy chains designated α, δ, ε, γ and μ, respectively. The γ and α classes are further divided into subclasses on the basis of relatively minor differences in the CH sequence and function, e.g., humans express the following subclasses: IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2. IgG1 antibodies can exist in multiple polymorphic variants termed allotypes (reviewed in Jefferis and Lefranc 2009. mAbs Vol 1 Issue 4 1-7) any of which are suitable for use in the invention. Common allotypic variants in human populations are those designated by the letters a, f, n, z.


An “isolated” antibody is one that has been identified, separated and/or recovered from a component of its production environment (e.g., naturally or recombinantly). In some embodiments, the isolated polypeptide is free of association with all other components from its production environment. Contaminant components of its production environment, such as that resulting from recombinant transfected cells, are materials that would typically interfere with research, diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. In some embodiments, the polypeptide is purified: (1) to greater than 95% by weight of antibody as determined by, for example, the Lowry method, and in some embodiments, to greater than 99% by weight; (1) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie blue or silver stain. Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, an isolated polypeptide or antibody is prepared by at least one purification step.


The term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations and/or post-translation modifications (e.g., isomerizations, amidations) that may be present in minor amounts. In some embodiments, monoclonal antibodies have a C-terminal cleavage at the heavy chain and/or light chain. For example, 1, 2, 3, 4, or 5 amino acid residues are cleaved at the C-terminus of heavy chain and/or light chain. In some embodiments, the C-terminal cleavage removes a C-terminal lysine from the heavy chain. In some embodiments, monoclonal antibodies have an N-terminal cleavage at the heavy chain and/or light chain. For example, 1, 2, 3, 4, or 5 amino acid residues are cleaved at the N-terminus of heavy chain and/or light chain. In some embodiments truncated forms of monoclonal antibodies can be made by recombinant techniques. In some embodiments, monoclonal antibodies are highly specific, being directed against a single antigenic site. In some embodiments, monoclonal antibodies are highly specific, being directed against multiple antigenic sites (such as a bispecific antibody or a multispecific antibody). The modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including, for example, the hybridoma method, recombinant DNA methods, phage-display technologies, and technologies for producing human or human-like antibodies in animals that have parts or all of the human immunoglobulin loci or genes encoding human immunoglobulin sequences.


The term “naked antibody” refers to an antibody that is not conjugated to a cytotoxic moiety or radiolabel.


The term “parental antibody” refers to an antibody prior to modification, such as the masking of an antibody with a masking peptide.


The term “masked antibody” refers to an antibody that has been modified to comprise a masking peptide and in some embodiments other components that allow for activation or removal of the masking peptide in a preferred environment.


An “antibody-drug conjugate” or “ADC” refers to an antibody conjugated to one or more heterologous molecule(s), including but not limited to a cytotoxic agent.


The terms “full-length antibody,” “intact antibody” or “whole antibody” are used interchangeably to refer to an antibody in its substantially intact form, as opposed to an antibody fragment. Specifically, whole antibodies include those with heavy and light chains including an Fc region. The constant domains may be native sequence constant domains (e.g., human native sequence constant domains) or amino acid sequence variants thereof. In some cases, the intact antibody may have one or more effector functions.


An “antibody fragment” comprises a portion of an intact antibody, the antigen binding and/or the variable region of the intact antibody. Examples of antigen-binding antibody fragments include domain antibodies (dAbs), Fab, Fab′, F(ab′)2 and Fv fragments; diabodies; linear antibodies (see U.S. Pat. No. 5,641,870, Example 2; Zapata et al., Protein Eng. 8(10): 1057-1062 [1995]); single-chain antibody molecules, and multispecific antibodies formed from antibody fragments. Single heavy chain antibodies or single light chain antibodies can be engineered, or in the case of the heavy chain, can be isolated from camelids, shark, libraries or mice engineered to produce single heavy chain molecules.


Papain digestion of antibodies produced two identical antigen-binding fragments, called “Fab” fragments, and a residual “Fc” fragment, a designation reflecting the ability to crystallize readily. The Fab fragment consists of an entire L chain along with the variable region domain of the H chain (VH), and the first constant domain of one heavy chain (CH1). Each Fab fragment is monovalent with respect to antigen binding, i.e., it has a single antigen-binding site. Pepsin treatment of an antibody yields a single large F(ab′)2 fragment which roughly corresponds to two disulfide linked Fab fragments having different antigen-binding activity and is still capable of cross-linking antigen. Fab′ fragments differ from Fab fragments by having a few additional residues at the carboxy terminus of the CH1 domain including one or more cysteines from the antibody hinge region. Fab′-SH is the designation herein for Fab′ in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab′)2 antibody fragments originally were produced as pairs of Fab′ fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.


The Fc fragment comprises the carboxy-terminal portions of both H chains held together by disulfides. The effector functions of antibodies are determined by sequences and glycan in the Fc region, the region which is also recognized by Fc receptors (FcR) found on certain types of cells.


“Fv” is the minimum antibody fragment which contains a complete antigen-recognition and -binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three HVRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.


“Single-chain Fv” also abbreviated as “sFv” or “scFv” are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain. In some embodiments, the sFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the sFv to form the desired structure for antigen binding. For a review of the sFv, see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).


“Functional fragments” of the antibodies of the invention comprise a portion of an intact antibody, generally including the antigen binding or variable region of the intact antibody or the Fv region of an antibody which retains or has modified FcR binding capability. Examples of antibody fragments include linear antibody, single-chain antibody molecules and multispecific antibodies formed from antibody fragments.


The monoclonal antibodies herein specifically include “chimeric” antibodies (immunoglobulins) in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is (are) identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Pat. No. 4,816,567; Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)). Chimeric antibodies of interest herein include PRIMATIZED® antibodies wherein the antigen-binding region of the antibody is derived from an antibody produced by, e.g., immunizing macaque monkeys with an antigen of interest. As used herein, “humanized antibody” is used as a subset of “chimeric antibodies.”


“Humanized” forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. In one embodiment, a humanized antibody is a human immunoglobulin (recipient antibody) in which residues from an HVR of the recipient are replaced by residues from an HVR of a non-human species (donor antibody) such as murine, rat, rabbit or non-human primate having the desired specificity, affinity, and/or capacity. In some instances, FR residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications may be made to further refine antibody performance, such as binding affinity. In general, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin sequence, and all or substantially all of the FR regions are those of a human immunoglobulin sequence, although the FR regions may include one or more individual FR residue substitutions that improve antibody performance, such as binding affinity, isomerization, immunogenicity, etc. In some embodiments, the number of these amino acid substitutions in the FR are no more than 6 in the H chain, and in the L chain, no more than 3. The humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see, e.g., Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992). See also, for example, Vaswani and Hamilton, Ann. Allergy, Asthma & Immunol. 1:105-115 (1998); Harris, Biochem. Soc. Transactions 23:1035-1038 (1995); Hurle and Gross, Curr. Op. Biotech. 5:428-433 (1994); and U.S. Pat. Nos. 6,982,321 and 7,087,409. In some embodiments, humanized antibodies are directed against a single antigenic site. In some embodiments, humanized antibodies are directed against multiple antigenic sites. An alternative humanization method is described in U.S. Pat. No. 7,981,843 and U.S. Patent Application Publication No. 2006/0134098.


The “variable region” or “variable domain” of an antibody refers to the amino-terminal domains of the heavy or light chain of the antibody. Accordingly, the terms “variable region” and “variable domain” as used herein may be used interchangeably. The variable domains of the heavy chain and light chain may be referred to as “VH” and “VL”, respectively. These domains are generally the most variable parts of the antibody (relative to other antibodies of the same class) and contain the antigen binding sites. The variable domains of the heavy chain and the light chain can be determined using any available method or numbering scheme and may include the variable domains as described, e.g., in WO 2018/207701, the contents of which are hereby incorporated by reference. In some embodiments, the variable domain of the heavy chain and/or the light chain may lack one or more amino acid residues on the carboxyl terminus of the variable domain (i.e., at the carboxyl terminus of the fourth framework domain) that may otherwise be included in descriptions of the variable domain based on certain numbering schemes. In some embodiments, the variable domain of the heavy chain and/or the light chain may include one or more amino acid residues on the carboxyl terminus of the variable domain (i.e., at the carboxyl terminus of the fourth framework domain) that may otherwise not be included in descriptions of the variable domain based on certain numbering schemes.


The term “hypervariable region,” “HVR,” or “HV,” when used herein refers to the regions of an antibody-variable domain that are hypervariable in sequence and/or form structurally defined loops. Generally, antibodies comprise six HVRs; three in the VH (H1, H2, H3), and three in the VL (L1, L2, L3). In native antibodies, H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies. See, e.g., Xu et al. Immunity 13:37-45 (2000); Johnson and Wu in Methods in Molecular Biology 248:1-25 (Lo, ed., Human Press, Totowa, N.J., 2003)). Indeed, naturally occurring camelid antibodies consisting of a heavy chain only are functional and stable in the absence of light chain. See, e.g., Hamers-Casterman et al., Nature 363:446-448 (1993) and Sheriff et al., Nature Struct. Biol. 3:733-736 (1996).


A number of HVR delineations are in use and are encompassed herein. The HVRs that are Kabat complementarity-determining regions (CDRs) are based on sequence variability and are the most commonly used (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institute of Health, Bethesda, Md. (1991)). Chothia HVRs refer instead to the location of the structural loops (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)). The “contact” HVRs are based on an analysis of the available complex crystal structures. The residues from each of these HVRs are noted below.















Loop
Kabat
Chothia
Contact







L1
L24-L34
L26-L34
L30-L36


L2
L50-L56
L50-L56
L46-L55


L3
L89-L97
L91-L96
L89-L96


H1
H31-H35B
H26-H32
H30-H35B (Kabat Numbering)


H1
H31-H35
H26-H32
H30-H35 (Chothia Numbering)


H2
H50-H65
H53-H56
H47-H58


H3
H95-H102
H95-H102
H93-H101









Unless otherwise indicated, the variable-domain residues (HVR residues and framework region residues) are numbered according to Kabat et al., supra.


“Framework” or “FR” residues are those variable-domain residues other than the HVR residues as herein defined.


The expression “variable-domain residue-numbering as in Kabat” or “amino-acid-position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy-chain variable domains or light-chain variable domains of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain. For example, a heavy-chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc. according to Kabat) after heavy-chain FR residue 82. The Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence.


An “acceptor human framework” for the purposes herein is a framework comprising the amino acid sequence of a VL or VH framework derived from a human immunoglobulin framework or a human consensus framework. An acceptor human framework “derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain pre-existing amino acid sequence changes. In some embodiments, the number of pre-existing amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.


“Percent (%) amino acid sequence identity” with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For example, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows:





100 times the fraction X/Y


number of amino acid residues scored as identical matches by the sequence in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A.


An antibody that “binds to,” “specifically binds to” or is “specific for” a particular a polypeptide or an epitope on a particular polypeptide is one that binds to that particular polypeptide or epitope on a particular polypeptide without substantially binding to any other polypeptide or polypeptide epitope. In some embodiments, binding of an activatable masked anti-CTLA4 binding protein described herein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) to an unrelated, non-CTLA4 polypeptide is less than about 10% of the antibody binding to CTLA4 as measured by methods known in the art (e.g., enzyme-linked immunosorbent assay (ELISA)). In some embodiments, the binding protein (e.g., antibody) that binds to a CTLA4 (e.g., a murine CTLA4 and/or a human CTLA4) has an equilibrium dissociation constant (KD) of ≤1 μM, ≤100 nM, ≤10 nM, ≤2 nM, ≤1 nM, ≤0.7 nM, ≤0.6 nM, ≤0.5 nM, ≤0.1 nM, ≤0.01 nM, or ≤0.001 nM (e.g. 10−8M or less, e.g. from 10−8M to 10−13M, e.g., from 10−9M to 10−13M).


The term “CTLA4” or “CTLA4 protein” as provided herein includes any of the recombinant or naturally-occurring forms of the cytotoxic T-lymphocyte-associated protein 4 (CTLA4) or variants or homologs thereof that maintain CTLA4 protein activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to CTLA4). In some aspects, the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring CTLA4 polypeptide. In some embodiments, CTLA4 is the protein as identified by the NCBI sequence reference GI:83700231, homolog or functional fragment thereof. In some embodiments, CTLA4 is a human CTLA4. In some embodiments, CTLA4 is a murine CTLA4.


Antibody “effector functions” refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype. Examples of antibody effector functions include: C1q binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptors); and B cell activation.


“Antibody-dependent cell-mediated cytotoxicity” or “ADCC” refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcRs) present on certain cytotoxic cells (e.g., natural killer (NK) cells, neutrophils and macrophages) enable these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell with cytotoxins. The antibodies “arm” the cytotoxic cells and are required for killing of the target cell by this mechanism. The primary cells for mediating ADCC, NK cells, express FcγRIII only, whereas monocytes express FcγRI, FcγRII and FcγRIII. Fc expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9: 457-92 (1991). In some embodiments, an activatable masked anti-CTLA4 binding protein described herein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) is engineered or expressed in cells that lack the ability to fucosylate the Fc glycan to have enhanced ADCC. To assess ADCC activity of a molecule of interest, an in vitro ADCC assay, such as that described in U.S. Pat. No. 5,500,362 or 5,821,337 may be performed. Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and natural killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al., PNAS USA 95:652-656 (1998). Other Fc variants that alter ADCC activity and other antibody properties include those disclosed by Ghetie et al., Nat Biotech. 15:637-40, 1997; Duncan et al, Nature 332:563-564, 1988; Lund et al., J. Immunol 147:2657-2662, 1991; Lund et al, Mol Immunol 29:53-59, 1992; Alegre et al, Transplantation 57:1537-1543, 1994; Hutchins et al., Proc Natl. Acad Sci USA 92:11980-11984, 1995; Jefferis et al, Immunol Lett. 44:111-117, 1995; Lund et al., FASEB J9:115-119, 1995; Jefferis et al, Immunol Lett 54:101-104, 1996; Lund et al, J Immunol 157:4963-4969, 1996; Armour et al., Eur J Immunol 29:2613-2624, 1999; Idusogie et al, J Immunol 164:4178-4184, 200; Reddy et al, J Immunol 164:1925-1933, 2000; Xu et al., Cell Immunol 200:16-26, 2000; Idusogie et al, J Immunol 166:2571-2575, 2001; Shields et al., J Biol Chem 276:6591-6604, 2001; Jefferis et al, Immunol Lett 82:57-65. 2002; Presta et al., Biochem Soc Trans 30:487-490, 2002; Lazar et al., Proc. Natl. Acad. Sci. USA 103:4005-4010, 2006; U.S. Pat. Nos. 5,624,821; 5,885,573; 5,677,425; 6,165,745; 6,277,375; 5,869,046; 6,121,022; 5,624,821; 5,648,260; 6,194,551; 6,737,056; 6,821,505; 6,277,375; 7,335,742; and 7,317,091.


The term “Fc region” herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native-sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy-chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof. Suitable native-sequence Fc regions for use in the antibodies of the invention include human IgG1, IgG2, IgG3 and IgG4.


“Binding affinity” as used herein refers to the strength of the non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). In some embodiments, the affinity of a binding protein (e.g., antibody) for a CTLA4 can generally be represented by an equilibrium dissociation constant (KD). Affinity can be measured by common methods known in the art, including those described herein.


“Binding avidity” as used herein refers to the binding strength of multiple binding sites of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen).


An “isolated” nucleic acid molecule encoding the antibodies herein is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the environment in which it was produced. In some embodiments, the isolated nucleic acid is free of association with all components associated with the production environment. The isolated nucleic acid molecules encoding the polypeptides and antibodies herein is in a form other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from nucleic acid encoding the polypeptides and antibodies herein existing naturally in cells.


The term “pharmaceutical formulation” refers to a preparation that is in such form as to permit the biological activity of the active ingredient to be effective, and that contains no additional components that are unacceptably toxic to a subject to which the formulation would be administered. Such formulations are sterile.


“Carriers” as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution. Examples of physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEEN™, polyethylene glycol (PEG), and PLURONICS™.


As used herein, the term “treatment” refers to clinical intervention designed to alter the natural course of the individual or cell being treated during the course of clinical pathology. Desirable effects of treatment include decreasing the rate of disease progression, ameliorating or palliating the disease state, and remission or improved prognosis. An individual is successfully “treated”, for example, if one or more symptoms associated with a disorder (e.g., a neoplastic disease) are mitigated or eliminated. For example, an individual is successfully “treated” if treatment results in increasing the quality of life of those suffering from a disease, decreasing the dose of other medications required for treating the disease, reducing the frequency of recurrence of the disease, lessening severity of the disease, delaying the development or progression of the disease, and/or prolonging survival of individuals.


As used herein, “in conjunction with” or “in combination with” refers to administration of one treatment modality in addition to another treatment modality. As such, “in conjunction with” or “in combination with” refers to administration of one treatment modality before, during or after administration of the other treatment modality to the individual.


As used herein, the term “prevention” includes providing prophylaxis with respect to occurrence or recurrence of a disease in an individual. An individual may be predisposed to, susceptible to a disorder, or at risk of developing a disorder, but has not yet been diagnosed with the disorder. In some embodiments, activatable masked anti-CTLA4 binding proteins (e.g., activatable masked anti-CTLA4 antibodies) described herein are used to delay development of a disorder.


As used herein, an individual “at risk” of developing a disorder may or may not have detectable disease or symptoms of disease, and may or may not have displayed detectable disease or symptoms of disease prior to the treatment methods described herein. “At risk” denotes that an individual has one or more risk factors, which are measurable parameters that correlate with development of the disease, as known in the art. An individual having one or more of these risk factors has a higher probability of developing the disorder than an individual without one or more of these risk factors.


An “effective amount” refers to at least an amount effective, at dosages and for periods of time necessary, to achieve the desired or indicated effect, including a therapeutic or prophylactic result. An effective amount can be provided in one or more administrations. A “therapeutically effective amount” is at least the minimum concentration required to affect a measurable improvement of a particular disorder. A therapeutically effective amount herein may vary according to factors such as the disease state, age, sex, and weight of the patient, and the ability of the antibody to elicit a desired response in the individual. A therapeutically effective amount may also be one in which any toxic or detrimental effects of the antibody are outweighed by the therapeutically beneficial effects. A “prophylactically effective amount” refers to an amount effective, at the dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, but not necessarily, since a prophylactic dose is used in subjects prior to or at the earlier stage of disease, the prophylactically effective amount can be less than the therapeutically effective amount.


“Chronic” administration refers to administration of the medicament(s) in a continuous as opposed to acute mode, so as to main the initial therapeutic effect (activity) for an extended period of time. “Intermittent” administration is treatment that is not consecutively done without interruption, but rather is cyclic in nature.


As used herein, an “individual” or a “subject” is a mammal. A “mammal” for purposes of treatment includes humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, rabbits, cattle, pigs, hamsters, gerbils, mice, ferrets, rats, cats, etc. In some embodiments, the individual or subject is human.


II. Methods of Treatment

Provided herein are methods for treating or preventing a disease in a subject comprising administering to the subject an effective amount of an activatable masked anti-CTLA4 binding protein described herein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) or compositions thereof) and a PD-1 signaling agent (e.g., PD-1 or PD-L1 inhibitor). In some embodiments, the subject (e.g., a human patient) has been diagnosed with a neoplastic disorder (e.g., cancer) or is at risk of developing such a disorder.


For the prevention or treatment of disease, the appropriate dosage of an active agent, will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the agent is administered for preventive or therapeutic purposes, previous therapy, the subject's clinical history and response to the agent, and the discretion of the attending physician. The agent is suitably administered to the subject at one time or over a series of treatments. In some embodiments of the methods described herein, an interval between administrations of an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) and a PD-1 signaling agent (e.g., PD-1 or PD-L1 inhibitor) is about one month or longer. In some embodiments, the interval between administrations is about two months, about three months, about four months, about five months, about six months or longer. In some embodiments of the methods described herein, an interval between administrations of an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) and a PD-1 signaling agent (e.g., PD-1 or PD-L1 inhibitor) is about every 3 weeks. In some embodiments of the methods described herein, an interval between administrations of an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) and a PD-1 signaling agent (e.g., PD-1 or PD-L1 inhibitor) is weekly, every 2 weeks, every 3 weeks, every 4 weeks, every 5 weeks, or every 6 weeks. In some embodiments, the a PD-1 signaling agent (e.g., PD-1 or PD-L1 inhibitor) is administered every 3 weeks.


As used herein, an interval between administrations refers to the time period between one administration of the antibody and the next administration of the antibody. As used herein, an interval of about one month includes four weeks. In some embodiments, the interval between administrations is about two weeks, about three weeks, about four weeks, about eight weeks, about twelve weeks, about sixteen weeks, about twenty weeks, about twenty four weeks, or longer.


In some embodiments, the treatment includes multiple administrations of the antibody, wherein the interval between administrations may vary. For example, the interval between the first administration and the second administration is about one month, and the intervals between the subsequent administrations are about three months. In some embodiments, the interval between the first administration and the second administration is about one month, the interval between the second administration and the third administration is about two months, and the intervals between the subsequent administrations are about three months.


In some embodiments, an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) described herein is administered at a flat dose. In some embodiments, an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) described herein is administered to a subject at a dosage from about 25 mg to about 500 mg per dose.


In some embodiments, an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) described herein is administered to a subject depending on the type and severity of the disease. In some embodiments, the activatable masked anti-CTLA4 antibody is administered at a dose of about 1 μg/kg to 20 mg/kg (e.g. 0.1 mg/kg-10 mg/kg, 0.1 mg/kg-15 mg/kg) by one or more separate administrations, or by continuous infusion.


In some embodiments, an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) described herein is administered to a subject at a dosage from about 0.1 mg/kg to about 10 mg/kg or about 1.0 mg/kg to about 10 mg/kg. In some embodiments, an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) described herein is administered to a subject at a dosage of about any of 0.1 mg/kg, 0.5 mg/kg, 1.0 mg/kg, 1.5 mg/kg, 2.0 mg/kg, 2.5 mg/kg, 3.0 mg/kg, 3.5 mg/kg, 4.0 mg/kg, 4.5 mg/kg, 5.0 mg/kg, 5.5 mg/kg, 6.0 mg/kg, 6.5 mg/kg, 7.0 mg/kg, 7.5 mg/kg, 8.0 mg/kg, 8.5 mg/kg, 9.0 mg/kg, 9.5 mg/kg, 10.0 mg/kg, 11.0 mg/kg, 12 mg/kg, 13 mg/kg, 14 mg/kg, 15 mg/kg, 16.0 mg/kg, 17 mg/kg, 18 mg/kg, 19 mg/kg, or 20 mg/kg.


In some embodiments, an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) described herein is administered to a subject at a dosage of between about 0.1 mg/kg and 10 mg/kg, between about 0.1 mg/kg and 20 mg/kg, between about 1 mg/kg and 10 mg/kg, between about 3 mg/kg and 10 mg/kg, between about 0.3 mg/kg and 15 mg/kg, or between about 0.3 mg/kg and 10 mg/kg.


A method of treatment contemplated herein is the treatment of a disorder or disease with an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) described herein and a PD-1 signaling agent (e.g., PD-1 or PD-L1 inhibitor). Disorders or diseases that are treatable with the formulations of this present invention include leukemia, lymphoma, head and neck cancer, colorectal cancer, prostate cancer, pancreatic cancer, melanoma, myeloma, breast cancer, neuroblastoma, lung cancer, ovarian cancer, osteosarcoma, bladder cancer, cervical cancer, liver cancer, kidney cancer, skin cancer (e.g., Merkel cell carcinoma) or testicular cancer.


In some embodiments, the cancer is small-cell lung carcinoma (SCLC) or non-small-cell lung carcinoma (NSCLC).


In some embodiments, the cancer is melanoma.


In some embodiments, provided herein is a method of treatment or prevention of a cancer by administration of an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) and a PD-1 signaling agent (e.g., PD-1 or PD-L1 inhibitor) described herein. As used herein, the term “cancer” refers to all types of cancer, neoplasm or malignant tumors found in mammals, including leukemias, lymphomas, melanomas, neuroendocrine tumors, carcinomas and sarcomas. Exemplary cancers that may be treated with an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) and a PD-1 signaling agent (e.g., PD-1 or PD-L1 inhibitor), pharmaceutical composition, or method provided herein include lymphoma, sarcoma, bladder cancer, bone cancer, brain tumor, cervical cancer, colon cancer, esophageal cancer, gastric cancer, head and neck cancer, kidney cancer, myeloma, thyroid cancer, leukemia, prostate cancer, breast cancer (e.g. triple negative, ER positive, ER negative, chemotherapy resistant, Herceptin resistant, HER2 positive, doxorubicin resistant, tamoxifen resistant, ductal carcinoma, lobular carcinoma, primary, metastatic), ovarian cancer, pancreatic cancer, liver cancer (e.g. hepatocellular carcinoma), lung cancer (e.g. non-small cell lung carcinoma, squamous cell lung carcinoma, adenocarcinoma, large cell lung carcinoma, small cell lung carcinoma, carcinoid, sarcoma), glioblastoma multiforme, glioma, melanoma, prostate cancer, castration-resistant prostate cancer, breast cancer, triple negative breast cancer, glioblastoma, ovarian cancer, lung cancer, squamous cell carcinoma (e.g., head, neck, or esophagus), colorectal cancer, leukemia, acute myeloid leukemia, lymphoma, B cell lymphoma, or multiple myeloma. Additional examples include, cancer of the thyroid, endocrine system, brain, breast, cervix, colon, head & neck, esophagus, liver, kidney, lung, non-small cell lung, melanoma, mesothelioma, ovary, sarcoma, stomach, uterus or Medulloblastoma, Hodgkin's Disease, Non-Hodgkin's Lymphoma, multiple myeloma, neuroblastoma, glioma, glioblastoma multiforme, ovarian cancer, rhabdomyosarcoma, primary thrombocytosis, primary macroglobulinemia, primary brain tumors, cancer, malignant pancreatic insulanoma, malignant carcinoid, urinary bladder cancer, premalignant skin lesions, testicular cancer, lymphomas, thyroid cancer, neuroblastoma, esophageal cancer, genitourinary tract cancer, malignant hypercalcemia, endometrial cancer, adrenal cortical cancer, neoplasms of the endocrine or exocrine pancreas, medullary thyroid cancer, medullary thyroid carcinoma, melanoma, colorectal cancer, papillary thyroid cancer, hepatocellular carcinoma, Paget's Disease of the Nipple, Phyllodes Tumors, Lobular Carcinoma, Ductal Carcinoma, cancer of the pancreatic stellate cells, cancer of the hepatic stellate cells, or prostate cancer.


In some embodiments, provided herein is a method of treatment or prevention of a leukemia by administration of an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) and a PD-1 signaling agent (e.g., PD-1 or PD-L1 inhibitor) described herein. The term “leukemia” refers broadly to progressive, malignant diseases of the blood-forming organs and is generally characterized by a distorted proliferation and development of leukocytes and their precursors in the blood and bone marrow. Leukemia is generally clinically classified on the basis of (1) the duration and character of the disease-acute or chronic; (2) the type of cell involved; myeloid (myelogenous), lymphoid (lymphogenous), or monocytic; and (3) the increase or non-increase in the number abnormal cells in the blood-leukemic or aleukemic (subleukemic). Exemplary leukemias that may be treated with a compound, pharmaceutical composition, or method provided herein include, for example, acute nonlymphocytic leukemia, chronic lymphocytic leukemia, acute granulocytic leukemia, chronic granulocytic leukemia, acute promyelocytic leukemia, adult T-cell leukemia, aleukemic leukemia, a leukocythemic leukemia, basophylic leukemia, blast cell leukemia, bovine leukemia, chronic myelocytic leukemia, leukemia cutis, embryonal leukemia, eosinophilic leukemia, Gross' leukemia, hairy-cell leukemia, hemoblastic leukemia, hemocytoblastic leukemia, histiocytic leukemia, stem cell leukemia, acute monocytic leukemia, leukopenic leukemia, lymphatic leukemia, lymphoblastic leukemia, lymphocytic leukemia, lymphogenous leukemia, lymphoid leukemia, lymphosarcoma cell leukemia, mast cell leukemia, megakaryocytic leukemia, micromyeloblastic leukemia, monocytic leukemia, myeloblastic leukemia, myelocytic leukemia, myeloid granulocytic leukemia, myelomonocytic leukemia, Naegeli leukemia, plasma cell leukemia, multiple myeloma, plasmacytic leukemia, promyelocytic leukemia, Rieder cell leukemia, Schilling's leukemia, stem cell leukemia, subleukemic leukemia, or undifferentiated cell leukemia.


In some embodiments, provided herein is a method of treatment or prevention of a sarcoma by administration of an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) and a PD-1 signaling agent (e.g., PD-1 or PD-L1 inhibitor) described herein. The term “sarcoma” generally refers to a tumor which is made up of a substance like the embryonic connective tissue and is generally composed of closely packed cells embedded in a fibrillar or homogeneous substance. Sarcomas that may be treated with a compound, pharmaceutical composition, or method provided herein include a chondrosarcoma, fibrosarcoma, lymphosarcoma, melanosarcoma, myxosarcoma, osteosarcoma, Abemethy's sarcoma, adipose sarcoma, liposarcoma, alveolar soft part sarcoma, ameloblastic sarcoma, botryoid sarcoma, chloroma sarcoma, chorio carcinoma, embryonal sarcoma, Wilms' tumor sarcoma, endometrial sarcoma, stromal sarcoma, Ewing's sarcoma, fascial sarcoma, fibroblastic sarcoma, giant cell sarcoma, granulocytic sarcoma, Hodgkin's sarcoma, idiopathic multiple pigmented hemorrhagic sarcoma, immunoblastic sarcoma of B cells, lymphoma, immunoblastic sarcoma of T-cells, Jensen's sarcoma, Kaposi's sarcoma, Kupffer cell sarcoma, angiosarcoma, leukosarcoma, malignant mesenchymoma sarcoma, parosteal sarcoma, reticulocytic sarcoma, Rous sarcoma, serocystic sarcoma, synovial sarcoma, or telangiectaltic sarcoma.


In some embodiments, provided herein is a method of treatment or prevention of a melanoma by administration of an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) and a PD-1 signaling agent (e.g., PD-1 or PD-L1 inhibitor) described herein. The term “melanoma” is taken to mean a tumor arising from the melanocytic system of the skin and other organs. Melanomas that may be treated with a compound, pharmaceutical composition, or method provided herein include, for example, acral-lentiginous melanoma, amelanotic melanoma, benign juvenile melanoma, Cloudman's melanoma, S91 melanoma, Harding-Passey melanoma, juvenile melanoma, lentigo maligna melanoma, malignant melanoma, nodular melanoma, subungal melanoma, or superficial spreading melanoma.


In some embodiments, provided herein is a method of treatment or prevention of a carcinoma by administration of an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) and a PD-1 signaling agent (e.g., PD-1 or PD-L1 inhibitor) described herein. The term “carcinoma” refers to a malignant new growth made up of epithelial cells tending to infiltrate the surrounding tissues and give rise to metastases. Exemplary carcinomas that may be treated with a compound, pharmaceutical composition, or method provided herein include, for example, medullary thyroid carcinoma, familial medullary thyroid carcinoma, acinar carcinoma, acinous carcinoma, adenocystic carcinoma, adenoid cystic carcinoma, carcinoma adenomatosum, carcinoma of adrenal cortex, alveolar carcinoma, alveolar cell carcinoma, basal cell carcinoma, carcinoma basocellulare, basaloid carcinoma, basosquamous cell carcinoma, bronchioalveolar carcinoma, bronchiolar carcinoma, bronchogenic carcinoma, cerebriform carcinoma, cholangiocellular carcinoma, chorionic carcinoma, colloid carcinoma, comedo carcinoma, corpus carcinoma, cribriform carcinoma, carcinoma en cuirasse, carcinoma cutaneum, cylindrical carcinoma, cylindrical cell carcinoma, duct carcinoma, ductal carcinoma, carcinoma durum, embryonal carcinoma, encephaloid carcinoma, epiermoid carcinoma, carcinoma epitheliale adenoides, exophytic carcinoma, carcinoma ex ulcere, carcinoma fibrosum, gelatiniforni carcinoma, gelatinous carcinoma, giant cell carcinoma, carcinoma gigantocellulare, glandular carcinoma, granulosa cell carcinoma, hair-matrix carcinoma, hematoid carcinoma, hepatocellular carcinoma, Hurthle cell carcinoma, hyaline carcinoma, hypernephroid carcinoma, infantile embryonal carcinoma, carcinoma in situ, intraepidermal carcinoma, intraepithelial carcinoma, Krompecher's carcinoma, Kulchitzky-cell carcinoma, large-cell carcinoma, lenticular carcinoma, carcinoma lenticulare, lipomatous carcinoma, lobular carcinoma, lymphoepithelial carcinoma, carcinoma medullare, medullary carcinoma, melanotic carcinoma, carcinoma molle, mucinous carcinoma, carcinoma muciparum, carcinoma mucocellulare, mucoepidermoid carcinoma, carcinoma mucosum, mucous carcinoma, carcinoma myxomatodes, nasopharyngeal carcinoma, oat cell carcinoma, carcinoma ossificans, osteoid carcinoma, papillary carcinoma, periportal carcinoma, preinvasive carcinoma, prickle cell carcinoma, pultaceous carcinoma, renal cell carcinoma of kidney, reserve cell carcinoma, carcinoma sarcomatodes, schneiderian carcinoma, scirrhous carcinoma, carcinoma scroti, signet-ring cell carcinoma, carcinoma simplex, small-cell carcinoma, solanoid carcinoma, spheroidal cell carcinoma, spindle cell carcinoma, carcinoma spongiosum, squamous carcinoma, squamous cell carcinoma, string carcinoma, carcinoma telangiectaticum, carcinoma telangiectodes, transitional cell carcinoma, carcinoma tuberosum, tubular carcinoma, tuberous carcinoma, verrucous carcinoma, or carcinoma villosum.


In some embodiments, provided herein is a method of treatment or prevention of metastatic cancer by administration of an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) and a PD-1 signaling agent (e.g., PD-1 or PD-L1 inhibitor) described herein. As used herein, the terms “metastasis,” “metastatic,” and “metastatic cancer” can be used interchangeably and refer to the spread of a neoplastic disease or disorder, e.g., cancer, from one organ or another non-adjacent organ or body part. Cancer occurs at an originating site, e.g., breast, which site is referred to as a primary tumor, e.g., primary breast cancer. Some cancer cells in the primary tumor or originating site acquire the ability to penetrate and infiltrate surrounding normal tissue in the local area and/or the ability to penetrate the walls of the lymphatic system or vascular system circulating through the system to other sites and tissues in the body. A second clinically detectable tumor formed from cancer cells of a primary tumor is referred to as a metastatic or secondary tumor. When cancer cells metastasize, the metastatic tumor and its cells are presumed to be similar to those of the original tumor. Thus, if lung cancer metastasizes to the breast, the secondary tumor at the site of the breast consists of abnormal lung cells and not abnormal breast cells. The secondary tumor in the breast is referred to a metastatic lung cancer. Thus, the phrase metastatic cancer refers to a disease in which a subject has or had a primary tumor and has one or more secondary tumors. The phrases non-metastatic cancer or subjects with cancer that is not metastatic refers to diseases in which subjects have a primary tumor but not one or more secondary tumors. For example, metastatic lung cancer refers to a disease in a subject with or with a history of a primary lung tumor and with one or more secondary tumors at a second location or multiple locations, e.g., in the breast.


In some embodiments, diseases or disorders that may benefit by the masked CTLA4 binding proteins in combination with a PD-1 signaling agent (e.g., PD-1 or PD-L1 inhibitor) described herein include a disease (e.g., diabetes, cancer (e.g. prostate cancer, renal cancer, metastatic cancer, melanoma, castration-resistant prostate cancer, breast cancer, triple negative breast cancer, glioblastoma, ovarian cancer, lung cancer, squamous cell carcinoma (e.g., head, neck, or esophagus), colorectal cancer, leukemia, acute myeloid leukemia, lymphoma, B cell lymphoma, or multiple myeloma)) caused by (in whole or in part), or a symptom of the disease is caused by (in whole or in part) CTLA4 or CTLA4 activity or function and/or PD-1 signaling activity or function.


Described herein are methods of treating disorders in a subject (e.g., disorders that benefit from administration of an anti-PD-1 therapy). For example, an anti-PD-1 therapy described herein can be administered e.g., as a combination therapy with an activatable CTLA-4 antibody, for a period sufficient to achieve clinical benefit or according to a regimen as determined by a physician (e.g., an anti-PD-1 therapy is administered in dosage amounts and number of treatment cycles as determined by a physician).


In embodiments, methods described herein are useful for treating T-cell dysfunctional disorders (e.g., cancer). In embodiments, methods described herein are useful for reducing tumors or inhibiting the growth of tumor cells in a subject.


In embodiments, methods described herein are useful for increasing T cell activation or T cell effector function in a subject.


In embodiments, methods described herein are useful for inducing an immune response in a subject.


In embodiments, methods described herein are useful for enhancing an immune response or increasing the activity of an immune cell in a subject.


The inventive methods can be used to treat any type of autoimmune disease (i.e., as disease or disorder caused by immune system over-activity in which the body attacks and damages its own tissues), such as those described in, for example, MacKay I. R. and Rose N. R., eds., The Autoimmune Diseases, Fifth Edition, Academic Press, Waltham, Mass. (2014). Examples of autoimmune diseases that can be treated by the inventive method include, but are not limited to, multiple sclerosis, type 1 diabetes mellitus, rheumatoid arthritis, scleroderma, Crohn's disease, psoriasis, systemic lupus erythematosus (SLE), and ulcerative colitis. When the inventive method treats an autoimmune disease, a PD-1 antibody agent can be used in combination with an anti-inflammatory agent including, for example, corticosteroids (e.g., prednisone and fluticasone) and non-steroidal anti-inflammatory drugs (NSAIDs) (e.g., aspirin, ibuprofen, and naproxen).


PD-1 is abnormally expressed in a variety of cancers (see, e.g., Brown et al, J. Immunol., 170: 1257-1266 (2003); and Flies et. al, Yale Journal of Biology and Medicine, 84: 409-421 (2011)), and PD-L1 expression in some renal cell carcinoma patients correlates with tumor aggressiveness. The inventive methods can be used to treat any type of cancer known in the art.


In embodiments, a cancer that is adenocarcinoma, adenocarcinoma of the lung, acute myeloid leukemia (“AML”), acute lymphoblastic leukemia (“ALL”), adrenocortical carcinoma, anal cancer, appendiceal cancer, B-cell derived leukemia, B-cell derived lymphoma, bladder cancer, brain cancer, breast cancer (e.g., triple negative breast cancer (TNBC)), cancer of the fallopian tube(s), cancer of the testes, cerebral cancer, cervical cancer, choriocarcinoma, chronic myelogenous leukemia, a CNS tumor, colon adenocarcinoma, colon cancer, colorectal cancer, diffuse intrinsic pontine glioma (DIPG), diffuse large B cell lymphoma (“DLBCL”), embryonal rhabdomyosarcoma (ERMS), endometrial cancer, epithelial cancer, esophageal cancer, Ewing's sarcoma, follicular lymphoma (“FL”), gall bladder cancer, gastric cancer, gastrointestinal cancer, glioma, head and neck cancer, a hematological cancer, hepatocellular cancer, Hodgkin's lymphoma/primary mediastinal B-cell lymphoma, kidney cancer, kidney clear cell cancer, laryngeal cancer, leukemia, liver cancer, lung cancer, lymphoma, melanoma, Merkel cell carcinoma, mesothelioma, monocytic leukemia, multiple myeloma, myeloma, a neuroblastic-derived CNS tumor, non-Hodgkin's lymphoma (NHL), non-small cell lung cancer (NSCLC), oral cancer, osteosarcoma, ovarian cancer, ovarian carcinoma, pancreatic cancer, peritoneal cancer, primary peritoneal cancer, prostate cancer, relapsed or refractory classic Hodgkin's Lymphoma (cHL), renal cell carcinoma, rectal cancer, salivary gland cancer (e.g., a salivary gland tumor), sarcoma, skin cancer, small cell lung cancer, small intestine cancer, squamous cell carcinoma of the anogenital region (e.g., squamous cell carcinoma of the anus, penis, cervix, vagina, or vulva), squamous cell carcinoma of the esophagus, squamous cell carcinoma of the head and neck (SCHNC), squamous cell carcinoma of the lung, stomach cancer, T-cell derived leukemia, T-cell derived lymphoma, thymic cancer, a thymoma, thyroid cancer, uveal melanoma, urothelial cell carcinoma, uterine cancer, uterine endometrial cancer, uterine sarcoma, vaginal cancer, vulvar cancer, or Wilms tumor.


In other embodiments, a cancer is a head and neck cancer, a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), a renal cancer, a bladder cancer, a melanoma, Merkel cell carcinoma (see, e.g., Bhatia et al., Curr. Oncol. Rep., 13(6): 488-497 (2011), a cervical cancer, a vaginal cancer, a vulvar cancer, a uterine cancer, a endometrial cancer, an ovarian cancer, a fallopian tube cancer, a breast cancer, a prostate cancer, a salivary gland tumor, a thymoma, a adrenocortical carcinoma, a esophageal cancer, a gastric cancer, a colorectal cancer, an appendiceal cancer, a urothelial cell carcinoma, or a squamous cell carcinoma (e.g., of the lung; of the anogenital region including anus, penis, cervix, vagina, or vulva; or of the esophagus). In some embodiments, a cancer for treatment in the context of the present disclosure is a melanoma, renal cell carcinoma, lung cancer, bladder cancer, breast cancer, cervical cancer, colon cancer, gall bladder cancer, laryngeal cancer, liver cancer, thyroid cancer, stomach cancer, salivary gland cancer, prostate cancer, pancreatic cancer, or Merkel cell carcinoma.


In some embodiments, a patient or population of patients have a hematological cancer. In some embodiments, the patient has a hematological cancer such as Diffuse large B cell lymphoma (“DLBCL”), Hodgkin's lymphoma (“HL”), Non-Hodgkin's lymphoma (“NHL”), Follicular lymphoma (“FL”), acute myeloid leukemia (“AML”), acute lymphoblastic leukemia (“ALL”), or Multiple myeloma (“MM”). In embodiments, a cancer is a blood-borne cancer such as acute lymphoblastic leukemia (“ALL”), acute lymphoblastic B-cell leukemia, acute lymphoblastic T-cell leukemia, acute myeloblastic leukemia (“AML”), acute promyelocytic leukemia (“APL”), acute monoblastic leukemia, acute erythroleukemic leukemia, acute megakaryoblastic leukemia, acute myelomonocytic leukemia, acute nonlymphocyctic leukemia, acute undifferentiated leukemia, chronic myelocytic leukemia (“CML”), chronic lymphocytic leukemia (“CLL”), hairy cell leukemia and multiple myeloma; acute and chronic leukemias such as lymphoblastic, myelogenous, lymphocytic, and myelocytic leukemias.


In embodiments a cancer is a lymphoma such as Hodgkin's disease, non-Hodgkin's Lymphoma, Multiple myeloma, Waldenstrom's macroglobulinemia, Heavy chain disease and Polycythemia vera.


In embodiments, a cancer is a squamous cell carcinoma. In embodiments, a cancer is squamous cell carcinoma of the lung. In embodiments, a cancer is squamous cell carcinoma of the esophagus. In embodiments, a cancer is head and neck squamous cell carcinoma (HNSCC).


In embodiments, a cancer is squamous cell carcinoma of the anogenital region (e.g., of the anus, penis, cervix, vagina, or vulva).


In embodiments, a cancer is bladder cancer, breast cancer (e.g., triple negative breast cancer (TNBC)), cancer of the fallopian tube(s), cholagiocarcinoma, colon adenocarcinoma, endometrial cancer, esophageal cancer, Ewing's sarcoma, gastric cancer, kidney clear cell cancer, lung cancer (e.g., lung adenocarcinoma or lung squamous cell cancer), mesothelioma, ovarian cancer, pancreatic cancer, peritoneal cancer, prostate cancer, uterine endometrial cancer, or uveal melanoma. In embodiments, a cancer is ovarian cancer, cancer of the fallopian tube(s), or peritoneal cancer. In embodiments, a cancer is breast cancer (e.g., TNBC). In embodiments, a cancer is lung cancer (e.g., non-small cell lung cancer). In embodiments, a cancer is prostate cancer.


In embodiments, a cancer is a CNS or brain cancer such as neuroblastoma (NB), glioma, diffuse intrinsic pontine glioma (DIPG), pilocytic astrocytoma, astrocytoma, anaplastic astrocytoma, glioblastoma multiforme, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, meningioma, vestibular schwannoma, adenoma, metastatic brain tumor, meningioma, spinal tumor, or medulloblastoma. In embodiments, a cancer is a CNS tumor.


In some embodiments, a patient or population of patients have a solid tumor. In embodiments, a cancer is a solid tumor such as fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, osteosarcoma, colon cancer, colorectal cancer, kidney cancer, pancreatic cancer, bone cancer, breast cancer, ovarian cancer, prostate cancer, esophageal cancer, stomach cancer, oral cancer, nasal cancer, throat cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilms tumor, cervical cancer, uterine cancer, testicular cancer, non small cell lung cancer (NSCLC), small cell lung carcinoma, bladder carcinoma, lung cancer, epithelial carcinoma, skin cancer, melanoma, neuroblastoma (NB), or retinoblastoma. In some embodiments, the tumor is an advanced stage solid tumor. In some embodiments, the tumor is a metastatic solid tumor. In some embodiments, the patient has a MSI-H solid tumor.


In some embodiments, a patient or population of patients to be treated by the methods of the present invention have or are susceptible to cancer, such as a head and neck cancer, a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), a renal cancer, a bladder cancer, a melanoma, Merkel cell carcinoma, a cervical cancer, a vaginal cancer, a vulvar cancer, a uterine cancer, a endometrial cancer, an ovarian cancer, a fallopian tube cancer, a breast cancer, a prostate cancer, a salivary gland tumor, a thymoma, a adrenocortical carcinoma, a esophageal cancer, a gastric cancer, a colorectal cancer, an appendiceal cancer, a urothelial cell carcinoma, or a squamous cell carcinoma (e.g., of the lung; of the anogenital region including anus, penis, cervix, vagina, or vulva; or of the esophagus). In some embodiments, a patient or population of patients to be treated by the methods of the present invention have or are susceptible to lung cancer (e.g., NSCLC), renal cancer, melanoma, cervical cancer, colorectal cancer, or endometrial cancer (e.g., MSS endometrial cancer or MSI-H endometrial cancer).


In some embodiments, a cancer is a gynecologic cancer (i.e., a cancer of the female reproductive system such as ovarian cancer, fallopian tube cancer, cervical cancer, vaginal cancer, vulvar cancer, uterine cancer, or primary peritoneal cancer, or breast cancer). In some embodiments, cancers of the female reproductive system include, but are not limited to, ovarian cancer, cancer of the fallopian tube(s), peritoneal cancer, and breast cancer.


In embodiments, a cancer is ovarian cancer (e.g., serous or clear cell ovarian cancer). In embodiments, a cancer is fallopian tube cancer (e.g., serous or clear cell fallopian tube cancer). In embodiments, a cancer is primary peritoneal cancer (e.g., serous or clear cell primary peritoneal cancer).


In some embodiments, an ovarian cancer is an epithelial carcinoma. Epithelial carcinomas make up 85% to 90% of ovarian cancers. While historically considered to start on the surface of the ovary, new evidence suggests at least some ovarian cancer begins in special cells in a part of the fallopian tube. The fallopian tubes are small ducts that link a woman's ovaries to her uterus that are a part of a woman's reproductive system. In a normal female reproductive system, there are two fallopian tubes, one located on each side of the uterus. Cancer cells that begin in the fallopian tube may go to the surface of the ovary early on. The term ‘ovarian cancer’ is often used to describe epithelial cancers that begin in the ovary, in the fallopian tube, and from the lining of the abdominal cavity, call the peritoneum. In some embodiments, the cancer is or comprises a germ cell tumor. Germ cell tumors are a type of ovarian cancer develops in the egg-producing cells of the ovaries. In some embodiments, a cancer is or comprises a stromal tumor. Stromal tumors develop in the connective tissue cells that hold the ovaries together, which sometimes is the tissue that makes female hormones called estrogen. In some embodiments, a cancer is or comprises a granulosa cell tumor. Granulosa cell tumors may secrete estrogen resulting in unusual vaginal bleeding at the time of diagnosis. In some embodiments, a gynecologic cancer is associated with homologous recombination repair deficiency/homologous repair deficiency (“HRD”) and/or BRCA1/2 mutation(s). In some embodiments, a gynecologic cancer is platinum-sensitive. In some embodiments, a gynecologic cancer has responded to a platinum-based therapy. In some embodiments, a gynecologic cancer has developed resistance to a platinum-based therapy. In some embodiments, a gynecologic cancer has at one time shown a partial or complete response to platinum-based therapy (e.g., a partial or complete response to the last platinum-based therapy or to the penultimate platinum-based therapy). In some embodiments, a gynecologic cancer is now resistant to platinum-based therapy.


In embodiments, a cancer is a breast cancer. Usually breast cancer either begins in the cells of the milk producing glands, known as the lobules, or in the ducts. Less commonly breast cancer can begin in the stromal tissues. These include the fatty and fibrous connective tissues of the breast. Over time the breast cancer cells can invade nearby tissues such the underarm lymph nodes or the lungs in a process known as metastasis. The stage of a breast cancer, the size of the tumor and its rate of growth are all factors which determine the type of treatment that is offered. Treatment options include surgery to remove the tumor, drug treatment which includes chemotherapy and hormonal therapy, radiation therapy and immunotherapy. The prognosis and survival rate varies widely; the five year relative survival rates vary from 98% to 23% depending on the type of breast cancer that occurs. Breast cancer is the second most common cancer in the world with approximately 1.7 million new cases in 2012 and the fifth most common cause of death from cancer, with approximately 521,000 deaths. Of these cases, approximately 15% are triple-negative, which do not express the estrogen receptor, progesterone receptor (PR) or HER2. In some embodiments, triple negative breast cancer (TNBC) is characterized as breast cancer cells that are estrogen receptor expression negative (<1% of cells), progesterone receptor expression negative (<1% of cells), and HER2-negative.


In embodiments, a cancer is ER-positive breast cancer, ER-negative breast cancer, PR-positive breast cancer, PR-negative breast cancer, HER2-positive breast cancer, HER2-negative breast cancer, BRCA1/2-positive breast cancer, BRCA1/2-negative cancer, or triple negative breast cancer (TNBC). In embodiments, a cancer is triple negative breast cancer (TNBC).


In some embodiments, a breast cancer is a metastatic breast cancer. In some embodiments, a breast cancer is an advanced breast cancer. In some embodiments, a cancer is a stage II, stage III or stage IV breast cancer. In some embodiments, a cancer is a stage IV breast cancer. In some embodiments, a breast cancer is a triple negative breast cancer.


In some embodiments, a patient or a population of patients to be treated by the methods of the present disclosure have or are susceptible to endometrial cancer (“EC”). Endometrial carcinoma is the most common cancer of the female genital, tract accounting for 10-20 per 100,000 person-years. The annual number of new cases of endometrial cancer (EC) is estimated at about 325 thousand worldwide. Further, EC is the most commonly occurring cancer in post-menopausal women. About 53% of endometrial cancer cases occur in developed countries. In 2015, approximately 55,000 cases of EC were diagnosed in the U.S. and no targeted therapies are currently approved for use in EC. There is a need for agents and regimens that improve survival for advanced and recurrent EC in 1L and 2L settings. Approximately 10,170 people are predicted to die from EC in the U.S. in 2016. The most common histologic form is endometrioid adenocarcinoma, representing about 75-80% of diagnosed cases. Other histologic forms include uterine papillary serous (less than 10%), clear cell 4%, mucinous 1%, squamous less than 1% and mixed about 10%.


From the pathogenetic point of view, EC falls into two different types, so-called types I and II. Type I tumors are low-grade and estrogen-related endometrioid carcinomas (EEC) while type II are non-endometrioid (NEEC) (mainly serous and clear cell) carcinomas. The World Health Organization has recently updated the pathologic classification of EC, recognizing nine different subtypes of EC, but EEC and serous carcinoma (SC) account for the vast majority of cases. EECs are estrogen-related carcinomas, which occur in perimenopausal patients, and are preceded by precursor lesions (endometrial hyperplasia/endometrioid intraepithelial neoplasia). Microscopically, lowgrade EEC (EEC 1-2) contains tubular glands, somewhat resembling the proliferative endometrium, with architectural complexity with fusion of the glands and cribriform pattern. High-grade EEC shows solid pattern of growth. In contrast, SC occurs in postmenopausal patients in absence of hyperestrogenism. At the microscope, SC shows thick, fibrotic or edematous papillae with prominent stratification of tumor cells, cellular budding, and anaplastic cells with large, eosinophilic cytoplasms. The vast majority of EEC are low grade tumors (grades 1 and 2), and are associated with good prognosis when they are restricted to the uterus. Grade 3 EEC (EEC3) is an aggressive tumor, with increased frequency of lymph node metastasis. SCs are very aggressive, unrelated to estrogen stimulation, mainly occurring in older women. EEC 3 and SC are considered high-grade tumors. SC and EEC3 have been compared using the surveillance, epidemiology and End Results (SEER) program data from 1988 to 2001. They represented 10% and 15% of EC respectively, but accounted for 39% and 27% of cancer death respectively.


Endometrial cancers can also be classified into four molecular subgroups: (1) ultramutated/POLE-mutant; (2) hypermutated MSI+ (e.g., MSI-H or MSI-L); (3) copy number low/microsatellite stable (MSS); and (4) copy number high/serous-like. Approximately 28% of cases are MSI-high. (Murali, Lancet Oncol. (2014). In some embodiments, a patient has a mismatch repair deficient subset of 2L endometrial cancer.


In embodiments, an endometrial cancer is metastatic endometrial cancer.


In embodiments, a patient has a MSS endometrial cancer.


In embodiments, a patient has a MSI-H endometrial cancer.


In embodiments, a cancer is a lung cancer. In embodiments, a lung cancer is a squamous cell carcinoma of the lung. In embodiments, a lung cancer is small cell lung cancer (SCLC). In embodiments, a lung cancer is non-small cell lung cancer (NSCLC) such as squamous NSCLC. In embodiments, a lung cancer is an ALK-translocated lung cancer (e.g., ALK-translocated NSCLC). In embodiments, a lung cancer is an EGFR-mutant lung cancer (e.g., EGFR-mutant NSCLC).


In embodiments, a cancer is a colorectal (CRC) cancer (e.g., a solid tumor). In embodiments, a colorectal cancer is an advanced colorectal cancer. In embodiments, a colorectal cancer is a metastatic colorectal cancer. In embodiments, a colorectal cancer is a MSI-H colorectal cancer. In embodiments, a colorectal cancer is a MSS colorectal cancer. In embodiments, a colorectal cancer is a POLE-mutant colorectal cancer. In embodiments, a colorectal cancer is a POLD-mutant colorectal cancer. In embodiments, a colorectal cancer is a high TMB colorectal cancer.


In embodiments, a cancer is a melanoma. In embodiments, a melanoma is an advanced melanoma. In embodiments, a melanoma is a metastatic melanoma. In embodiments, a melanoma is a MSI-H melanoma. In embodiments, a melanoma is a MSS melanoma. In embodiments, a melanoma is a POLE-mutant melanoma. In embodiments, a melanoma is a POLD-mutant melanoma. In embodiments, a melanoma is a high TMB melanoma.


In embodiments, a cancer is an advanced cancer.


In embodiments, a cancer is a metastatic cancer.


In embodiments, a cancer is a recurrent cancer (e.g., a recurrent gynecological cancer such as recurrent epithelial ovarian cancer, recurrent fallopian tube cancer, recurrent primary peritoneal cancer, or recurrent endometrial cancer).


Cancers that can be treated with methods described herein include cancers associated with a high tumor mutation burden (TMB), cancers that microsatellite stable (MSS), cancers that are characterized by microsatellite instability, cancers that have a high microsatellite instability status (MSI-H), cancers that have low microsatellite instability status (MSI-L), cancers associated with high TMB and MSI-H (e.g., cancers associated with high TMB and MSI-L or MSS), cancers having a defective DNA mismatch repair system, cancers having a defect in a DNA mismatch repair gene, hypermutated cancers, cancers having homologous recombination repair deficiency/homologous repair deficiency (“HRD”), cancers comprising a mutation in polymerase delta (POLD), and cancers comprising a mutation in polymerase epsilon (POLE).


In some embodiments, a tumor to be treated is characterized by microsatellite instability. In some embodiments, a tumor is characterized by microsatellite instability high status (MSI-H). Microsatellite instability (“MSI”) is or comprises a change that in the DNA of certain cells (such as tumor cells) in which the number of repeats of microsatellites (short, repeated sequences of DNA) is different than the number of repeats that was contained in the DNA from which it was inherited. About 15% of sporadic colorectal cancers (CRC) harbor widespread alterations in the length of microsatellite (MS) sequences, known as microsatellite instability (MSI) (Boland and Goel, 2010). Sporadic MSI CRC tumors display unique clinicopathological features including near-diploid karyotype, higher frequency in older populations and in females, and a better prognosis (de la Chapelle and Hampel, 2010; Popat et al., 2005). MSI is also present in other tumors, such as in endometrial cancer (EC) of the uterus, the most common gynecological malignancy (Duggan et al., 1994). The same reference Bethesda panel originally developed to screen an inherited genetic disorder (Lynch syndrome) (Umar et al., 2004) is currently applied to test MSI for CRCs and ECs. However, the genes frequently targeted by MSI in CRC genomes rarely harbor DNA slippage events in EC genomes (Gurin et al., 1999).


Microsatellite instability arises from a failure to repair replication-associated errors due to a defective DNA mismatch repair (MMR) system. This failure allows persistence of mismatch mutations all over the genome, but especially in regions of repetitive DNA known as microsatellites, leading to increased mutational load. It has been demonstrated that at least some tumors characterized by MSI-H have improved responses to certain anti-PD-1 agents (Le et al., (2015) N. Engl. J. Med. 372(26):2509-2520; Westdorp et al., (2016) Cancer Immunol. Immunother. 65(10):1249-1259). In some embodiments, a cancer has a microsatellite instability of high microsatellite instability (e.g., MSI-H status). In some embodiments, a cancer has a microsatellite instability status of low microsatellite instability (e.g., MSI-Low). In some embodiments, a cancer has a microsatellite instability status of microsatellite stable (e.g., MSS status). In some embodiments microsatellite instability status is assessed by a next generation sequencing (NGS)-based assay, an immunohistochemistry (IHC)-based assay, and/or a PCR-based assay. In some embodiments, microsatellite instability is detected by NGS. In some embodiments, microsatellite instability is detected by IHC. In some embodiments, microsatellite instability is detected by PCR.


In embodiments, a patient has a MSI-L cancer.


In embodiments, a patient has a MSI-H cancer. In some embodiments, a patient has a MSI-H solid tumor. In embodiments, a MSI-H cancer is MSI-H endometrial cancer. In embodiments, a MSI-H cancer is a solid tumor. In embodiments, a MSI-H cancer is a metastatic tumor. In embodiments, a MSI-H cancer is endometrial cancer. In embodiments, a MSI-H cancer is a non-endometrial cancer. In embodiments, a MSI-H cancer is colorectal cancer.


In embodiments, a patient has a MSS cancer. In embodiments, a MSS cancer is MSS endometrial cancer.


In embodiments, a cancer is associated with a POLE (DNA polymerase epsilon) mutation (i.e., a cancer is a POLE-mutant cancer). In embodiments, a POLE mutation is a mutation in the exonuclease domain. In embodiments, a POLE mutation is a germline mutation. In embodiments, a POLE mutation is a sporadic mutation. In embodiments, a MSI cancer also is associated with a POLE mutation. In embodiments, a MSS cancer also is associated with a POLE mutation. In embodiments, a POLE mutation is identified using sequencing. In embodiments, a POLE-mutant cancer is endometrial cancer. In embodiments, a POLE-mutant cancer is colon cancer. In embodiments, a POLE-mutant cancer is pancreatic cancer, ovarian cancer, or cancer of the small intestine.


In embodiments, a cancer is associated with a POLD (DNA polymerase delta) mutation (i.e., a cancer is a POLD-mutant cancer). In embodiments, a POLD mutation is a mutation in the exonuclease domain. In embodiments, a POLD mutation is a somatic mutation. In embodiments, a POLD mutation is a germline mutation. In embodiments, a POLD-mutant cancer is identified using sequencing. In embodiments, a POLD-mutant cancer is endometrial cancer. In embodiments, a POLD-mutant cancer is colorectal cancer. In embodiments, a POLD-mutant cancer is brain cancer.


In some embodiments, a patient has a mismatch repair deficient (MMRd) cancer.


In embodiments, a MMRd cancer is colorectal cancer.


Microsatellite instability may arise from a failure to repair replication-associated errors due to a defective DNA mismatch repair (MMR) system. This failure allows persistence of mismatch mutations all over the genome, but especially in regions of repetitive DNA known as microsatellites, leading to increased mutational load that may improve responses to certain anti-PD-1 agents. Id. In some embodiments MSI-H status is assess by a NGS-based assay and/or a PCR-based MSI assay. In some embodiments, microsatellite instability is detected by next generation sequencing. In embodiments, microsatellite instability is detected using immunohistochemistry (IHC) testing.


In embodiments, a cancer (e.g., a MMRd cancer) is characterized by a high tumor mutation burden (i.e., a cancer is a high TMB cancer). In some embodiments, the cancer is associated with high TMB and MSI-H. In some embodiments, the cancer is associated with high TMB and MSI-L or MSS. In some embodiments, the cancer is endometrial cancer associated with high TMB. In some related embodiments, the endometrial cancer is associated with high TMB and MSI-H. In some related embodiments, the endometrial cancer is associated with high TMB and MSI-L or MSS. In embodiments, a high TMB cancer is colorectal cancer. In embodiments, a high TMB cancer is lung cancer (e.g., small cell lung cancer (SCLC) or non-small cell lung cancer (NSCLC) such as squamous NSCLC or non-squamous NSCLC). In embodiments, a high TMB cancer is melanoma. In embodiments, a high TMB cancer is urothelial cancer.


In embodiments, a patient has a cancer with elevated expression of tumor-infiltrating lymphocytes (TILs), i.e., a patient has a high-TIL cancer. In embodiments, a high-TIL cancer is breast cancer (e.g., triple negative breast cancer (TNBC) or HER2-positive breast cancer). In embodiments, a high-TIL cancer is a metastatic cancer (e.g., a metastatic breast cancer).


In embodiments, immune-related gene expression signatures can be predictive of a response to an anti-PD-1 therapy for cancer as described herein. For example, a gene panel that includes genes associated with IFN-γ signaling can be useful in identifying cancer patients who would benefit from anti-PD-1 therapy. Exemplary gene panels are described in Ayers et al., J. Clin. Invest., 127(8):2930-2940, 2017. In embodiments, a cancer patient has a cancer that is breast cancer (e.g., TNBC) or ovarian cancer. In embodiments, a cancer patient has a cancer that is bladder cancer, gastric cancer, bilary cancer, esophageal cancer, or head and neck squamous cell carcinoma (HNSCC). In embodiments, a cancer patient has a cancer that is anal cancer or colorectal cancer.


In some embodiments, a patient has a tumor that expresses PD-L1. In some embodiments, PD-L1 status is evaluated in a patient or patient population. In some embodiments, mutational load and baseline gene expression profiles in archival or fresh pre-treatment biopsies are evaluated before, during and/or after treatment with an anti-PD-1 antibody agent. In some embodiments, the status and/or expression of TIM-3 and/or LAG-3 are evaluated in patients.


In some embodiments, at least some of the patients in the cancer patient population have not previously been treated with one or more different cancer treatment modalities.


In some embodiments, a patient has previously been treated with one or more different cancer treatment modalities (e.g., one or more of surgery, radiotherapy, chemotherapy or immunotherapy). In embodiments, a subject has previously been treated with two or more different cancer treatment modalities (e.g., one or more of surgery, radiotherapy, chemotherapy, or immunotherapy). In embodiments, a subject has been previously treated with a cytotoxic therapy. In embodiments, a subject has been previously treated with chemotherapy. In embodiments, a subject has previously been treated with two different cancer treatment modalities (e.g., one or more of surgery, radiotherapy, chemotherapy, or immunotherapy). In embodiments, a subject has previously been treated with three different cancer treatment modalities (e.g., one or more of surgery, radiotherapy, chemotherapy, or immunotherapy).


In embodiments of methods described herein, a method further comprises administering one or more of surgery, a radiotherapy, a chemotherapy, an immunotherapy, an anti-angiogenic agent, or an anti-inflammatory. In embodiments, a method further comprises administering a chemotherapy.


In some embodiments, at least some of the patients in the cancer patient population have previously been treated with chemotherapy (e.g., platinum-based chemotherapy). For example, a patient who has received two lines of cancer treatment can be identified as a 2L cancer patient (e.g., a 2L NSCLC patient). In embodiments, a patient has received two lines or more lines of cancer treatment (e.g., a 2L+ cancer patient such as a 2L+ endometrial cancer patient). In embodiments, a patient has not been previously treated with an anti-PD-1 therapy. In embodiments, a patient previously received at least one line of cancer treatment (e.g., a patient previously received at least one line or at least two lines of cancer treatment). In embodiments, a patient previously received at least one line of treatment for metastatic cancer (e.g., a patient previously received one or two lines of treatment for metastatic cancer).


In embodiments, a subject is resistant to treatment with an agent that inhibits PD-1.


In embodiments, a subject is refractory to treatment with an agent that inhibits PD-1.


In embodiments, a method described herein sensitizes the subject to treatment with an agent that inhibits PD-1.


In embodiments, a subject comprises an exhausted immune cell (e.g., an exhausted immune cell that is an exhausted T cell).


In embodiments of methods described herein, a subject is an animal (e.g., a mammal). In embodiments, a subject is a human. In embodiments, a subject is a non-human mammal (e.g., mice, rats, rabbits, or non-human primates). Accordingly, methods described herein can be useful in both treatment of humans and in veterinary medicine.


In embodiments, a PD-1 inhibitor (e.g., an anti-PD-1 antibody) is administered intravenously (e.g., by intravenous infusion).


Measuring Tumor Response


In some embodiments, a clinical benefit is a complete response (“CR”), a partial response (“PR”) or a stable disease (“SD”). In some embodiments, a clinical benefit corresponds to at least SD. In some embodiments, a clinical benefit corresponds to at least a PR. In some embodiments, a clinical benefit corresponds to a CR. In some embodiments, at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 95% of patients achieve a clinical benefit. In some embodiments, at least 5% of patients achieve a clinical benefit. In some embodiments, at least 5% of patients achieve SD. In some embodiments, at least 5% of patients achieve at least a PR. In some embodiments, at least 5% of patients achieve CR. In some embodiments, at least 20% of patients achieve a clinical benefit. In some embodiments, at least 20% of patients achieve SD.


In some embodiments, the clinical benefit (e.g., SD, PR and/or CR) is determined in accordance with Response Evaluation Criteria in Solid Tumors (RECIST). In some embodiments, the clinical benefit (e.g., SD, PR and/or CR) is determined in accordance RECIST guidelines.


In some embodiments, tumor response can be measured by, for example, the RECIST v 1.1 guidelines. The guidelines are provided by E. A. Eisenhauer, et al., “New response evaluation criteria in solid tumors: Revised RECIST guideline (version 1.1.),” Eur. J. of Cancer, 45: 228-247 (2009), which is incorporated by reference in its entirety. In some embodiments, RECIST guidelines may serve as a basis for all protocol guidelines related to disease status. In some embodiments, RECIST guidelines are used to assess tumor response to treatment and/or date of disease progression.


RECIST guidelines require, first, estimation of the overall tumor burden at baseline, which is used as a comparator for subsequent measurements. Tumors can be measured via use of any imaging system known in the art, for example, by a CT scan, or an X-ray. Measurable disease is defined by the presence of at least one measurable lesion. In studies where the primary endpoint is tumor progression (either time to progression or proportion with progression at a fixed date), the protocol must specify if entry is restricted to those with measurable disease or whether patients having non-measurable disease only are also eligible.


When more than one measurable lesion is present at baseline, all lesions up to a maximum of five lesions total (and a maximum of two lesions per organ) representative of all involved organs should be identified as target lesions and will be recorded and measured at baseline (this means in instances where patients have only one or two organ sites involved a maximum of two and four lesions respectively will be recorded).


Target lesions should be selected on the basis of their size (lesions with the longest diameter), be representative of all involved organs, but in addition should be those that lend themselves to reproducible repeated measurements.


Lymph nodes merit special mention since they are normal anatomical structures which may be visible by imaging even if not involved by tumor. Pathological nodes which are defined as measurable and may be identified as target lesions must meet the criterion of a short axis of P15 mm by CT scan. Only the short axis of these nodes will contribute to the baseline sum. The short axis of the node is the diameter normally used by radiologists to judge if a node is involved by solid tumor. Nodal size is normally reported as two dimensions in the plane in which the image is obtained (for CT scan this is almost always the axial plane; for MRI the plane of acquisition may be axial, sagittal or coronal). The smaller of these measures is the short axis.


For example, an abdominal node which is reported as being 20 mm 30 mm has a short axis of 20 mm and qualifies as a malignant, measurable node. In this example, 20 mm should be recorded as the node measurement. All other pathological nodes (those with short axis P10 mm but <15 mm) should be considered non-target lesions. Nodes that have a short axis <10 mm are considered non-pathological and should not be recorded or followed.


A sum of the diameters (longest for non-nodal lesions, short axis for nodal lesions) for all target lesions will be calculated and reported as the baseline sum diameters. If lymph nodes are to be included in the sum, then as noted above, only the short axis is added into the sum. The baseline sum diameters will be used as reference to further characterize any objective tumor regression in the measurable dimension of the disease.


All other lesions (or sites of disease) including pathological lymph nodes should be identified as non-target lesions and should also be recorded at baseline. Measurements are not required and these lesions should be followed as ‘present’, ‘absent’, or in rare cases ‘unequivocal progression.’ In addition, it is possible to record multiple nontarget lesions involving the same organ as a single item on the case record form (e.g., ‘multiple enlarged pelvic lymph nodes’ or ‘multiple liver metastases’).


In some embodiments, tumor response can be measured by, for example, the immune-related RECIST (irRECIST) guidelines, which include immune related Response Criteria (irRC). In irRC, measurable lesions are measured that have at least one dimension with a minimum size of 10 mm (in the longest diameter by CT or MRI scan) for nonnodal lesions and greater than or equal to 15 mm for nodal lesions, or at least 20 mm by chest X-ray.


In some embodiments, Immune Related Response Criteria include CR (complete disappearance of all lesions (measurable or not, and no new lesions)); PR (decrease in tumor burden by 50% or more relative to baseline); SD (not meeting criteria for CR or PR in the absence of PD); or PD (an increase in tumor burden of at 25% or more relative to nadir). Detailed description of irRECIST can be found at Bohnsack et al., (2014) ESMO, ABSTRACT 4958 and Nishino et al., (2013) Clin. Cancer Res. 19(14): 3936-43.


In some embodiments, tumor response can be assessed by either irRECIST or RECIST version 1.1. In some embodiments, tumor response can be assessed by both irRECIST and RECIST version 1.1.


III. Activatable Masked Anti-CTLA4 Binding Proteins

In one aspect, there is provided an activatable masked cytotoxic T-lymphocyte-associated protein 4 (CTLA4) binding protein comprising (i) a CTLA4 binding domain; (ii) a CTLA4 binding domain masking peptide (also referred to herein as a “masking peptide”); and (iii) a linker comprising a cleavable peptide connecting the masking peptide to the CTLA4 binding domain. In some embodiments, the activatable masked CTLA4 binding protein is a masked anti-CTLA4 antibody or antigen-binding fragment thereof. In some embodiments, the activatable masked CTLA4 binding protein is a masked bispecific antibody that binds to CTLA4. In some embodiments, the activatable masked CTLA4 binding protein is a masked chimeric receptor that binds to CTLA4.


The activatable masked CTLA4 binding proteins provided herein can bind to CTLA4 from various species, for example, some bind to a human CTLA4 and/or murine CTLA4, or cynomolgus CTLA4. In some embodiments, an activatable masked anti-CTLA4 binding protein described herein has one or more of the following characteristics: (1) binds a CTLA4 (e.g. a human CTLA4); (2) binds a CTLA4 with a higher affinity after protease cleavage of a peptide linker linking a masking peptide to the binding protein (e.g., activation); and (3) binds a CTLA4 in vivo at a tumor site.


In one aspect, provided herein are activatable masked CTLA4 binding proteins useful, inter alia, for the treatment of a neoplastic disease in which CTLA4 plays a role. An activatable masked CTLA4 binding protein as provided herein includes a binding domain capable of interacting with (e.g., binding to) a CTLA4 protein expressed on the surface of a cell (e.g., a cancer cell or T cell). The binding domain, in some embodiments, is connected to a masking peptide through a linker comprising a cleavable peptide such that the masking peptide prevents the CTLA4 binding domain from binding to a CTLA4 protein. Upon cleavage of the cleavable peptide, the masking peptide is released thereby allowing the binding domain to interact with a CTLA4 protein.


Also provided herein, in some embodiments, is a masked CTLA4 binding protein (e.g., a masked anti-CTLA4 antibody or antigen-binding fragment thereof) comprising (a) a CTLA4 binding protein (e.g., an anti-CTLA4 antibody or antigen-binding fragment thereof comprising a first chain and a second chain); and (b) a masking peptide. In some embodiments, the CTLA4 binding protein is an anti-CTLA4 antibody or antigen-binding fragment thereof comprising a first chain and a second chain, and the masking peptide is linked via a linker comprising a cleavable peptide to an amino-terminus or carboxy-terminus of the first chain or the second chain of the antibody or antigen-binding fragment thereof. In some embodiments, the first chain is or comprises a heavy chain, and the second chain is or comprises a light chain; or the first chain is or comprises a light chain, and the second chain is or comprises a heavy chain. In some embodiments, the first chain is or comprises a heavy chain variable region, and the second chain is or comprises a light chain variable region; or the first chain is or comprises a light chain variable region, and the second chain is or comprises a heavy chain variable region. In some embodiments, the linker comprising a cleavable peptide comprises, in an amino-terminus to carboxy-terminus direction: a spacer linker, a cleavable peptide, and a spacer linker. In some embodiments, the C-terminus of the masking peptide is linked to the N-terminus of the linker comprising a cleavable peptide, and the C-terminus of the linker comprising a cleavable peptide is linked to the N-terminus of the first chain, e.g., the light chain or the light chain variable region.


CTLA4 Binding Protein


The term “CTLA4 binding protein” as provided herein refers to a polypeptide comprising a CTLA4 binding domain that is capable of binding to, or otherwise exhibiting an affinity for, a CTLA4 protein. In some embodiments, the CTLA4 binding protein is an anti-CTLA4 antibody or antigen-binding fragment thereof, a bispecific antibody, an antigen binding fragment, a single chain antibody, etc. In some embodiments, the CTLA4 binding protein is an antibody or antigen-binding fragment thereof that binds to CTLA4. In some embodiments, an antibody or antigen-binding fragment thereof that binds to CTLA4 is an anti-CTLA4 antibody or antigen-binding fragment thereof. Accordingly, in some embodiments, the CTLA4 binding protein is an anti-CTLA4 antibody or antigen-binding fragment thereof. In some embodiments, the CTLA4 binding protein is a component of a chimeric antigen receptor that binds CTLA4.


The term “CTLA4 binding domain” refers to a recombinantly expressed polypeptide domain capable of binding to, or otherwise exhibiting an affinity for, a CTLA4 protein found in or on a cell. Methods for determining the extent of binding of a CTLA4 binding domain to CTLA4 are well known in the art.


In some embodiments, the antibody is a humanized antibody, a chimeric antibody, or a human antibody. In some embodiments, an anti-CTLA4 antibody or antigen-binding fragment thereof described herein is a monoclonal antibody. In some embodiments, an anti-CTLA4 antibody or antigen-binding fragment thereof described herein is an antibody fragment (including antigen-binding fragment), e.g., a dAb, Fab, Fab′-SH, Fv, scFv, or (Fab′)2 fragment. In some embodiments, the antibody or antigen-binding fragment thereof is a dimer. In some embodiments, the antibody or antigen-binding fragment thereof is a homodimer. In some embodiments, the antibody or antigen-binding fragment thereof is a heterodimer. In some embodiments, the antibody or antigen-binding fragment thereof is a heterodimer comprising a first chain and a second chain, such as a heterodimer comprising a heavy chain and a light chain. In some embodiments, the antibody or antigen-binding fragment comprises a first chain and a second chain. In some embodiments, the first chain is or comprises a heavy chain, and the second chain is or comprises a light chain; or the first chain is or comprises a light chain, and the second chain is or comprises a heavy chain. In some embodiments, the first chain is or comprises a heavy chain variable region, and the second chain is or comprises a light chain variable region; or the first chain is or comprises a light chain variable region, and the second chain is or comprises a heavy chain variable region. In some embodiments, the antibody or antigen-binding fragment thereof comprises a first chain and a second chain (e.g., a light chain and a heavy chain). In some embodiments, the antibody or antigen-binding fragment thereof comprises two first chains and two second chains (e.g., two light chains and two heavy chains). In some embodiments, the antibody or antigen-binding fragment thereof comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:402 or 408, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:403 or 409, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:404 or 410; and/or wherein the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:405 or 411, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:406 or 412, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:407 or 413.


In some embodiments, the antibody or antigen-binding fragment comprises alight chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:402, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:403, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:404; and/or wherein the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:405, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:406, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:407. In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:402, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:403, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:404; and the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:405, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:406, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:407.


In some embodiments, the antibody or antigen-binding fragment comprises alight chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:432, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:433, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:434; and/or wherein the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:435, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:436, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:437. In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:432, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:433, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:434; and the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:435, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:436, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:437.


In some embodiments, the antibody or antigen-binding fragment comprises alight chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:408, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:409, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:410; and/or wherein the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:411, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:412, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:413. In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:408, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:409, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:410; and the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:411, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:412, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:413.


In some embodiments, the antibody or antigen-binding fragment comprises alight chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:438, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:439, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:440; and/or wherein the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:441, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:442, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:443. In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region and a heavy chain variable region, wherein the light chain variable region comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:438, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:439, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:440; and the heavy chain variable region comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:441, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:442, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:443.


In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO:232; and/or comprises a heavy chain variable region comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 233. In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO:232; and comprises a heavy chain variable region comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 233. In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO:232; and/or a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:233. In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO:232; and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:233.


In some embodiments, the antibody or antigen-binding fragment thereof comprises a CDR-L1, a CDR-L2, and a CDR-L3 comprised within a VL domain comprising the amino acid sequence of SEQ ID NO: 321, and comprises a CDR-H1, a CDR-H2, and a CDR-H3 comprised within a VH domain comprising the amino acid sequence of SEQ ID NO: 323. In some embodiments, the antibody or antigen-binding fragment thereof comprises a CDR-L1, a CDR-L2, and a CDR-L3 comprised within a VL domain comprising the amino acid sequence of SEQ ID NO: 322, and comprises a CDR-H1, a CDR-H2, and a CDR-H3 comprised within a VH domain comprising the amino acid sequence of SEQ ID NO: 324.


In some embodiments, the antibody or antigen-binding fragment comprises alight chain variable region comprising the amino acid sequence selected from SEQ ID NOs:321 or 322; and/or a heavy chain variable region comprising the amino acid sequence selected from SEQ ID NOs:323 or 324. In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 321; and/or comprises a heavy chain variable region comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 323. In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 321; and comprises a heavy chain variable region comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 323. In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 322; and/or comprises a heavy chain variable region comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 324. In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 322; and comprises a heavy chain variable region comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 324. In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 322; and/or comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 324. In some embodiments, the antibody or antigen-binding fragment comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 322; and comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 324.


In some embodiments, the antibody or antigen-binding fragment thereof comprises a light chain comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 334; and/or comprises a heavy chain comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the antibody or antigen-binding fragment thereof comprises a light chain comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 334; and comprises a heavy chain comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the antibody or antigen-binding fragment thereof comprises a light chain comprising the amino acid sequence of SEQ ID NO: 334; and/or comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 421. In some embodiments, the antibody or antigen-binding fragment thereof comprises a light chain comprising the amino acid sequence of SEQ ID NO: 334; and comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 421.


In some embodiments, the antibody or antigen-binding fragment thereof comprises a light chain comprising the amino acid sequence selected from SEQ ID NOs:237-318; and/or a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:319 or 320. In some embodiments, the antibody or antigen-binding fragment thereof comprises a light chain comprising the amino acid sequence selected from SEQ ID NOs:327-341; and/or a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:366-380, 421, and 478. In some embodiments, the antibody or antigen-binding fragment thereof comprises a light chain comprising the amino acid sequence selected from SEQ ID NOs:327, 334, or 342-365; and/or a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:366 or 380-397. In some embodiments, the antibody or antigen-binding fragment thereof has an IgG1, IgG2, IgG3 or IgG4 isotype. In some embodiments, the antibody or antigen-binding fragment thereof has an IgG1 isotype comprising amino acid substitutions that enhance effector function as described herein.


In some embodiments, the CTLA4 binding domain comprises a light chain and a heavy chain of an antigen-binding arm of a bispecific antibody. In some embodiments of the bispecific antibody, the light chain comprises (i) CDR-L1 comprising the amino acid sequence of SEQ ID NO:402 or 408, (ii) CDR-L2 comprising the amino acid sequence of SEQ ID NO:403 or 409, and (iii) CDR-L3 comprising the amino acid sequence of SEQ ID NO:404 or 410; and/or wherein the heavy chain comprises (i) CDR-H1 comprising the amino acid sequence of SEQ ID NO:405 or 411, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO:406 or 412, and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO:407 or 413. In some embodiments of the bispecific antibody, the light chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:402, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:403, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:404; and the heavy chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:405, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:406, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:407. In some embodiments of the bispecific antibody, the light chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:432, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:433, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:434; and the heavy chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:435, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:436, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:437. In some embodiments of the bispecific antibody, the light chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:408, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:409, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:410; and the heavy chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:411, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:412, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:413. In some embodiments of the bispecific antibody, the light chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:438, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:439, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:440; and the heavy chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:441, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:442, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:443.


In some embodiments of the bispecific antibody, the light chain comprises a CDR-L1, a CDR-L2, and a CDR-L3 comprised within a VL domain comprising the amino acid sequence of SEQ ID NO: 321, and the heavy chain comprises a CDR-H1, a CDR-H2, and a CDR-H3 comprised within a VH domain comprising the amino acid sequence of SEQ ID NO: 323. In some embodiments of the bispecific antibody, the light chain comprises a CDR-L1, a CDR-L2, and a CDR-L3 comprised within a VL domain comprising the amino acid sequence of SEQ ID NO: 322, and the heavy chain comprises a CDR-H1, a CDR-H2, and a CDR-H3 comprised within a VH domain comprising the amino acid sequence of SEQ ID NO: 324.


In some embodiments of the bispecific antibody, the light chain comprises an 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 232; and/or the heavy chain comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 233. In some embodiments of the bispecific antibody, the light chain comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 321; and/or the heavy chain comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 323. In some embodiments of the bispecific antibody, the light chain comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 322; and/or the heavy chain comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 324.


In some embodiments of the bispecific antibody, the light chain comprises the amino acid sequence of SEQ ID NO:232; and/or the heavy chain comprises the amino acid sequence of SEQ ID NO:233. In some embodiments of the bispecific antibody, the light chain comprises the amino acid sequence selected from SEQ ID NOs:321 or 322; and/or the heavy chain comprises the amino acid sequence selected from SEQ ID NOs:323 or 324. In some embodiments of the bispecific antibody, the light chain comprises the amino acid sequence selected from SEQ ID NOs:237-318; and/or the heavy chain comprises the amino acid sequence selected from SEQ ID NOs:319 or 320.


In some embodiments of the bispecific antibody, the light chain comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to an amino acid sequence selected from the group consisting of SEQ ID NOs: 327-341; and/or the heavy chain comprises an 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to an amino acid sequence selected from the group consisting of SEQ ID NOs: 366-380, 421, and 478. In some embodiments of the bispecific antibody, the light chain comprises the amino acid sequence selected from SEQ ID NOs:327-341; and/or the heavy chain comprises the amino acid sequence selected from SEQ ID NOs:366-380, 421, and 478. In some embodiments of the bispecific antibody, the light chain comprises the amino acid sequence selected from SEQ ID NOs:327, 334, or 342-365; and/or the heavy chain comprises the amino acid sequence selected from SEQ ID NOs:366,380-397, 421, and 478. In some embodiments of the bispecific antibody, the light chain comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 334; and/or the heavy chain comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments of the bispecific antibody, the light chain comprises the amino acid sequence of SEQ ID NO: 334, and the heavy chain comprises the amino acid sequence of SEQ ID NO: 421. In some embodiments of the bispecific antibody, the CTLA4 is a human CTLA4. In some embodiments of the bispecific antibody, the CTLA4 is a murine CTLA4. In some embodiments, the bispecific antibody is a murine antibody. In some embodiments, the bispecific antibody is a humanized antibody, a chimeric antibody, or a human antibody. In some embodiments, the bispecific antibody has an IgG1, IgG2, IgG3 or IgG4 isotype. In some embodiments, the bispecific antibody has an IgG1 isotype comprising amino acid substitutions that enhance effector function as described herein.


In some embodiments, the CTLA4 binding domain comprises a first chain and a second chain that binds to CTLA4, such as part of a ligand-binding domain for use in a chimeric receptor. In some embodiments of the chimeric receptor, the first chain is a light chain variable domain. In some embodiments, the second chain is a heavy chain variable domain. In some embodiments of the chimeric receptor, the first chain comprises (i) CDR-L1 comprising the amino acid sequence of SEQ ID NO:402 or 408, (ii) CDR-L2 comprising the amino acid sequence of SEQ ID NO:403 or 409, and (iii) CDR-L3 comprising the amino acid sequence of SEQ ID NO:404 or 410; and/or wherein the second chain comprises (i) CDR-H1 comprising the amino acid sequence of SEQ ID NO:405 or 411, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO:406 or 412, and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO:407 or 413. In some embodiments of the chimeric receptor, the first chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:402, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:403, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:404; and the second chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:405, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:406, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:407. In some embodiments of the chimeric receptor, the first chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:432, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:433, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:434; and the second chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:435, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:436, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:437. In some embodiments of the chimeric receptor, the first chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:408, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:409, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:410; and the second chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:411, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:412, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:413. In some embodiments of the chimeric receptor, the first chain comprises (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO:438, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO:439, and (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO:440; and the second chain comprises (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO:441, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO:442, and (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO:443.


In some embodiments of the chimeric receptor, the first chain comprises a CDR-L1, a CDR-L2, and a CDR-L3 comprised within a VL domain comprising the amino acid sequence of SEQ ID NO: 321, and the second chain comprises a CDR-H1, a CDR-H2, and a CDR-H3 comprised within a VH domain comprising the amino acid sequence of SEQ ID NO: 323. In some embodiments of the chimeric receptor, the first chain comprises a CDR-L1, a CDR-L2, and a CDR-L3 comprised within a VL domain comprising the amino acid sequence of SEQ ID NO: 322, and the second chain comprises a CDR-H1, a CDR-H2, and a CDR-H3 comprised within a VH domain comprising the amino acid sequence of SEQ ID NO: 324.


In some embodiments of the chimeric receptor, the first chain comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 232; and/or the second chain comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 233. In some embodiments of the chimeric receptor, the first chain comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 321; and/or the second chain comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 323. In some embodiments of the chimeric receptor, the first chain comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 322; and/or the second chain comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 324. In some embodiments of the chimeric receptor, the first chain comprises the amino acid sequence of SEQ ID NO:232; and/or the second chain comprises the amino acid sequence of SEQ ID NO:233. In some embodiments of the chimeric receptor, the first chain comprises the amino acid sequence selected from SEQ ID NOs:321 or 322; and/or the second chain comprises the amino acid sequence selected from SEQ ID NOs:323 or 324. In some embodiments of the chimeric receptor, the first chain comprises the amino acid sequence of SEQ ID NO: 322, and the second chain comprises the amino acid sequence of SEQ ID NO: 324.


Masking Peptides


A CTLA4 binding domain masking peptide (also referred to as a “masking peptide”) as provided herein refers to a peptide capable of binding to, or otherwise exhibiting an affinity for, a CTLA4 binding domain. When bound to the CTLA4 binding domain, the masking peptide blocks, occludes, inhibits (e.g. decreases) or otherwise prevents (e.g., masks) the activity or binding of the CTLA4 binding domain to its cognate receptor or protein (i.e., CTLA4). Methods for determining the extent of binding of a CTLA4 binding domain to a CTLA4 protein are well known in the art.


In embodiments, the masking peptide has a length of at least 4 amino acids. In some embodiments, the masking peptide is a linear peptide. In some embodiments, the linear peptide is a 4-mer to 24-mer. In embodiments, the masking peptide is a cyclic peptide. In embodiments, the cyclic peptide is a 3-mer to 12-mer, as defined by the number of amino acids between the 2 cysteines. In embodiments, the cyclic peptide is a 3-mer to 20-mer. Where the masking peptide is a cyclized peptide, a cyclized peptide is formed by a di-sulfide bond connecting two cysteine amino acid residues. In some embodiments, the cysteine amino acid residues are terminal cysteines (i.e., are located at or near the N-terminus and/or the C-terminus of the masking peptide). In embodiments, the di-sulfide bond connects an N-terminal cysteine with a C-terminal cysteine.


In some embodiments, the masking peptide is linked to the N-terminus of the light chain or the heavy chain of the anti-CTLA4 antibody or antigen-binding fragment thereof. In some embodiments, the masking peptide is linked to the N-terminus of the light chain variable region or the heavy chain variable region of the anti-CTLA4 antibody or antigen-binding fragment thereof. In some embodiments, the masking peptide is linked to the C-terminus of the light chain or the heavy chain of the anti-CTLA4 antibody or antigen-binding fragment thereof. In some embodiments, the masking peptide is linked to the C-terminus of the light chain variable region or the heavy chain variable region of the anti-CTLA4 antibody or antigen-binding fragment thereof.


In some embodiments, the masking peptide is linked to the N-terminus of the light chain or the heavy chain of the anti-CTLA4 antibody or antigen-binding fragment thereof via a linker comprising a cleavable peptide. In some embodiments, the masking peptide is linked to the N-terminus of the light chain of the anti-CTLA4 antibody or antigen-binding fragment thereof via a linker comprising a cleavable peptide. In some embodiments, the masking peptide is linked to the N-terminus of the light chain variable region or the heavy chain variable region of the anti-CTLA4 antibody or antigen-binding fragment thereof via a linker comprising a cleavable peptide. In some embodiments, the masking peptide is linked to the N-terminus of the light chain variable region of the anti-CTLA4 antibody or antigen-binding fragment thereof via a linker comprising a cleavable peptide. In some embodiments, the masking peptide is linked to the C-terminus of the light chain or the heavy chain of the anti-CTLA4 antibody or antigen-binding fragment thereof via a linker comprising a cleavable peptide. In some embodiments, the masking peptide is linked to the C-terminus of the light chain variable region or the heavy chain variable region of the anti-CTLA4 antibody or antigen-binding fragment thereof via a linker comprising a cleavable peptide.


In some embodiments, the masking peptide comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence selected from SEQ ID NOs:1-46. Thus, in embodiments, the masking peptide comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of CNLIVEGHC (SEQ ID NO:1), MQTRCKEYPRWCEHWL (SEQ ID NO:2), CKHAPYALC (SEQ ID NO:3), CPFPAKILC (SEQ ID NO:4), CPGKGLPSC (SEQ ID NO:5), NWLGEWLPPGKV (SEQ ID NO:6), QFIECPNFPRQCPGKN (SEQ ID NO:7), VRQQCSLNPGRCPYLV (SEQ ID NO:8), VWQECHTAPQLCPGKI (SEQ ID NO:9), DSYTCRGPTWMCAGNM (SEQ ID NO:10), FNHDCSGHWMRCLDQQ (SEQ ID NO:11), NKSPCRPKMVACYGIL (SEQ ID NO:12), PTPQCWNQYYECWIPS (SEQ ID NO:13), SQKCPWTKETCMHYM (SEQ ID NO:14), WHLSMYPKPPAE (SEQ ID NO:15), WHTDGFYTRLPA (SEQ ID NO:16), CIHAPYAKC (SEQ ID NO:17), CPAKIGQEC (SEQ ID NO:18), CPFPALELC (SEQ ID NO:19), CTKPAKALC (SEQ ID NO:20), DTATCYTTTGWCEGMV (SEQ ID NO:21), NSDNCGPAKSTCMYND (SEQ ID NO:22), PPGKCTQPHRCPPLN (SEQ ID NO:23), DDPVCWDSNPTCQTIA (SEQ ID NO:24), ISDQCSVLFLSCNTRV (SEQ ID NO:25), ACHFPHPEGC (SEQ ID NO:26), CLPPFPTKC (SEQ ID NO:27), CPDHVFPKC (SEQ ID NO:28), CWLPKPDMC (SEQ ID NO:29), CWSWPSKAC (SEQ ID NO:30), CYPFGKYEC (SEQ ID NO:31), ALTPAKWLPADD (SEQ ID NO:32), DDKECDWMHFACTGPQ (SEQ ID NO:33), DEMKCAWSLEMCVRTS (SEQ ID NO:34), DPILCPNTRMSCDNQT (SEQ ID NO:35), GNALYDSPGTML (SEQ ID NO:36), KNYECREVMPPCEPNT (SEQ ID NO:37), NSYTSPYWLPDS (SEQ ID NO:38), SLTPPYWIPREW (SEQ ID NO:39), SPLTPHDRPSFL (SEQ ID NO:40), TADVFSSSRYTR (SEQ ID NO:41), TDLQCPPSSPICQIEH (SEQ ID NO:42), TKCHCDGNCVMCYQMQ (SEQ ID NO:43), TLAYETPLLWLP (SEQ ID NO:44), TNWHCNNDGSSCNVRA (SEQ ID NO:45), or CNLIVQGHC (SEQ ID NO:46).


In some embodiments, the masking peptide comprises an amino acid sequence having about 90% homology to the amino acid sequence selected from SEQ ID NOs:1-46. For example, the masking peptide comprises an amino acid sequence having about 90% homology to the amino acid sequence of SEQ ID NO:1.


1 In some embodiments, the masking peptide comprises an amino acid sequence having about 80% homology to the amino acid sequence selected from SEQ ID NOs:1-46. For example, the masking peptide comprises an amino acid sequence having about 80% homology to the amino acid sequence of SEQ ID NO:1.


In some embodiments, the masking peptide comprises an amino acid sequence having about 70% homology to the amino acid sequence selected from SEQ ID NOs:1-46. For example, the masking peptide comprises an amino acid sequence having about 70% homology to the amino acid sequence of SEQ ID NO:1.


In some embodiments, the masking peptide amino acid sequence is an amino acid sequence selected from SEQ ID NOs:1-46. For example, the masking peptide amino acid sequence is the amino acid sequence of SEQ ID NO:1.


In some embodiments, the masking peptide comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 5. In some embodiments, the masking peptide comprises the amino acid sequence of SEQ ID NO: 5.


In some embodiments, the masking peptide comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 19. In some embodiments, the masking peptide comprises the amino acid sequence of SEQ ID NO: 19.


In some embodiments, at least one amino acid but no more than 20 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, at least one amino acid but no more than 30 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, at least one amino acid but no more than 40 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, at least one amino acid but no more than 50 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is alanine (A) or glycine-alanine (GA). In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is a detectable tag. In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is YPYDVPDYA (SEQ ID NO:398), DYKDDDDK (SEQ ID NO:399), EQKLISEEDL (SEQ ID NO:400), or GLNDIFEAQKIEWHE (SEQ ID NO:401). In some embodiments, at least one amino acid but no more than 50 amino acids is directly linked to the N-terminus of a masking peptide comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-46. In some embodiments, at least one amino acid but no more than 50 amino acids is directly linked to the N-terminus of a masking peptide selected from the group consisting of SEQ ID NOs: 1-46. In some embodiments, at least one amino acid but no more than 50 amino acids is directly linked to the N-terminus of a masking peptide selected from the group consisting of SEQ ID NOs: 1-46, wherein the at least one amino acid is alanine (A) or glycine-alanine (GA). In some embodiments, at least one amino acid but no more than 50 amino acids is directly linked to the N-terminus of a masking peptide selected from the group consisting of SEQ ID NOs: 1-46, wherein the at least one amino acid is alanine (A).


Linkers


In some embodiments, the activatable masked anti-CTLA4 binding protein comprises a linker, e.g., a spacer linker. In some embodiments, the activatable masked anti-CTLA4 binding protein comprises more than one linker, e.g., a first spacer linker and a second spacer linker. In some embodiments, the activatable masked anti-CTLA4 binding protein comprises a linker comprising a cleavable peptide. A “linker comprising a cleavable peptide” as used herein refers to an enzymatically cleavable linker covalently bonded to a CTLA4 binding domain and covalently bonded to a masking peptide. In some embodiments the linker comprising a cleavable peptide is recombinantly expressed. In some embodiments, the linker comprising a cleavable peptide is a linker formed by reacting a functional (reactive) group attached to the linker with a masking peptide using, for example, conjugate chemistry. In some embodiments, the linker comprising a cleavable peptide is a linker formed by reacting a functional (reactive) group attached to the linker with a CTLA4 binding domain using, for example, conjugate chemistry. In some embodiments, the linker comprising a cleavable peptide connects the masking peptide to the N-terminus of the CTLA4 binding domain (e.g., N-terminus of a light chain). In some embodiments, the linker comprising a cleavable peptide connects the masking peptide to the C-terminus of the CTLA4 binding domain (e.g., C-terminus of a light chain).


In some embodiments, the linker comprising a cleavable peptide is fused with a masking peptide, such as when a nucleic acid encodes the linker and masking peptide and is expressed from a cell as an amino acid sequence encoding the linker and masking peptide. In some embodiments, the linker comprising a cleavable peptide is fused with a CTLA4 binding domain such as when a nucleic acid encodes the linker and CTLA4 binding domain and is expressed from a cell as an amino acid sequence encoding the linker and CTLA4 binding domain. In some embodiments, the linker comprising a cleavable peptide connects the masking peptide to the N-terminus of the CTLA4 binding domain (e.g., N-terminus of a light chain). In some embodiments, the linker comprising a cleavable peptide connects the masking peptide to the C-terminus of the CTLA4 binding domain (e.g., C-terminus of a light chain).


In some embodiments, the linker comprising a cleavable peptide is a flexible linker including one or more glycine residues, serine residues, alanine residues, histidine residues, and/or proline residues. In some embodiments, the linker comprising a cleavable peptide contains a spacer linker directly linked to the N-terminus and/or the C-terminus of the cleavable peptide. In some embodiments, the spacer linker comprises one or more glycine residues, serine residues, alanine residues, histidine residues, and/or proline residues. In some embodiments, the linker comprising a cleavable peptide comprises a spacer linker and a cleavable peptide. In some embodiments, the linker comprising a cleavable peptide comprises a first spacer linker, a cleavable peptide, and a second spacer linker. Accordingly, in some embodiments, the masked CTLA4 binding protein (e.g., masked anti-CTLA4 antibody or antigen-binding fragment thereof) comprises a linker comprising a cleavable peptide comprising a spacer linker (e.g., a first spacer linker, or spacer linker 1) linked to the N-terminus of the cleavable peptide, and a spacer linker (e.g., a second spacer linker, or spacer linker 2) linked to the C-terminus of the cleavable peptide, wherein each spacer linker comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:89-112 and 415-420. In some embodiments, the C-terminus of the linker comprising a cleavable peptide is linked to the light chain or the light chain variable domain of the anti-CTLA4 antibody or antigen-binding fragment thereof, and the N-terminus of the linker comprising a cleavable peptide is linked to the masking peptide. In some embodiments, the C-terminus of the linker comprising a cleavable peptide is linked to the heavy chain or the heavy chain variable domain of the anti-CTLA4 antibody or antigen-binding fragment thereof, and the N-terminus of the linker comprising a cleavable peptide is linked to the masking peptide. In some embodiments, the N-terminus of the linker comprising a cleavable peptide is linked to the light chain or the light chain variable domain of the anti-CTLA4 antibody or antigen-binding fragment thereof, and the C-terminus of the linker comprising a cleavable peptide is linked to the masking peptide. In some embodiments, the N-terminus of the linker comprising a cleavable peptide is linked to the heavy chain or the heavy chain variable domain of the anti-CTLA4 antibody or antigen-binding fragment thereof, and the C-terminus of the linker comprising a cleavable peptide is linked to the masking peptide.


In some embodiments, the spacer linker comprises an amino acid sequence is selected from SEQ ID NOs:89-112 and 415-420. In some embodiments, the spacer linker is directly linked to the N-terminus the cleavable peptide and comprises an amino acid sequence selected from SEQ ID NOs:89-100. In some embodiments, the spacer linker is directly linked to the C-terminus the cleavable peptide and comprises an amino acid sequence is selected from SEQ ID NOs:101-112 and 415-420. In some embodiments, a masking peptide described herein is directly linked to the N-terminus of the spacer linker. Thus, in some embodiments, the linker comprising a cleavable peptide comprises in the N-terminus to C-terminus direction: 1) a spacer linker (e.g., a spacer linker comprising an amino acid sequence selected from the amino acid sequences of SEQ ID NOs:89-112 and 415-420), 2) a cleavable peptide such as one described herein (e.g., a cleavable peptide comprising an amino acid sequence selected from the amino acid sequences of SEQ ID NOs:47-88, 464-469, and 479-508), and 3) a spacer linker (e.g., a spacer linker comprising an amino acid sequence selected from the amino acid sequences of SEQ ID NOs:89-112 and 415-420).


In some embodiments, the linker comprising a cleavable peptide comprises in the N-terminus to C-terminus direction: 1) a spacer linker comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 89-112 and 415-420; 2) a cleavable peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 47-88, 464-469, and 479-508; and 3) a spacer linker comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 89-112 and 415-420.


In some embodiments, the linker comprising a cleavable peptide comprises in the N-terminus to C-terminus direction: 1) a spacer linker comprising the amino acid sequence of SEQ ID NO: 420; 2) a cleavable peptide comprising the amino acid sequence of SEQ ID NO: 50; and 3) a spacer linker comprising the amino acid sequence of SEQ ID NO: 102.


In some embodiments, the linker comprising a cleavable peptide comprises in the N-terminus to C-terminus direction: 1) a spacer linker comprising the amino acid sequence of SEQ ID NO: 96; 2) a cleavable peptide comprising the amino acid sequence of SEQ ID NO: 86; and 3) a spacer linker comprising the amino acid sequence of SEQ ID NO: 102.


In some embodiments, the linker comprising a cleavable peptide comprises in the N-terminus to C-terminus direction: 1) a spacer linker comprising the amino acid sequence of SEQ ID NO: 415; 2) a cleavable peptide comprising the amino acid sequence of SEQ ID NO: 86; and 3) a spacer linker comprising the amino acid sequence of SEQ ID NO: 102.


In some embodiments, the linker comprising a cleavable peptide comprises in the N-terminus to C-terminus direction: 1) a spacer linker comprising the amino acid sequence of SEQ ID NO: 416; 2) a cleavable peptide comprising the amino acid sequence of SEQ ID NO: 47; and 3) a spacer linker comprising the amino acid sequence of SEQ ID NO: 102.


In some embodiments, the linker comprising a cleavable peptide comprises in the N-terminus to C-terminus direction: 1) a spacer linker comprising the amino acid sequence of SEQ ID NO: 417; 2) a cleavable peptide comprising the amino acid sequence of SEQ ID NO: 57; and 3) a spacer linker comprising the amino acid sequence of SEQ ID NO: 102.


In some embodiments, the linker comprising a cleavable peptide comprises in the N-terminus to C-terminus direction: 1) a spacer linker comprising the amino acid sequence of SEQ ID NO: 418; 2) a cleavable peptide comprising the amino acid sequence of SEQ ID NO: 48; and 3) a spacer linker comprising the amino acid sequence of SEQ ID NO: 102.


In some embodiments, the linker comprising a cleavable peptide comprises in the N-terminus to C-terminus direction: 1) a spacer linker comprising the amino acid sequence of SEQ ID NO: 417; 2) a cleavable peptide comprising the amino acid sequence of SEQ ID NO: 72; and 3) a spacer linker comprising the amino acid sequence of SEQ ID NO: 102.


In some embodiments, the linker comprising a cleavable peptide comprises in the N-terminus to C-terminus direction: 1) a spacer linker comprising the amino acid sequence of SEQ ID NO: 418; 2) a cleavable peptide comprising the amino acid sequence of SEQ ID NO: 51; and 3) a spacer linker comprising the amino acid sequence of SEQ ID NO: 102.


In some embodiments, the linker comprising a cleavable peptide comprises in the N-terminus to C-terminus direction: 1) a spacer linker comprising the amino acid sequence of SEQ ID NO: 419; 2) a cleavable peptide comprising the amino acid sequence of SEQ ID NO: 54; and 3) a spacer linker comprising the amino acid sequence of SEQ ID NO: 102.


In some embodiments, the linker comprising a cleavable peptide comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% homology to an amino acid sequence selected from the group consisting of SEQ ID NOs: 454-462. In some embodiments, the linker comprising a cleavable peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 454-462. In some embodiments, the linker comprising a cleavable peptide comprises the amino acid sequence of SEQ ID NO: 454. In some embodiments, the linker comprising a cleavable peptide comprises the amino acid sequence of SEQ ID NO: 455.


Linkers can be conjugated to the masking peptide and/or the CTLA4 binding protein by a variety of methods well known in the art. The terms “conjugate” and “conjugate chemistry” refer to reactions with known reactive groups which proceed under relatively mild conditions. These include, but are not limited to nucleophilic substitutions (e.g., reactions of amines and alcohols with acyl halides, active esters), electrophilic substitutions (e.g., enamine reactions) and additions to carbon-carbon and carbon-heteroatom multiple bonds (e.g., Michael reaction, Diels-Alder addition). These and other useful reactions are discussed in, for example, March, Advanced Organic Chemistry, 3rd Ed., John Wiley & Sons, New York, 1985; Hermanson, Bioconjugate Techniques, Academic Press, San Diego, 1996; and Feeney et al., Modification of Proteins; Advances in Chemistry Series, Vol. 198, American Chemical Society, Washington, D.C., 1982.


Useful reactive functional groups used for conjugate chemistries herein include, for example: (a) carboxyl groups and various derivatives thereof including, but not limited to, N-hydroxysuccinimide esters, N-hydroxybenztriazole esters, acid halides, acyl imidazoles, thioesters, p-nitrophenyl esters, alkyl, alkenyl, alkynyl and aromatic esters; (b) hydroxyl groups which can be converted to esters, ethers, aldehydes, etc. (c) haloalkyl groups wherein the halide can be later displaced with a nucleophilic group such as, for example, an amine, a carboxylate anion, thiol anion, carbanion, or an alkoxide ion, thereby resulting in the covalent attachment of a new group at the site of the halogen atom; (d) dienophile groups which are capable of participating in Diels-Alder reactions such as, for example, maleimido groups; (e) aldehyde or ketone groups such that subsequent derivatization is possible via formation of carbonyl derivatives such as, for example, imines, hydrazones, semicarbazones or oximes, or via such mechanisms as Grignard addition or alkyllithium addition; (f) sulfonyl halide groups for subsequent reaction with amines, for example, to form sulfonamides; (g) thiol groups, which can be converted to disulfides, reacted with acyl halides, or bonded to metals such as gold; (h) amine or sulfhydryl groups, which can be, for example, acylated, alkylated or oxidized; (i) alkenes, which can undergo, for example, cycloadditions, acylation, Michael addition, etc; (j) epoxides, which can react with, for example, amines and hydroxyl compounds; (k) phosphoramidites and other standard functional groups useful in nucleic acid synthesis; (i) metal silicon oxide bonding; and (1) metal bonding to reactive phosphorus groups (e.g. phosphines) to form, for example, phosphate diester bonds.


The reactive functional groups can be chosen such that they do not participate in, or interfere with, the chemical stability of the compositions described herein. Alternatively, a reactive functional group can be protected from participating in the crosslinking reaction by the presence of a protecting group.


In some embodiments, linkers can be engineered to be fused to the masking peptide and/or the CTLA4 binding protein by a variety of methods well known in the art. For example, a nucleic acid can engineered to encode a linker with a masking peptide and/or a CTLA4 binding protein to produce a fusion protein when recombinantly expressed from a host cell.


Cleavable Peptides


The masked CTLA4 binding protein (e.g., masked anti-CTLA4 antibody or antigen-binding fragment thereof) provided herein, in some embodiments, comprises a cleavable peptide. In some embodiments, the cleavable peptide is contained within a linker comprising a cleavable peptide. The linker comprising a cleavable peptide provided herein may include a protease cleavage site within the cleavable peptide. A “cleavage site” as used herein, refers to a recognizable site for cleavage of a portion of a linker (e.g., linker comprising a cleavable peptide as described above) found in a CTLA4 binding protein described herein. Thus, a cleavage site may be found in the sequence of a cleavable peptide as described herein, including embodiments thereof. In some embodiments, the cleavage site is an amino acid sequence that is recognized and cleaved by a cleaving agent. Exemplary cleaving agents include proteins, enzymes, DNAzymes, RNAzymes, metals, acids, and bases. The cleavable peptide can be any peptide that includes a protease cleavage site. Exemplary cleavable peptides are shown in Table 1.









TABLE 1





Representative cleavable peptides


Exemplary cleavable peptides


















MPYDLYHP
(SEQ ID NO: 47)







GGIGQLTA
(SEQ ID NO: 48)







DLGRFQTF
(SEQ ID NO: 49)







DSGGFMLT
(SEQ ID NO: 50)







TSVLMAAP
(SEQ ID NO: 51)







TSEFVFAPDQ
(SEQ ID NO: 52)







KLVLPVLP
(SEQ ID NO: 53)







KPILFFRL
(SEQ ID NO: 54)







ANQLKG
(SEQ ID NO: 55)







QSQLKE
(SEQ ID NO: 56)







HEQLTV
(SEQ ID NO: 57)







PANLVAPDP
(SEQ ID NO: 58)







PAPGVYPGP
(SEQ ID NO: 59)







APAGLIVPYN
(SEQ ID NO: 60)







PQALVA
(SEQ ID NO: 61)







VGNLNF
(SEQ ID NO: 62)







VANLLYE
(SEQ ID NO: 63)







VYNLMD
(SEQ ID NO: 64)







TFNIKQ
(SEQ ID NO: 65)







DLWKLLP
(SEQ ID NO: 66)







PGSTKRA
(SEQ ID NO: 67)







QQYRALKS
(SEQ ID NO: 68)







YVPRAVL
(SEQ ID NO: 69)







GVNKWPT
(SEQ ID NO: 70)







LAQAVRSS
(SEQ ID NO: 71)







RAAAVKSP
(SEQ ID NO: 72)







DLLAVVAAS
(SEQ ID NO: 73)







VQTVTWPD
(SEQ ID NO: 74)







AIPMSIPP
(SEQ ID NO: 75)







GYEVHHQK
(SEQ ID NO: 76)







VHHQKLVF
(SEQ ID NO: 77)







IRRVSYSF
(SEQ ID NO: 78)







MPYDLYHPILFFRL
(SEQ ID NO: 79)







GGIGQLTSVLMAAP
(SEQ ID NO: 80)







DSGGFMLTLVLPVLP
(SEQ ID NO: 81)







TSEFVFAPDLGRFQTF
(SEQ ID NO: 82)







TSTSGRSANPR
(SEQ ID NO: 83)







TSTSGRSANPG
(SEQ ID NO: 84)







TSTSGRSANPH
(SEQ ID NO: 85)







VPLSLY
(SEQ ID NO: 86)







TSASGASASAA
(SEQ ID NO: 87)







PSSPGGGSSP
(SEQ ID NO: 88)







ISSGLLSGRSDNH
(SEQ ID NO: 464)







AVGLLAPPGGLSGRSDNH
(SEQ ID NO: 465)







VPLSLYSG
(SEQ ID NO: 466)







RQARVVG
(SEQ ID NO: 467)







LSGRSNAMPYDLYHP
(SEQ ID NO: 468)







MPYDLYHPRQARVVG
(SEQ ID NO: 469)







IPESLRAG
(SEQ ID NO: 479)







IPVSLRSG
(SEQ ID NO: 480)







IYDQKT
(SEQ ID NO: 481)







AHNYKT
(SEQ ID NO: 482)







MMDQAN
(SEQ ID NO: 483)







MLGEFVSE
(SEQ ID NO: 484)







GLVALRGA
(SEQ ID NO: 485)







KEHKYKAE
(SEQ ID NO: 486)







LAQAVRSS
(SEQ ID NO: 487)







LGGSGRSNAQVRLE
(SEQ ID NO: 488)







LGGSGRKASLSLE
(SEQ ID NO: 489)







SGRIGFLRTA
(SEQ ID NO: 490)







SGAIGFLRTA
(SEQ ID NO: 491)







RPARSGRSAGGSVA
(SEQ ID NO: 492)







VTGRGDSPASS
(SEQ ID NO: 493)







PRFKIIGG
(SEQ ID NO: 494)







LSGRIGFLRTA
(SEQ ID NO: 495)







LSGRSNAGGIGQLTA
(SEQ ID NO: 496)







LSGRSNAVPLSLY
(SEQ ID NO: 497)







LSGRSNADSGGFMLT
(SEQ ID NO: 498)







LSGRSNAHEQLTA
(SEQ ID NO: 499)







LSGRSNARAAAVKSP
(SEQ ID NO: 500)







LSGRSNATSVLMAAP
(SEQ ID NO: 501)







VPLSLYLSGRSNA
(SEQ ID NO: 502)







DSGGFMLTLSGRSNA
(SEQ ID NO: 503)







GGIGQLTALSGRSNA
(SEQ ID NO: 504)







MPYDLYHPLSGRSNA
(SEQ ID NO: 505)







HEQLTVLSGRSNA
(SEQ ID NO: 506)







RAAAVKSPLSGRSNA
(SEQ ID NO: 507)







TSVLMAAPLSGRSNA
(SEQ ID NO: 508)










Accordingly, in some embodiments, the cleavable peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 47-88, 464-469, and 479-508. In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 50. In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 86. In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 47. In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 57. In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 48. In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 72. In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 51. In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 54.


In some embodiments, the protease cleavage site is a tumor-associated protease cleavage site. A “tumor-associated protease cleavage site” as provided herein is an amino acid sequence recognized by a protease, whose expression is specific for a tumor cell or tumor cell environment thereof. In some embodiments, the protease cleavage site is a cleavage site recognized by one or more enzyme selected from the group consisting of: ABHD12, ADAM12, ABHD12B, ABHD13, ABHD17A, ADAM19, ADAM20, ADAM21, ADAM28, ADAM30, ADAM33, ADAM8, ABHD17A, ADAMDEC1, ADAMTS1, ADAMTS10, ADAMTS12, ADAMTS13, ADAMTS14, ADAMTS15, ADAMTS16, ADAMTS17, ADAMTS18, ADAMTS19, ADAMTS2, ADAMTS20, ADAMTS3, ADAMTS4, ABHD17B, ADAMTS5, ADAMTS6, ADAMTS7, ADAMTS8, ADAMTS9, ADAMTSL1, ADAMTSL2, ADAMTSL3, ABHD17C, ADAMTSL5, ASTL, BMP1, CELA1, CELA2A, CELA2B, CELA3A, CELA3B, ADAM10, ADAM15, ADAM17, ADAM9, ADAMTS4, CTSE, CTSF, ADAMTSL4, CMA1, CTRB1, CTRC, CTSO, CTR1, CTSA, CTSW, CTSB, CTSC, CTSD, ESP1, CTSG, CTSH, GZMA, GZMB, GZMH, CTSK, GZMM, CTSL, CTSS, CTSV, CTSZ, HTRA4, KLK10, KLK11, KLK13, KLK14, KLK2, KLK4, DPP4, KLK6, KLK7, KLKB1, ECE1, ECE2, ECEL1, MASP2, MEP1A, MEP1B, ELANE, FAP, GZMA, MMP11, GZMK, HGFAC, HPN, HTRA1, MMP11, MMP16, MMP17, MMP19, HTRA2, MMP20, MMP21, HTRA3, HTRA4, KEL, MMP23B, MMP24, MMP25, MMP26, MMP27, MMP28, KLK5, MMP3, MMP7, MMP8, MMP9, LGMN, LNPEP, MASP1, PAPPA, PAPPA2, PCSK1, NAPSA, PCSK5, PCSK6, MME, MMP1, MMP10, PLAT, PLAU, PLG, PRSS1, PRSS12, PRSS2, PRSS21, PRSS3, PRSS33, PRSS4, PRSS55, PRSS57, MMP12, PRSS8, PRSS9, PRTN3, MMP13, MMP14, ST14, TMPRSS10, TMPRSS11A, TMPRSS11D, TMPRSS11E, TMPRSS11F, TMPRSS12, TMPRSS13, MMP15, TMPRSS15, MMP2, TMPRSS2, TMPRSS3, TMPRSS4, TMPRSS5, TMPRSS6, TMPRSS7, TMPRSS9, NRDC, OVCH1, PAMR1, PCSK3, PHEX, TINAG, TPSAB1, TPSD1, and TPSG1. In some embodiments, the protease cleavage site is a cleavage site recognized by one or more enzyme selected from the group consisting of: ADAM17, HTRA1, PRSS1, FAP, GZMK, NAPSA, MMP1, MMP2, MMP9, MMP10, MMP7, MMP12, MMP28, ADAMTS9, HGFAC, and HTRA3.


In embodiments, the protease cleavage site is a matrix metalloprotease (MMP) cleavage site, a disintegrin and metalloprotease domain-containing (ADAM) metalloprotease cleavage site, a prostate specific antigen (PSA) protease cleavage site, a urokinase-type plasminogen activator (uPA) protease cleavage site, a membrane type serine protease 1 (MT-SP1) protease cleavage site, a matriptase protease cleavage site (ST14) or a legumain protease cleavage site. In embodiments, the matrix metalloprotease (MMP) cleavage site is a MMP9 cleavage site, a MMPI3 cleavage site or a MMP2 cleavage site. In embodiments, the disintegrin and metalloprotease domain-containing (ADAM) metalloprotease cleavage site is a ADAM9 metalloprotease cleavage site, a ADAM10 metalloprotease cleavage site or a ADAM17 metalloprotease cleavage site. Protease cleavage sites may be designated by a specific amino acid sequence.


In some embodiments, the cleavable peptide is cleaved by one or more enzyme selected from the group consisting of: ABHD12, ADAM12, ABHD12B, ABHD13, ABHD17A, ADAM19, ADAM20, ADAM21, ADAM28, ADAM30, ADAM33, ADAM8, ABHD17A, ADAMDEC1, ADAMTS1, ADAMTS10, ADAMTS12, ADAMTS13, ADAMTS14, ADAMTS15, ADAMTS16, ADAMTS17, ADAMTS18, ADAMTS19, ADAMTS2, ADAMTS20, ADAMTS3, ADAMTS4, ABHD17B, ADAMTS5, ADAMTS6, ADAMTS7, ADAMTS8, ADAMTS9, ADAMTSL1, ADAMTSL2, ADAMTSL3, ABHD17C, ADAMTSL5, ASTL, BMP1, CELA1, CELA2A, CELA2B, CELA3A, CELA3B, ADAM10, ADAM15, ADAM17, ADAM9, ADAMTS4, CTSE, CTSF, ADAMTSL4, CMA1, CTRB1, CTRC, CTSO, CTR1, CTSA, CTSW, CTSB, CTSC, CTSD, ESP1, CTSG, CTSH, GZMA, GZMB, GZMH, CTSK, GZMM, CTSL, CTSS, CTSV, CTSZ, HTRA4, KLK10, KLK11, KLK13, KLK14, KLK2, KLK4, DPP4, KLK6, KLK7, KLKB1, ECE1, ECE2, ECEL1, MASP2, MEP1A, MEP1B, ELANE, FAP, GZMA, MMP11, GZMK, HGFAC, HPN, HTRA1, MMP11, MMP16, MMP17, MMP19, HTRA2, MMP20, MMP21, HTRA3, HTRA4, KEL, MMP23B, MMP24, MMP25, MMP26, MMP27, MMP28, KLK5, MMP3, MMP7, MMP8, MMP9, LGMN, LNPEP, MASP1, PAPPA, PAPPA2, PCSK1, NAPSA, PCSK5, PCSK6, MME, MMP1, MMP10, PLAT, PLAU, PLG, PRSS1, PRSS12, PRSS2, PRSS21, PRSS3, PRSS33, PRSS4, PRSS55, PRSS57, MMP12, PRSS8, PRSS9, PRTN3, MMP13, MMP14, ST14, TMPRSS10, TMPRSS11A, TMPRSS11D, TMPRSS11E, TMPRSS11F, TMPRSS12, TMPRSS13, MMP15, TMPRSS15, MMP2, TMPRSS2, TMPRSS3, TMPRSS4, TMPRSS5, TMPRSS6, TMPRSS7, TMPRSS9, NRDC, OVCH1, PAMR1, PCSK3, PHEX, TINAG, TPSAB1, TPSD1, and TPSG1. In some embodiments, the cleavable peptide is cleaved by one or more enzyme selected from the group consisting of: ADAM17, HTRA1, PRSS1, FAP, GZMK, NAPSA, MMP1, MMP2, MMP9, MMP10, MMP7, MMP12, MMP28, ADAMTS9, HGFAC, and HTRA3.


In embodiments, the cleavable peptide is a 5-mer (i.e. peptide 5 amino acids in length), 6-mer (i.e. peptide 6 amino acids in length), 7-mer (i.e. peptide 7 amino acids in length), 8-mer (i.e. peptide 8 amino acids in length), 9-mer (i.e. peptide 9 amino acids in length), 10-mer (i.e. peptide 10 amino acids in length), 11-mer (i.e. peptide 11 amino acids in length), 12-mer (i.e. peptide 12 amino acids in length), or 13-mer (i.e. peptide 13 amino acids in length).


Thus, in some embodiments, a masking peptide and linker comprising a cleavable peptide comprises in the N-terminus to C-terminus direction: 1) a masking peptide (e.g., a masking peptide comprising an amino acid sequence selected from the amino acid sequence of SEQ ID NOs:1-46), 2) a spacer linker (e.g., a spacer linker comprising an amino acid sequence selected from the amino acid sequences of SEQ ID NOs:89-112 and 415-420), 3) a cleavable peptide such as one described herein (e.g., a cleavable peptide comprising an amino acid sequence selected from the amino acid sequences of SEQ ID NOs:47-88, 464-469, and 479-508), and 4) a spacer linker (e.g., a spacer linker comprising an amino acid sequence selected from the amino acid sequences of SEQ ID NOs:89-112 and 415-420). In some embodiments, at least one amino acid but no more than 20 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, at least one amino acid but no more than 30 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, at least one amino acid but no more than 40 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, at least one amino acid but no more than 50 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is alanine (A) or glycine-alanine (GA). In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is a detectable tag. In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is YPYDVPDYA (SEQ ID NO:398), DYKDDDDK (SEQ ID NO:399), EQKLISEEDL (SEQ ID NO:400), or GLNDIFEAQKIEWHE (SEQ ID NO:401).


In some embodiments, the activatable masked anti-CTLA4 binding protein described herein comprises a peptide comprising a masking peptide, a spacer linker and a cleavable peptide, wherein the peptide comprises an amino acid sequence selected from SEQ ID NOs:113-231. In some embodiments, the activatable masked anti-CTLA4 binding protein described herein comprises a peptide comprising a masking peptide, a spacer linker and a cleavable peptide, wherein the peptide comprises an amino acid sequence selected from SEQ ID NOs:113-193. In some embodiments, the activatable masked anti-CTLA4 binding protein described herein comprises a peptide comprising a masking peptide, a spacer linker and a cleavable peptide, wherein the peptide comprises an amino acid sequence selected from SEQ ID NOs:194-206. In some embodiments, the activatable masked anti-CTLA4 binding protein described herein comprises a peptide comprising a masking peptide, a spacer linker and a cleavable peptide, wherein the peptide comprises an amino acid sequence selected from SEQ ID NOs:207-231.


In some embodiments, the activatable masked anti-CTLA4 binding protein described herein comprises a peptide comprising a masking peptide, a first spacer linker, a cleavable peptide, and a second spacer linker, wherein the peptide comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to an amino acid sequence selected from the group consisting of SEQ ID NOs: 113-231, 444, 446-448, and 450-453. In some embodiments, the activatable masked anti-CTLA4 binding protein described herein comprises a peptide comprising a masking peptide, a first spacer linker, a cleavable peptide, and a second spacer linker, wherein the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 113-231, 444, 446-448, and 450-453. In some embodiments, the activatable masked anti-CTLA4 binding protein described herein comprises a peptide comprising a masking peptide, a first spacer linker, a cleavable peptide, and a second spacer linker, wherein the peptide comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to an amino acid sequence selected from the group consisting of SEQ ID NOs: 444, 446-448, and 450-453. In some embodiments, the activatable masked anti-CTLA4 binding protein described herein comprises a peptide comprising a masking peptide, a first spacer linker, a cleavable peptide, and a second spacer linker, wherein the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 444, 446-448, and 450-453.


Exemplary Masked CTLA4 Binding Proteins


The following describes certain exemplary embodiments of masked CTLA4 binding proteins containing certain features as described above. These embodiments are merely exemplary and are not to be construed as being limiting.


Provided herein, in some embodiments, is a masked antibody comprising a) an antibody or antigen-binding fragment thereof that binds to CTLA4 (e.g., human CTLA4), wherein the antibody or antigen-binding fragment thereof comprises a first chain and a second chain, and b) a masking peptide comprising an amino acid sequence selected from SEQ ID NOs:1-46, wherein the masking peptide is linked via a linker comprising a cleavable peptide to an amino-terminus or carboxy-terminus of the first chain or the second chain of the antibody or antigen-binding fragment thereof. In some embodiments, the antibody or antigen-binding fragment thereof that binds to CTLA4 is any anti-CTLA4 antibody or antigen-binding fragment thereof described herein. In some embodiments, the antibody or antigen-binding fragment thereof comprises two first chains and two second chains. In some embodiments, the first chain is a light chain and the second chain is a heavy chain. In some embodiments, the first chain is a light chain variable domain and the second chain is a heavy chain variable domain. In some embodiments, the cleavable peptide comprises an amino acid sequence selected from SEQ ID NOs:47-88, 464-469, and 479-508. In some embodiments, a spacer linker is directly linked to the N-terminus and/or the C-terminus of the cleavable peptide. In some embodiments, the spacer linker comprises an amino acid sequence selected from SEQ ID NOs:89-112 and 415-420. In some embodiments, at least one amino acid but no more than 20, 30, 40, or 50 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, the at least one amino acid is alanine (A) or glycine-alanine (GA). In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is a detectable tag. In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is YPYDVPDYA (SEQ ID NO:398), DYKDDDDK (SEQ ID NO:399), EQKLISEEDL (SEQ ID NO:400), or GLNDIFEAQKIEWHE (SEQ ID NO:401).


Also provided herein, in some embodiments, is a masked antibody comprising a) an antibody or antigen-binding fragment thereof that binds to CTLA4 (e.g., human CTLA4), wherein the antibody or antigen-binding fragment thereof comprises a first chain and a second chain, and b) a masking peptide comprising an amino acid sequence selected from SEQ ID NOs:1-46, wherein the masking peptide is linked via a linker comprising a cleavable peptide to an amino-terminus of the first chain and of the second chain of the antibody or antigen-binding fragment thereof. In some embodiments, the antibody or antigen-binding fragment thereof that binds to CTLA4 is any anti-CTLA4 antibody or antigen-binding fragment thereof described herein. In some embodiments, the antibody or antigen-binding fragment thereof comprises two first chains and two second chains. In some embodiments, the first chain is a light chain and the second chain is a heavy chain. In some embodiments, the first chain is a light chain variable domain and the second chain is a heavy chain variable domain. In some embodiments, the cleavable peptide comprises an amino acid sequence selected from SEQ ID NOs:47-88, 464-469, and 479-508. In some embodiments, a spacer linker is directly linked to the N-terminus and/or the C-terminus of the cleavable peptide. In some embodiments, the spacer linker comprises an amino acid sequence selected from SEQ ID NOs:89-112 and 415-420. In some embodiments, at least one amino acid but no more than 20, 30, 40, or 50 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, the at least one amino acid is alanine (A) or glycine-alanine (GA). In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is a detectable tag. In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is YPYDVPDYA (SEQ ID NO:398), DYKDDDDK (SEQ ID NO:399), EQKLISEEDL (SEQ ID NO:400), or GLNDIFEAQKIEWHE (SEQ ID NO:401).


Further provided herein, in some embodiments, is a masked antibody comprising an antibody or antigen-binding fragment thereof that binds to CTLA4 (e.g., human CTLA4), wherein the antibody or antigen-binding fragment thereof comprises a first chain and a second chain, and b) a masking peptide comprising an amino acid sequence selected from SEQ ID NOs:1-46, wherein the masking peptide is linked via a linker comprising a cleavable peptide to a carboxy-terminus of the first chain and the second chain of the antibody or antigen-binding fragment thereof. In some embodiments, the antibody or antigen-binding fragment thereof that binds to CTLA4 is any anti-CTLA4 antibody or antigen-binding fragment thereof described herein. In some embodiments, the antibody or antigen-binding fragment thereof comprises two first chains and two second chains. In some embodiments, the first chain is a light chain and the second chain is a heavy chain. In some embodiments, the first chain is a light chain variable domain and the second chain is a heavy chain variable domain. In some embodiments, the cleavable peptide comprises an amino acid sequence selected from SEQ ID NOs:47-88, 464-469, and 479-508. In some embodiments, a spacer linker is directly linked to the N-terminus and/or the C-terminus of the cleavable peptide. In some embodiments, the spacer linker comprises an amino acid sequence selected from SEQ ID NOs:89-112 and 415-420. In some embodiments, at least one amino acid but no more than 20, 30, 40, or 50 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, the at least one amino acid is alanine (A) or glycine-alanine (GA). In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is a detectable tag. In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is YPYDVPDYA (SEQ ID NO:398), DYKDDDDK (SEQ ID NO:399), EQKLISEEDL (SEQ ID NO:400), or GLNDIFEAQKIEWHE (SEQ ID NO:401).


Further provided herein, in some embodiments, is masking antibody comprising an a) an antibody or antigen-binding fragment thereof that binds to CTLA4 (e.g., human CTLA4), and b) a masking peptide comprising an amino acid sequence selected from SEQ ID NOs:1-46, wherein a masking peptide is linked via a linker comprising a cleavable peptide to the C-terminus or N-terminus of a first chain of the antibody and a masking peptide is linked via a linker comprising a cleavable peptide to the C-terminus or N-terminus of a second chain of the antibody. In some embodiments, the antibody or antigen-binding fragment thereof that binds to CTLA4 is any anti-CTLA4 antibody or antigen-binding fragment thereof described herein. In some embodiments, the a) the first chain of the antibody is a light chain and the second chain of the antibody is a light chain; b) the first chain of the antibody is a heavy chain and the second chain of the antibody is a heavy chain; or c) the first chain of the antibody is a light chain and the second chain of the antibody is a heavy chain. Thus, in some embodiments, the isolated antibody comprises a masking peptide on the C-terminus and/or N-terminus of each of two light chains and the C-terminus and/or N-terminus of each of two heavy chains. In some embodiments, the cleavable peptide comprises an amino acid sequence selected from SEQ ID NOs:47-88, 464-469, and 479-508. In some embodiments, a spacer linker is directly linked to the N-terminus and/or the C-terminus of the cleavable peptide. In some embodiments, the spacer linker comprises an amino acid sequence selected from SEQ ID NOs:89-112 and 415-420. In some embodiments, at least one amino acid but no more than 20, 30, 40, or 50 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, the at least one amino acid is alanine (A) or glycine-alanine (GA). In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is a detectable tag. In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is YPYDVPDYA (SEQ ID NO:398), DYKDDDDK (SEQ ID NO:399), EQKLISEEDL (SEQ ID NO:400), or GLNDIFEAQKIEWHE (SEQ ID NO:401).


Also provided herein, in some embodiments, is a masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising: a) an anti-CTLA4 antibody or antigen-binding fragment thereof comprising a light chain variable region comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO:438, a CDR-L2 comprising the amino acid sequence of SEQ ID NO:439, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO:440; and a heavy chain variable region comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO:441, a CDR-H2 comprising the amino acid sequence of SEQ ID NO:442, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO:443; b) a masking peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-46; and c) a cleavable peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 47-88, 464-469, and 479-508. In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 50. In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 86. In some embodiments, at least one amino acid but no more than 20, 30, 40, or 50 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, the at least one amino acid is alanine (A) or glycine-alanine (GA). In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is a detectable tag. In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is YPYDVPDYA (SEQ ID NO:398), DYKDDDDK (SEQ ID NO:399), EQKLISEEDL (SEQ ID NO:400), or GLNDIFEAQKIEWHE (SEQ ID NO:401). In some embodiments, the masking peptide is linked to the cleavable peptide, and the cleavable peptide is linked to the light chain variable region or the heavy chain variable region. In some embodiments, the masked anti-CTLA4 antibody or antigen-binding fragment thereof further comprises a spacer linker comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 89-112 and 415-420 that links the masking peptide to the cleavable peptide, and further comprises a spacer linker comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 89-112 and 415-420 that links the cleavable peptide to the light chain variable region or the heavy chain variable region. In some embodiments, the spacer linker that links the masking peptide to the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 420, and the spacer linker that links the cleavable peptide to the light chain variable region or the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 102. In some embodiments, the spacer linker that links the masking peptide to the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 96, and the spacer linker that links the cleavable peptide to the light chain variable region or the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 102. In some embodiments, the light chain variable region comprises the amino acid sequence of SEQ ID NO: 322, and the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 324. In some embodiments, the masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 421 and a light chain comprising the amino acid sequence of SEQ ID NO: 334, and a peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 113-231 and 444-453. In some embodiments, the masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NO: 421, and comprises an amino acid sequence that is selected from the group consisting of SEQ ID NOs: 358 and 422-431.


In one aspect, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising a light chain variable region comprising the amino acid sequence of SEQ ID NO:232 and/or a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:233. In a further aspect, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising a light chain comprising the amino acid sequence selected from SEQ ID NOs:237-318 and/or a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:319 or 320.


In one aspect, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising a light chain variable region comprising the amino acid sequence selected from SEQ ID NOs:321 or 322 and/or a heavy chain variable region comprising the amino acid sequence selected from SEQ ID NOs:323 or 324. In some embodiments, provided herein is a masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising a light chain variable region comprising the amino acid sequence of SEQ ID NO: 322, and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 324. In a further aspect, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising a light chain comprising the amino acid sequence selected from SEQ ID NOs:327-341 and/or comprising a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:366-380, 421, and 478. In yet another further aspect, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising a light chain comprising the amino acid sequence selected from SEQ ID NOs:327, 334, or 342-365 and/or comprising a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:366 or 380-397. In some embodiments, provided herein is a masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising a light chain comprising the amino acid sequence of SEQ ID NO: 334, and a heavy chain comprising the amino acid sequence of SEQ ID NO: 421. In some embodiments, provided herein is a masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising a light chain comprising the amino acid sequence of SEQ ID NO: 327, and a heavy chain comprising the amino acid sequence of SEQ ID NO: 478.


In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising a heavy chain variable region comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence of SEQ ID NO:233. In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising a heavy chain variable domain comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from SEQ ID NOs:323 or 324. In some embodiments, an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity contains substitutions, insertions, or deletions relative to the reference sequence, but an antibody comprising that amino acid sequence retains the ability to bind to CTLA4 (e.g., human CTLA4). In some embodiments, the substitutions, insertions, or deletions (e.g., 1, 2, 3, 4, or 5 amino acids) occur in regions outside the HVRs (i.e., in the FRs). In some embodiments, an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises a heavy chain variable domain comprising an amino acid sequence of SEQ ID NO:233. In some embodiments, an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises a heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NOs:323 or 324.


In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising a light chain variable domain comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence of SEQ ID NO:232. In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising a light chain variable domain comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from SEQ ID NOs:321 or 322. In some embodiments, an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity contains substitutions, insertions, or deletions relative to the reference sequence, but an antibody comprising that amino acid sequence retains the ability to bind to CTLA4 (e.g., human CTLA4). In some embodiments, the substitutions, insertions, or deletions (e.g., 1, 2, 3, 4, or 5 amino acids) occur in regions outside the HVRs (i.e., in the FRs). In some embodiments, an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises a light chain variable domain comprising an amino acid sequence of SEQ ID NO:232. In some embodiments, an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises a light chain variable domain comprising an amino acid sequence selected from SEQ ID NOs:321 or 322.


In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising a) an amino acid sequence comprising a masking peptide, a linker comprising a cleavable peptide, and a light chain; and an amino acid sequence comprising a heavy chain. In some embodiments, the amino acid sequence comprising the masking peptide, the linker comprising a cleavable peptide, and the light chain is selected from the group consisting of SEQ ID NOs: 358, 422, 424-426, and 428-431. In some embodiments, the amino acid sequence comprising the heavy chain comprises the amino acid sequence of SEQ ID NO: 421. In some embodiments, the amino acid sequence comprising the masking peptide, the linker comprising a cleavable peptide, and the light chain is selected from the group consisting of SEQ ID NOs: 358, 422, 424-426, and 428-431; and the amino acid sequence comprising the heavy chain comprises the amino acid sequence of SEQ ID NO: 421.


In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to an amino acid sequence selected from the group consisting of SEQ ID NOs: 358 and 422-431; and/or comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to an amino acid sequence selected from the group consisting of SEQ ID NOs: 358 and 422-431; and comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 358 and 422-431; and/or comprises the amino acid sequence of SEQ ID NO: 421. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 358 and 422-431; and comprises the amino acid sequence of SEQ ID NO: 421.


In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 422; and comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NO: 422, and the amino acid sequence of SEQ ID NO: 421.


In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 358; and comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NO: 358, and the amino acid sequence of SEQ ID NO: 421.


In some embodiments, provided herein is a masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 423; and comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NO: 423, and the amino acid sequence of SEQ ID NO: 421.


In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 424; and comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NO: 424, and the amino acid sequence of SEQ ID NO: 421.


In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 425; and comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NO: 425, and the amino acid sequence of SEQ ID NO: 421.


In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 426; and comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NO: 426, and the amino acid sequence of SEQ ID NO: 421.


In some embodiments, provided herein is a masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 427; and comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NO: 427, and the amino acid sequence of SEQ ID NO: 421.


In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 428; and comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NO: 428, and the amino acid sequence of SEQ ID NO: 421.


In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 429; and an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NO: 429, and the amino acid sequence of SEQ ID NO: 421.


In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 430; and comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NO: 430, and the amino acid sequence of SEQ ID NO: 421. In some embodiments, provided herein is an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprising an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 431; and comprises an amino acid sequence having or having about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology to the amino acid sequence of SEQ ID NO: 421. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NO: 431, and the amino acid sequence of SEQ ID NO: 421.


There are five classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, having heavy chains designated α, β, ε, γ and μ, respectively. The γ and α classes are further divided into subclasses e.g., humans express the following subclasses: IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2. IgG1 antibodies can exist in multiple polymorphic variants termed allotypes (reviewed in Jefferis and Lefranc 2009. mAbs Vol 1 Issue 4 1-7) any of which are suitable for use in some of the embodiments herein. Common allotypic variants in human populations are those designated by the letters a, f, n, z or combinations thereof. In some of the embodiments herein, the antibody has an IgG1, IgG2, IgG3, or IgG4 isotype. In some embodiments, an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof provided herein has an IgG1 isotype (e.g., a human IgG1 isotype). In some embodiments, the antibody provided herein comprises a heavy chain constant domain comprising the amino acid sequence of SEQ ID NO: 235 or 236. In some embodiments, the antibody provided herein comprises a heavy chain constant domain comprising the amino acid sequence of SEQ ID NO:326. In some embodiments, the antibody provided herein comprises a heavy chain constant domain comprising the amino acid sequence of SEQ ID NO: 463.


In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof binds CTLA4 upon cleavage with a protease such as a protease described herein. In some embodiments, the cleavable peptide is a substrate for a protease that is co-localized in a region with a cell or a tissue expressing CTLA4.


In one aspect of the invention, polynucleotides encoding activatable masked anti-CTLA4 antibodies or antigen-binding fragments thereof are provided. In certain embodiments, vectors comprising polynucleotides encoding activatable masked anti-CTLA4 antibodies or antigen-binding fragments thereof are provided. In certain embodiments, host cells comprising such vectors are provided. In another aspect of the invention, compositions comprising activatable masked anti-CTLA4 antibodies described herein or polynucleotides encoding activatable masked anti-CTLA4 antibodies described herein are provided. In certain embodiments, a composition of the invention is a pharmaceutical formulation for the treatment of a neoplastic disease in which CTLA4 plays a role, such as those enumerated herein.


In some embodiments, the CTLA4 binding protein provided herein is a bispecific antibody capable of binding to CTLA4. Bispecific antibodies are monoclonal antibodies that have binding specificities for at least two different antigens. In some embodiments, one of the binding specificities is for CTLA4 and the other is for any other antigen. In certain embodiments, bispecific antibodies may bind to two different epitopes of CTLA4.


In some aspects, provided herein is a masked bispecific antibody comprising a) a light chain and a heavy chain of a first pair that specifically binds to CTLA4; b) a light chain and a heavy chain of a second pair that specifically binds to an antigen; and c) a masking peptide comprising an amino acid sequence selected from SEQ ID NOs:1-46, wherein the masking peptide is linked via a linker comprising a cleavable peptide to the amino-terminus of the light chain and/or the heavy chain of the first pair. In some aspects, provided herein is a masked bispecific antibody comprising a) a light chain and a heavy chain of a first pair that specifically binds to CTLA4; b) a light chain and a heavy chain of a second pair that specifically binds to an antigen; and c) a masking peptide comprising an amino acid sequence selected from SEQ ID NOs:1-46, wherein the masking peptide is linked via a linker comprising a cleavable peptide to the carboxy-terminus of the light chain and/or the heavy chain of the first pair. In some embodiments, the antigen is an antigen different from CTLA4. In some embodiments, the light chain of the first pair or the second pair is any light chain described herein. In some embodiments, the heavy chain of the first pair or the second pair is any light chain described herein. In some embodiments, the light chain of the first pair comprises a CDR-L1 comprising the amino acid sequence of SEQ ID NO:438, a CDR-L2 comprising the amino acid sequence of SEQ ID NO:439, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO:440; and the heavy chain of the first pair comprises a CDR-H1 comprising the amino acid sequence of SEQ ID NO:441, a CDR-H2 comprising the amino acid sequence of SEQ ID NO:442, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO:443. In some embodiments, the light chain of the second pair comprises a CDR-L1 comprising the amino acid sequence of SEQ ID NO:438, a CDR-L2 comprising the amino acid sequence of SEQ ID NO:439, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO:440; and the heavy chain of the second pair comprises a CDR-H1 comprising the amino acid sequence of SEQ ID NO:441, a CDR-H2 comprising the amino acid sequence of SEQ ID NO:442, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO:443. In some embodiments, the antigen is to a different epitope of CTLA4. In some embodiments, the cleavable peptide comprises an amino acid sequence selected from SEQ ID NOs:47-88, 464-469, and 479-508. In some embodiments, a spacer linker is directly linked to the N-terminus and/or the C-terminus of the cleavable peptide. In some embodiments, the spacer linker comprises an amino acid sequence selected from SEQ ID NOs:89-112 and 415-420. In some embodiments, at least one amino acid but no more than 20, 30, 40, or 50 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, the at least one amino acid is alanine (A) or glycine-alanine (GA). In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is a detectable tag. In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is YPYDVPDYA (SEQ ID NO:398), DYKDDDDK (SEQ ID NO:399), EQKLISEEDL (SEQ ID NO:400), or GLNDIFEAQKIEWHE (SEQ ID NO:401).


Bispecific antibodies contemplated herein for use in the masked bispecific antibodies include murine bispecific antibodies, humanized bispecific antibodies, chimeric bispecific antibodies, and human bispecific antibodies. In some of the embodiments herein, the bispecific antibody has an IgG1, IgG2, IgG3, or IgG4 isotype. In some embodiments, a bispecific antibody provided herein has an IgG1 isotype (e.g., a human IgG1 isotype). In some embodiments, the antibody has an IgG1 isotype comprising amino acid substitutions or is expressed by cells that have no ability to a reduced ability to fucosylate the Fc glycan. that enhance effector function as described herein. In some embodiments, the masked bispecific antibody provided herein comprises a heavy chain constant domain comprising the amino acid sequence of SEQ ID NO: 235 or 236. In some embodiments, the masked bispecific antibody provided herein comprises a heavy chain constant domain comprising the amino acid sequence of SEQ ID NO:326. In some embodiments, the masked bispecific antibody provided herein comprises a heavy chain constant domain comprising the amino acid sequence of SEQ ID NO:463.


In one aspect, provided herein is an activatable masked anti-CTLA4 bispecific antibody comprising a light chain variable region comprising the amino acid sequence of SEQ ID NO:232 and/or a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:233. In a further aspect, provided herein is an activatable masked anti-CTLA4 bispecific antibody comprising a light chain comprising the amino acid sequence selected from SEQ ID NOs:237-318 and/or a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:319 or 320.


In one aspect, provided herein is an activatable masked anti-CTLA4 bispecific antibody comprising a light chain variable region comprising the amino acid sequence selected from SEQ ID NOs:321 or 322 and/or a heavy chain variable region comprising the amino acid sequence selected from SEQ ID NOs:323 or 324. In a further aspect, provided herein is an activatable masked anti-CTLA4 bispecific antibody comprising a light chain comprising the amino acid sequence selected from SEQ ID NOs:327-341 and/or comprising a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:366-380, 421, and 478. In yet another further aspect, provided herein is an activatable masked anti-CTLA4 bispecific antibody comprising a light chain comprising the amino acid sequence selected from SEQ ID NOs:327, 334, or 342-365 and/or comprising a heavy chain comprising the amino acid sequence selected from SEQ ID NOs:366 or 380-397.


In some embodiments, provided herein is an activatable masked anti-CTLA4 bispecific antibody comprising a heavy chain variable region comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence of SEQ ID NO:233. In some embodiments, provided herein is an activatable masked anti-CTLA4 bispecific antibody comprising a heavy chain variable domain comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from SEQ ID NOs:323 or 324. In some embodiments, an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity contains substitutions, insertions, or deletions relative to the reference sequence, but an antibody comprising that amino acid sequence retains the ability to bind to CTLA4 (e.g., human CTLA4). In some embodiments, the substitutions, insertions, or deletions (e.g., 1, 2, 3, 4, or 5 amino acids) occur in regions outside the HVRs (i.e., in the FRs). In some embodiments, an activatable masked anti-CTLA4 bispecific antibody comprises a heavy chain variable domain comprising an amino acid sequence of SEQ ID NO:233. In some embodiments, an activatable masked anti-CTLA4 bispecific antibody comprises a heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NOs:323 or 324.


In some embodiments, provided herein is an activatable masked anti-CTLA4 bispecific antibody comprising a light chain variable domain comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence of SEQ ID NO:232. In some embodiments, provided herein is an activatable masked anti-CTLA4 bispecific antibody comprising a light chain variable domain comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from SEQ ID NOs:321 or 322. In some embodiments, an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity contains substitutions, insertions, or deletions relative to the reference sequence, but an antibody comprising that amino acid sequence retains the ability to bind to CTLA4 (e.g., human CTLA4). In some embodiments, the substitutions, insertions, or deletions (e.g., 1, 2, 3, 4, or 5 amino acids) occur in regions outside the HVRs (i.e., in the FRs). In some embodiments, an activatable masked anti-CTLA4 bispecific antibody comprises a light chain variable domain comprising an amino acid sequence of SEQ ID NO:232. In some embodiments, an activatable masked anti-CTLA4 bispecific antibody comprises a light chain variable domain comprising an amino acid sequence selected from SEQ ID NOs:321 or 322.


In some embodiments, the CTLA4 binding protein provided herein is a chimeric receptor (e.g., chimeric antigen receptor (CAR)) capable of binding to CTLA4. CARs are molecules that combine antibody-based specificity for a desired antigen (e.g., CTLA4) with a T cell receptor-activating intracellular domain to generate a chimeric protein that exhibits a specific anti-tumor cellular activity. In one embodiment, provided herein is a chimeric receptor engineered to comprise an extracellular domain having a CTLA4 binding domain described herein fused to an intracellular signaling domain of the T cell antigen receptor complex zeta chain (e.g., CD3 zeta). The CTLA4 binding domain is engineered so that it is linked to a masking peptide, such as one described herein, via a linker comprising a cleavable peptide. The activatable masked chimeric receptor provide herein, when expressed in a T cell is able to redirect antigen recognition based on the antigen binding specificity upon cleavage by a protease recognizing the cleavable peptide. In some embodiments, the CTLA4 binding domain is preferably fused with an intracellular domain from one or more of a costimulatory molecule and a zeta chain. In some embodiments, the CTLA4 binding domain is fused with one or more intracellular domains selected from the group of a CD137 (4-1BB) signaling domain, a CD28 signaling domain, a CD3zeta signal domain, and any combination thereof.


In some aspects, provided herein is a masked chimeric receptor comprising a) a ligand-binding domain comprising a first chain and a second chain that binds to CTLA4; b) a masking peptide comprising an amino acid sequence selected from SEQ ID NOs:1-46,c) a transmembrane domain; and d) an intracellular signaling domain comprising a signaling domain, wherein the masking peptide is linked via a linker comprising a cleavable peptide to the amino-terminus of the first chain and/or the second chain of the ligand-binding domain. In some embodiments the first chain is a light chain variable domain and the second chain is a heavy chain variable domain. In some of the embodiments of the activatable masked chimeric receptors described herein, the first chain comprises the amino acid sequence of SEQ ID NO:232; and/or the second chain comprises the amino acid sequence of SEQ ID NO:233. In some embodiments, the first chain comprises the amino acid sequence selected from SEQ ID NOs:321 or 322; and/or the second chain comprises the amino acid sequence selected from SEQ ID NOs:323 or 324.


In some aspects, provided herein is a masked chimeric receptor comprising a) a ligand-binding domain comprising a first chain and a second chain that binds to CTLA4; b) a masking peptide comprising an amino acid sequence selected from SEQ ID NOs:1-46,c) a transmembrane domain; and d) an intracellular signaling domain comprising a signaling domain, wherein the masking peptide is linked via a linker comprising a cleavable peptide to the carboxy-terminus of the first chain and/or the second chain of the ligand-binding domain. In some embodiments the first chain is a light chain variable domain and the second chain is a heavy chain variable domain. In some of the embodiments of the activatable masked chimeric receptors described herein, the first chain comprises the amino acid sequence of SEQ ID NO:232; and/or the second chain comprises the amino acid sequence of SEQ ID NO:233. In some embodiments, the first chain comprises the amino acid sequence selected from SEQ ID NOs:321 or 322; and/or the second chain comprises the amino acid sequence selected from SEQ ID NOs:323 or 324.


In some of the embodiments of the activatable masked chimeric receptors described herein, the cleavable peptide comprises an amino acid sequence selected from SEQ ID NOs:47-88, 464-469, and 479-508. In some embodiments, a spacer linker is directly linked to the N-terminus and/or the C-terminus of the cleavable peptide. In some embodiments, the spacer linker comprises an amino acid sequence selected from SEQ ID NOs:89-112 and 415-420. In some embodiments, at least one amino acid but no more than 20, 30, 40, or 50 amino acids is directly linked to the N-terminus of the masking peptide. In some embodiments, the at least one amino acid is alanine (A) or glycine-alanine (GA). In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is a detectable tag. In some embodiments, the at least one amino acid directly linked to the N-terminus of the masking peptide is YPYDVPDYA (SEQ ID NO:398), DYKDDDDK (SEQ ID NO:399), EQKLISEEDL (SEQ ID NO:400), or GLNDIFEAQKIEWHE (SEQ ID NO:401).


An exemplary activatable masked anti-CTLA4 antibody described herein is Antibody A. Antibody A comprises the following CDR sequences:
















Asnti-




body A
IMGT
Kabat





HCDR1
GYTFTNYF
NYFMN



(SEQ ID
(SEQ ID



NO: 411)
NO: 441)





HCDR2
VDPEQGRAD
RVDPEQGRADYAEKFKK



(SEQ ID
(SEQ ID



NO: 412)
NO: 442)





HCDR3
RRAMDNYGFAY
RAMDNYGFAY



(SEQ ID
(SEQ ID



NO: 413)
NO: 443)





LCDR1
SALSYM
SANSALSYMY



(SEQ ID
(SEQ ID



NO: 408)
NO: 438)





LCDR2
GTS
GTSNLAS



(SEQ ID
(SEQ ID



NO: 409)
NO: 439)





LCDR3
HHWSNTQ
HHWSNTQWT



(SEQ ID
(SEQ ID



NO: 410)
NO: 440)










Antibody A variable light chain:


EIVLTQSPDF QSVTPKEKVT ITCSANSALS YMYWYQQKPD 


QSPKLWVHGT SNLASGVPSR FSGSGSGTDF TLTINSLEAE


DAATYYCHHW SNTQWTFGGG TKVEIK


(SEQ ID NO: 509)





Antibody A Light Chain


ACPGKGLPSCGGGSSGGSGVPLSLYSGGEIVLTQSPDFQSVTP


KEKVTITCSANSALSYMYWYQQKPDQSPKLWVHGTSNLASGVP


SRFSGSGSGTDFTLTINSLEAEDAATYYCHHWSNTQWTFGGGT


KVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK


VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK


HKVYACEVTHQGLSSPVTKSFNRGEC


(SEQ ID NO: 358)





Antibody A variable heavy chain:


QVQLVQSGAE VKKPGSSVKV SCKASGYTFT NYFMNWVRQA 


PGQGLEWMGR VDPEQGRADY AEKFKKRVTI TADKSTSTAY


MELSSLRSED TAVYYCARRA MDNYGFAYWG QGTLVTVSS


(SEQ ID NO: 510)





Antibody A heavy chain:


QVQLVQSGAE VKKPGSSVKV SCKASGYTFT NYFMNWVRQA 


PGQGLEWMGR VDPEQGRADY AEKFKKRVTI TADKSTSTAY 


MELSSLRSED TAVYYCARRA MDNYGFAYWG QGTLVTVSSA


STKGPSVFPL APSSKSTSGG TAALGCLVKD YFPEPVTVSW


NSGALTSGVH TFPAVLQSSG LYSLSSVVTV PSSSLGTQTY 


ICNVNHKPSN TKVDKKVEPK SCDKTHTCPP CPAPELLGGP


DVFLFPPKPK DTLMISRTPE VTCVVVDVSH EDPEVKFNWY


VDGVEVHNAK TKPREEQYNS TYRVVSVLTV LHQDWLNGKE


YKCKVSNKAL PAPEEKTISK AKGQPREPQV YTLPPSRDEL 


TKNQVSLTCL VKGFYPSDIA VEWESNGQPE NNYKTTPPVL


DSDGSFFLYS KLTVDKSRWQ QGNVFSCSVM HEALHNHYTQ


KSLSLSPGK


(SEQ ID NO: 421)









In some embodiments, the activatable CTLA4 binding protein comprises Antibody A.


1. Binding Affinity


The strength, or affinity of immunological binding interactions, such as between an antibody and an antigen for which the antibody is specific, can be expressed in terms of the equilibrium dissociation constant (KD) of the interaction, wherein a smaller KD represents a greater affinity. Immunological binding properties of proteins can be quantified using methods well known in the art. For example, one method comprises measuring the rates of antigen-binding protein (e.g., antibody)/antigen complex formation and dissociation, wherein those rates depend on the concentrations of the complex partners, the affinity of the interaction, and geometric parameters that equally influence the rate in both directions. Both the “on rate constant” (Kon) and the “off rate constant” (Koff) can be determined by calculation of the concentrations and the actual rates of association and dissociation. The ratio of Koff/Kon enables the cancelation of all parameters not related to affinity, and is equal to the equilibrium dissociation constant KD. See Davies et al., Annual Rev Biochem. 59:439-473, (1990).


In some aspects, an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) described herein binds to CTLA4 with about the same or higher affinity upon cleavage with aprotease as compared to the parental anti-CTLA4 binding protein that does not comprise a cleavable peptide. In certain embodiments, an anti-CTLA4 binding protein provided herein has an equilibrium dissociation constant (KD) of ≤1 μM, ≤150 nM, ≤100 nM, ≤50 nM, ≤10 nM, ≤1 nM, ≤0.1 nM, ≤0.01 nM, or ≤0.001 nM (e.g. 10−8 M or less, e.g. from 10−8 M to 10−13 M, e.g., from 10−9 M to 10−13 M). In some embodiments, an anti-CTLA4 binding protein (e.g., an anti-CTLA4 antibody or antigen-binding fragment thereof) provided herein binds to a target protein (e.g., CTLA4 protein) with an equilibrium dissociation constant (KD) of about 50 μM to about 5 nM. Assays for assessing binding affinity are well known in the art.


In some aspects, activatable masked anti-CTLA4 binding proteins (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) that exhibit a desired occlusion ratio are provided. The term “occlusion ratio” as used herein refers a ratio of (a) a maximum detected level of a parameter under a first set of conditions to (b) a minimum detected value of that parameter under a second set of conditions. For example, in the context of an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof, the occlusion ratio refers to the ratio of (a) a maximum detected level of target protein (e.g., CTLA4 protein) binding to the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof in the presence of at least one protease capable of cleaving the cleavable peptide of the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof to (b) a minimum detected level of target protein (e.g., CTLA4 protein) binding to the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof in the absence of the protease. The occlusion ratio of an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof can be calculated as the ratio of the dissociation constant of an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof before cleavage with a protease to the dissociation constant of the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof after cleavage with a protease. In some embodiments, a greater occlusion ratio for the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof indicates that target protein (e.g., CTLA4 protein) bound by the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof occurs to a greater extent (e.g., predominantly occurs) in the presence of a protease capable of cleaving the cleavable peptide of the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof than in the absence of a protease. In some embodiments, activatable masked anti-CTLA4 binding proteins with an optimal occlusion ratio are provided herein. In some embodiments, an optimal occlusion ratio of an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof indicates the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof has desirable properties useful for the methods or compositions contemplated herein. In some embodiments, an activatable masked anti-CTLA4 binding protein provided herein exhibits an optimal occlusion ratio of about 20 to about 10,000, e.g., about 80 to about 100. In a further embodiment, the occlusion ratio is about 20 to about 7,500, about 20 to about 5,000, about 20 to about 2,500, about 20 to about 2,000, about 20 to about 1,000, about 20 to about 900, about 20 to about 800, about 20 to about 700, about 20 to about 600, about 20 to about 500, about 20 to about 400, about 20 to about 300, about 20 to about 200, about 20 to about 100, about 20 to about 50, about 30 to about 100, about 40 to about 100, about 50 to about 100, about 60 to about 100, about 70 to about 100, about 80 to about 100, or about 100 to about 1,000. In some embodiments, an activatable masked anti-CTLA4 binding protein provided herein exhibits an optimal occlusion ratio of about 80 to about 100. In some embodiments, an activatable masked anti-CTLA4 binding protein provided herein exhibits an optimal occlusion ratio of about 20 to about 1,000. Binding of an activatable masked anti-CTLA4 binding protein to a target protein (e.g., CTLA4 protein) before cleavage and/or after cleavage with a protease can be determined using techniques well known in the art such as by ELISA.


In some aspects, a masking peptide described herein binds to an anti-CTLA4 binding protein (e.g., an anti-CTLA4 antibody or antigen-binding fragment thereof) with lower affinity than the affinity between the anti-CTLA4 binding protein and a target protein (e.g., CTLA4 protein). In certain embodiments, a masking peptide provided herein binds to an anti-CTLA4 binding protein (e.g., an anti-CTLA4 antibody or antigen-binding fragment thereof) with an equilibrium dissociation constant (KD) of ≤1 mM, ≤1 μM, ≤150 nM, ≤100 nM, ≤50 nM, ≤10 nM, ≤1 nM, ≤0.1 nM, ≤0.01 nM, or ≤0.001 nM (e.g., 10−5 M or less, e.g. from 10−5 M to 10−13 M, e.g., from 10−5 M to 10−7 M). In some embodiments, a masking peptide provided herein binds to an anti-CTLA4 binding protein (e.g., an anti-CTLA4 antibody or antigen-binding fragment thereof) with an equilibrium dissociation constant (KD) of about 50 nM to about 50 μM. Assays for assessing binding affinity are well known in the art, for example such as ELISA, and surface plasma resonance (SPR).


2. Biological Activity Assays


In some aspects, an activatable masked anti-CTLA4 binding protein described herein reduces tumor volume in an in vivo murine tumor model.


IV. Pd1 Programmed Death 1 (PD-1)

Programmed Death 1 (PD-1) (also known as Programmed Cell Death 1) is a type I transmembrane protein of 268 amino acids originally identified by subtractive hybridization of a mouse T cell line undergoing apoptosis (Ishida et al., Embo J., 11: 3887-95 (1992)). PD-1 is a member of the CD28/CTLA-4 family of T-cell regulators, and is expressed on activated T-cells, B-cells, and myeloid lineage cells (Greenwald et al., Annu. Rev. Immunol., 23: 515-548 (2005); and Sharpe et al., Nat. Immunol., 8: 239-245 (2007)). PD-1 is an inhibitory member of the CD28 family of receptors, that also includes CD28, CTLA-4, ICOS and BTLA. PD-1 is expressed on activated B cells, T cells, and myeloid cells (Agata et al., supra; Okazaki et al. (2002) Curr. Opin. Immunol 14:391779-82; Bennett et al. (2003) J Immunol 170:711-8).


Two ligands for PD-1 have been identified, PD ligand 1 (PD-L1) and PD ligand 2 (PD-L2), both of which belong to the B7 protein superfamily (Greenwald et al, supra). PD-L1 is expressed in a variety of cell types, including cells of the lung, heart, thymus, spleen, and kidney (see, e.g., Freeman et al., J. Exp. Med., 192(7): 1027-1034 (2000); and Yamazaki et al., J. Immunol., 169(10): 5538-5545 (2002)). PD-L1 expression is upregulated on macrophages and dendritic cells (DCs) in response to lipopolysaccharide (LPS) and GM-CSF treatment, and on T-cells and B-cells upon signaling via T-cell and B-cell receptors. PD-L1 also is expressed in a variety of murine tumor cell lines (see, e.g., Iwai et al., Proc. Nat.l Acad. Sci. USA, 99(9): 12293-12297 (2002); and Blank et al., Cancer Res., 64(3): 1140-1145 (2004)). In contrast, PD-L2 exhibits a more restricted expression pattern and is expressed primarily by antigen presenting cells (e.g., dendritic cells and macrophages), and some tumor cell lines (see, e.g., Latchman et al., Nat. Immunol., 2(3): 261-238 (2001)). High PD-L1 expression in tumors, whether on the tumor cell, stroma, or other cells within the tumor microenvironment, correlates with poor clinical prognosis, presumably by inhibiting effector T cells and upregulating regulatory T cells (Treg) in the tumor.


PD-1 negatively regulates T-cell activation, and this inhibitory function is linked to an immunoreceptor tyrosine-based switch motif (ITSM) in the cytoplasmic domain (see, e.g., Greenwald et al., supra; and Parry et al., Mol. Cell. Biol., 25: 9543-9553 (2005)). PD-1 deficiency can lead to autoimmunity. For example, C57BL/6 PD-1 knockout mice have been shown to develop a lupus-like syndrome (see, e.g., Nishimura et al., Immunity, 11: 141-1151 (1999)). In humans, a single nucleotide polymorphism in the PD-1 gene is associated with higher incidences of systemic lupus erythematosus, type 1 diabetes, rheumatoid arthritis, and progression of multiple sclerosis (see, e.g., Nielsen et al., Tissue Antigens, 62(6): 492-497 (2003); Bertsias et al., Arthritis Rheum., 60(1): 207-218 (2009); Ni et al, Hum. Genet., 121(2): 223-232 (2007); Tahoori et al., Clin. Exp. Rheumatol., 29(5): 763-767 (2011); and Kroner et al., Ann. Neurol., 58(1): 50-57 (2005)). Abnormal PD-1 expression also has been implicated in T-cell dysfunctions in several pathologies, such as tumor immune evasion and chronic viral infections (see, e.g., Barber et al., Nature, 439: 682-687 (2006); and Sharpe et al., supra).


Recent studies demonstrate that T-cell suppression induced by PD-1 also plays a role in the suppression of anti-tumor immunity. For example, PD-L1 is expressed on a variety of human and mouse tumors, and binding of PD-1 to PD-L1 on tumors results in T-cell suppression and tumor immune evasion and protection (Dong et al., Nat. Med., 8: 793-800 (2002)). Expression of PD-L1 by tumor cells has been directly associated with their resistance to lysis by anti-tumor T-cells in vitro (Dong et al., supra; and Blank et al., Cancer Res., 64: 1140-1145 (2004)). PD-1 knockout mice are resistant to tumor challenge (Iwai et al., Int. Immunol., 17: 133-144 (2005)), and T-cells from PD-1 knockout mice are highly effective in tumor rejection when adoptively transferred to tumor-bearing mice (Blank et al., supra). Blocking PD-1 inhibitory signals using a monoclonal antibody can potentiate host anti-tumor immunity in mice (Iwai et al., supra; and Hirano et al., Cancer Res., 65: 1089-1096 (2005)), and high levels of PD-L1 expression in tumors are associated with poor prognosis for many human cancer types (Hamanishi et al., Proc. Natl. Acad. Sci. USA, 104: 3360-335 (2007), Brown et al, J. Immunol., 170: 1257-1266 (2003); and Flies et al., Yale Journal of Biology and Medicine, 84(4): 409-421 (2011)).


In view of the foregoing, strategies for inhibiting PD-1 activity to treat various types of cancer and for immunopotentiation (e.g., to treat infectious diseases) have been developed (see, e.g., Ascierto et al., Clin. Cancer. Res., 19(5): 1009-1020 (2013)). In this respect, monoclonal antibodies targeting PD-1 have been developed for the treatment of cancer (see, e.g., Weber, Semin. Oncol., 37(5): 430-4309 (2010); and Tang et al., Current Oncology Reports, 15(2): 98-104 (2013)). For example, nivolumab (also known as BMS-936558) produced complete or partial responses in non-small-cell lung cancer, melanoma, and renal-cell cancer in a Phase I clinical trial (see, e.g., Topalian, New England J. Med., 366: 2443-2454 (2012)), and is currently in Phase III clinical trials. MK-3575 is a humanized monoclonal antibody directed against PD-1 that has shown evidence of antitumor activity in Phase I clinical trials (see, e.g., Patnaik et al., 2012 American Society of Clinical Oncology (ASCO) Annual Meeting, Abstract #2512). In addition, recent evidence suggests that therapies which target PD-1 may enhance immune responses against pathogens, such as HIV (see, e.g., Porichis et al., Curr. HIV/AIDS Rep., 9(1): 81-90 (2012)). Despite these advances, however, the efficacy of these potential therapies in humans may be limited.


Agents that Inhibit PD-1 Signaling


The present disclosure provides methods of treating cancer that include administering compositions that deliver programmed death-1 protein (PD-1) signaling agents according to regimens that may achieve clinical benefit(s).


Agents that inhibit PD-1 signaling for use in therapies of the present disclosure include those that bind to and block PD-1 receptors on T cells without triggering inhibitory signal transduction, agents that bind to PD-1 ligands to prevent their binding to PD-1, agents that do both, and agents that prevent expression of genes that encode either PD-1 or natural ligands of PD-1. Compounds that bind to natural ligands of PD-1 include PD-1 itself, as well as active fragments of PD-1, and in the case of the B7-H1 ligand, B7.1 proteins and fragments. Such antagonists include proteins, antibodies, anti-sense molecules and small organics.


The present disclosure describes, at least in part, PD-1 agents (e.g., PD-1 agents or PD-L1 agents) and various compositions and methods relating thereto. In some embodiments, a PD-1 signaling agent (e.g., anti-PD-1 antibody agent) binds an epitope of PD-1 which blocks the binding of PD-1 to any one or more of its putative ligands.


In some embodiments, an agent that inhibits PD-1 signaling for use in combination therapies of the present disclosure is an antibody agent. In some embodiments, a PD-1 antibody agent binds an epitope of PD-1 which blocks the binding of PD-1 to any one or more of its putative ligands. In some embodiments, a PD-1 antibody agent binds an epitope of PD-1 which blocks the binding of PD-1 to two or more of its putative ligands. In embodiments, a PD-1 antibody agent binds an epitope of a PD-1 protein which blocks the binding of PD-1 to PD-L1 and/or PD-L2. PD-1 antibody agents of the present disclosure may comprise a heavy chain constant region (Fc) of any suitable class. In some embodiments, a PD-1 antibody agent comprises a heavy chain constant region that is based upon wild-type IgG1, IgG2, or IgG4 antibodies, or variants thereof.


In some embodiments, an agent that inhibits PD-1 signaling is a monoclonal antibody, or a fragment thereof. In some embodiments, an antibody agent that inhibits PD-1 signaling is a PD-1 antibody or fragment thereof. Monoclonal antibodies that target PD-1 that have been tested in clinical studies and/or received marketing approval in the United. Examples of antibody agents that target PD-1 signaling include, for example, any of the antibody agents listed in the following Table 2:









TABLE 2





Anti-PD-1 Antibody Agents







Antibody Agent Target (Format)


Opdivo Nivolumab


PD-1 (Human IgG4)


Keytruda Pembrolizumab


PD-1 (Humanized IgG4)


Tecentriq Atezolizumab


PD-L1 (Human IgG1)


Imfinzi Durvalumab


PD-L1 (Human IgG1)


Bavencio Avelumab


PD-L1 (Human IgG1)


PDR001


PD-1 (Humanized IgG4)


Cemiplimab


PD-1 (fully human IgG4)


BGB-A317


PD-1 (Humanized IgG4) engineered to


not bind FcγRI


LY3300054


PD-L1


BI 754091


(anti-PD-1)


IBI308


(anti-PD-1)


INCSHR-1210


(anti-PD-1)


JNJ-63723283


(anti-PD-1)


JS-001


(anti-PD-1)


MEDI0680 (AMP-514)


anti-PD-1 (Humanized IgG4)


MGA-012


(anti-PD-1)


PF-06801591


(anti-PD-1)


Dostarlimab (TSR-042)


anti-PD-1 (Humanized IgG4)


CX-072


anti-PD-L1


FAZ053


anti-PD-L1


PD-L1 millamolecule









In some embodiments, an antibody agent that inhibits PD-1 signaling is atezolizumab, avelumab, BGB-A317, BI 754091, CX-072, durvalumab, FAZ053, IBI308, INCSHR-1210, JNJ-63723283, JS-001, MEDI-0680, MGA-012, nivolumab, PDR001, pembrolizumab, PF-06801591, cemiplimab, dostarlimab, any of the antibodies disclosed in WO2014/179664, or derivatives thereof. In some embodiments, an antibody agent that inhibits PD-1 signaling is a PD-1 antibody selected from the group consisting of BGB-A317, BI 754091, CX-072, FAZ053, IBI308, INCSHR-1210, JNJ-63723283, JS-001, LY3300054, MEDI-0680, MGA-012, nivolumab, PD-L1 millamolecule, PDR001, pembrolizumab, PF-06801591, cemiplimab, and dostarlimab. In some embodiments, an antibody agent that inhibits PD-1 signaling is a PD-1 antibody selected from the group consisting of nivolumab, pembrolizumab, and dostarlimab.


In some embodiments, a PD-1 signaling agent is pembrolizumab, nivolumab, atezolizumab, durvalumab, avelumab, dostarlimab, PDR-001, tislelizumab (BGB-A317), cemiplimab (REGN2810), LY-3300054, JNJ-63723283, MGA012, BI-754091, IBI-308, camrelizumab (HR-301210), BCD-100, JS-001, CX-072, BGB-A333, AMP-514 (MEDI-0680), AGEN-2034, CS1001, Sym-021, SHR-1316, PF-06801591, LZM009, KN-035, AB122, genolimzumab (CBT-501), FAZ-053, CK-301, AK 104, or GLS-010, or any of the PD-1 antibodies disclosed in WO2014/179664. In embodiments, an immune checkpoint inhibitor is a PD-1 inhibitor. In embodiments, a PD-1 inhibitor is a PD-1 signaling agent (e.g., an antibody, an antibody conjugate, or an antigen-binding fragment thereof). In embodiments, a PD-1 inhibitor is a PD-L1 or PD-L2 binding agent is durvalumab, atezolizumab, avelumab, BGB-A333, SHR-1316, FAZ-053, CK-301, or, PD-L1 millamolecule, or derivatives thereof.


In some embodiments, a PD-1-binding agent (e.g., anti-PD-1 antibody agent) binds an epitope of PD-1 which blocks the binding of PD-1 to two or more of its putative ligands. In some embodiments, a PD-1-binding agent (e.g., anti-PD-1 antibody agent) binds an epitope of a PD-1 protein which blocks the binding of PD-1 to PD-L1 and/or PD-L2. PD-1-binding agents (e.g., anti-PD-1 antibody agents) of the present disclosure may comprise a heavy chain constant region (Fc) of any suitable class. In some embodiments, a PD-1-binding agent (e.g., anti-PD-1 antibody agent) comprises a heavy chain constant region that is based upon wild-type IgG1, IgG2, or IgG4 antibodies, or variants thereof. In some embodiments, a PD-1-binding agent is a monoclonal antibody.


In some embodiments a PD-1-binding agent is or comprises an immunoglobulin G4 (IgG4) humanized monoclonal antibody (mAb). In some embodiments, a PD-1-binding agent comprises a human IGHG4*01 polypeptide. In some embodiments, a PD-1-binding agent comprises one or more mutations within the IgG heavy chain region. In some embodiments, a PD-1-binding agent comprises an IgG4 heavy chain constant region having one or more mutations in the heavy chain constant region. In some embodiments, a PD-1-binding agent comprises an IgG4 heavy chain constant region having one or more mutations in hinge region. It is envisioned that in some embodiments, a mutation in the IgG4 hinge region may prevent half molecule exchange with other IgG4 molecules. In some embodiments, the one or more mutations in hinge region of IgG4 may include a serine to proline stabilizing mutation that prevents half molecule exchange with other IgG4 molecules. In some embodiments, the one or more mutations in hinge region of IgG4 may include an S228P mutation. See, e.g., J. Biol. Chem. 2015; 290(9):5462-5469. Without wishing to be bound by theory, it is envisioned that this point mutation serves to stabilize the hinge of the antibody heavy chain.


In some embodiments, a PD-1-binding agent is nivolumab, pembrolizumab, atezolizumab, durvalumab, avelumab, or any of the antibodies disclosed in WO2014/179664.


Pembrolizumab is an anti-PD-1 monoclonal antibody (“mAb”) (also known as MK-3475, SCH 9000475, Keytruda). Pembrolizumab is an immunoglobulin G4/kappa isotype humanized mAb. The mechanism of pembrolizumab consists of the mAb binding to the PD-1 receptor of lymphocytes to block the interaction of PD-1 with PD-L1 and PD-L2 ligands produced by other cells in the body, including tumor cells of certain cancers.


Similarly to pembrolizumab, nivolumab (also known as BMS-936558, Opdivo) was first approved by the FDA in 2014 to treat melanoma that cannot be surgically removed or has metastasized following treatment with ipilimumab and a BRAF inhibitor where appropriate.


In some embodiments, a PD-1 antibody agent is as disclosed in International Patent Application Publication WO2014/179664, the entirety of which is incorporated herein.


In some embodiments, the PD-1 agent is selected from a PD-1 agent provided in Table 2.


Exemplary PD-1 agents are described in Table 3.


In embodiments, a PD-1 agent is any of PD-1 agent nos. 1-94 of Table 3.


In some embodiments, an agent that inhibits PD-1 signaling binds to human PD-1. In some embodiments, an agent that inhibits PD-1 signaling binds to human PD-L1.


Exemplary PD-L1 agents are described in Table 4.


In embodiments, a PD-L1 agent is any of PD-L1 agent nos. 1-89 of Table 4.









TABLE 3







PD-1 Agents










PD-1 Agent No.
Drug Name and Synonyms






 1
pembrolizumab




Keytruda




lambrolizumab




MK 3475




MK-3475




MK3475




SCH 900475




SCH-900475




SCH900475



 2
nivolumab




anti-PD-1 MAb, Medarex




anti-PD-1 MAb, Ono




BMS 936558




BMS-936558




MDX-1106




NSC 748726




NSC-748726




ONO 4538




ONO-4538




Opdivo



 3
Tripolibamab




anti PD-1 monoclonal antibody,




Shanghai Junshi Biosciences




JS 001




JS-001




JS001




TAB 001




TAB-001




TAB001



 4
sintilimab




anti-PD1 MAb, Innovent Biologics




IBI-308




IBI308



 5
cemiplimab




REGN 2810




REGN-2810




REGN2810




SAR-439684




SAR439684



 6
spartalizumab




anti-PD-1 antibody, CoStim




anti-PD-1 antibody, Novartis




cancer immunotherapies, CoStim




PDR-001




PDR001



 7
camrelizumab




HR-301210




HR301210




INCSHR-1210




INCSHR1210




SHR-1210




SHR1210



 8
BGB-A317




BGB A317




BGBA317




PD-1 MAb, BeiGene




Tislelizumab



 9
BCD-100, Biocad




anti-PD1 monoclonal antibody, Biocad




BCD100, Biocad



10
MGA-012




INCMGA 00012




INCMGA 0012




INCMGA-00012




INCMGA-0012




INCMGA00012




INCMGA0012




MGA 012




MGA012



11
MEDI-0680




AMP-514




AMP514




MEDI0680



12
JNJ-63723283




JNJ-3283




JNJ3283




JNJ63723283



13
genolimzumab




CBT-501




CBT501




GB-226




GB226




recombinant PD-1 humanized




monoclonal antibody, Genor Biopharma



14
AGEN-2034




AGEN 2034




AGEN2034




PD-1 antagonist, Agenus



15
XmAb-20717




PD-1/CTLA-4 bispecific antibody,




Xencor




XmAb20717



16
Dostarlimab



17
Sym-021




anti-PD-1, Symphogen




Sym021



18
PF-06801591




anti-PD-1 antibody, Pfizer




PF06801591



19
MGD-013




MGD013



20
LZM-009




LZM009



21
iPD1 CD19 eCAR T cells, Marino




Biotechnology




autologous Anti-CD19 4-1BB CART




Cells, Marino Biotechnology



22
HX-008




HX008




recombinant humanized anti-PD-1




monoclonal antibody



23
HLX-10




anti-PD-1 monoclonal antibody, Henlius




HLX10



24
GLS-010




AB 122




AB-122




AB122




GLS 010




GLS010



25
Cytoplasmic activated PD-1 CAR19 T




cell therapy, Pregene




CAR19 T cells carrying cytoplasmic




activated PD1 therapy, Pregene



26
CS-1003




CS1003



27
BI-754091




anti- PD-1 monoclonal antibody,




Boehringer Ingelheim




BI 754091



28
AK-105, Akeso Biopharma




AK105, Akeso Biopharma



29
AK-104




AK104




PDCD1 antibody, Akeso



30
AK-103




AK103



31
ABBV-181




ABBV 181




ABBV181



32
XmAb-23104




CD278/PDCD1 antibody, Xencor




XmAb 23104




XmAb23104



33
SNA-01




SNA 01




SNA01



34
sd-rxRNA anticancer therapy, RXi




Pharmaceuticals




SD-RXRNA, RXi Pharmaceuticals



35
RXI-762




cancer immunotherapies, MirImmune




cancer immunotherapies, RXi




Pharmaceuticals




RXI762



36
RB-M1




anti-mesothelin CAR-T therapy, Refuge




Biotech




RB M1




RBM1



37
RB-H21




anti-HER2 CAR-T therapy, Refuge




Biotech




RB H21




RBH21



38
RB-1916




RB 1916




RB1916



39
PRS-332




PDCD1 antibody, Pieris




PRS 332




PRS332



40
PEG-interferon-alpha2b + PD-1




inhibitor, PharmaEssentia




P-1101 + PD-1 inhibitor, PharmaEssentia




P1101 + PD-1 inhibitor, PharmaEssentia



41
PD-1/PD-L1 immune checkpoint




inhibitors, ImmunoBrain Checkpoint




PD-1/PD-L1 immune checkpoint




inhibitors, Lundbeck



42
PD-1 knockout CAR, Cellular




Biomedicine Group




PD-1 knockout chimeric antigen




receptor, Cellular Biomedicine Group



43
PD-1 inhibitors, Globavir



44
mimotope vaccine, Imugene



45
MGD-019




MGD019



P
D-1/CTLA4, MacroGenics



46
MCLA-134




MCLA134




PDCD1/HAVCR1 antibody, Merus



47
MAX-10129




MAX 10129




MAX10129



48
KF-082




KF 082




KF082




PD1 antibody, Akeso



49
JTX-4014




JTX4014



50
JBI-426




JBI 426




JBI426



51
immuno-oncology therapy, Olipass



52
IKT-202




IKT202



53
ENUM-388D4




anti-PD-1 antibodies, Enumeral




Biomedical




ENUM 388D4



54
DARPin anticancer therapy, Molecular




Partners




PD-1/VEGF multi-DARPin cancer




therapy, Molecular Partners



55
CX-188




CX188




PD-1 probodies, CytomX Therapeutics



56
CS-4100




CS 4100




CS4100



57
CAB-PD-1




CAB-PD 1




CABPD1



58
BH-2950




BH2950




PD-1/ERRB2 antibody, Hanmi



59
BH-2941




anti-PD-1/PD-L1 BsAb, Hanmi




BH2941




PD-1/PD-L1 antibody, Hanmi



60
AT-16201




AT 16201




AT16201



61
anticancer therapeutics, Bristol-Myers




Squibb




anticancer therapeutics, Halozyme




nivolumab, Bristol-Myers Squibb




nivolumab, Halozyme



62
anti-PD1 MAbs, Aduro BioTech



63
anti-PD-1 scFv + anti-CTLA4 scFv,




Anaeropharma




anti-CTLA4 scFv + anti-PD-1 scFv,




Anaeropharma



64
anti-PD-1 antibody, Tikcro



65
anti PD-1/TAA-3 antibody, Hanmi




anti TAA-3/PD-1 antibody, Hanmi




PD1/TAA3 antibody, Hanmi



66
anti PD-1/TAA-2 antibody, Hanmi




anti TAA-2/PD-1 antibody, Hanmi




PD1/TAA2 antibody, Hanmi



67
anti PD-1/TAA-1 antibody, Hanmi




anti PD-1/TAA-1 antibody, Innovent




immuno-oncology programme, Hanmi



68
AM-0001




AM 0001




anti-PD1 antibody, ARMO BioSciences



69
AK-123




AK 123




AK123




PD1 bispecific antibody, Akeso



70
AK-112




AK112




PD-1 bispecific antibody, Akeso



71
ENUM-244C8




anticancer MAbs, Enumeral Biomedical




ENUM 244C8



72
Sym-016




anticancer therapies, Symphogen-2




Sym016



73
STI-A1110




STI-1110




STI-A110X




STI1110




STIA110X




STIA1110



74
PEG-MP7




PEGMP7



75
PD-1 peptide antagonists, Aurigene




Discovery Technologies



76
mAb B60-55




B60 55




B60-55




mAb B60 55



77
INDUS-903




INDUS903



78
immune checkpoint inhibitors,




TheraVectys



79
IMM-1802




IMM 1802




IMM1802



80
cancer immunotherapies, Immunotherapy




Nantibody



81
bispecific PD-1/OX40 antibody, Immune




Pharmaceuticals




TNFRSF4/PD1 antibody, Immune




Pharmaceuticals



82
BH-2922




BH 2922




BH2922




EGFR/PD-1 antibody, Hanmi



83
AUNP-12




AUNP 12




AUNP12




AUR 012




AUR-012




W-014A




W014A



84
AP-106




AP106



85
anticancers, ArQule




anticancers, Beryllium



86
anti-PD1 antibody, Premier Biomedical



87
anti-PD-1 MAbs, PxRadia




anticancer immunotherapy, PxRadia



88
anti-PD-1 MAbs, Kadmon




Pharmaceuticals



89
anti-PD-1 MAb, Immunovo



90
anti-PD-1 bispecific antibodies, Innovent




Biologics




anti-PD-1 bispecific antibodies, Eli Lilly




bispecific molecules, Eli Lilly




bispecific molecules, Innovent Biologics




PD-1 bispecific antibody, Innovent




Biologics



91
anti PD-1 MAbs, Mabquest




anti PD-1 MAbs, Cellectis



92
ANB-011




ANA-011




ANA011




ANB011



93
AN-2005




AN2005



94
AMP-224




AMP224




GSK 2661380




GSK-2661380




GSK2661380









In some embodiments, the PD-1 signaling agent is a PD-L1 inhibitor provided in Table 4.









TABLE 4







PD-L1 inhibitors








PD-L1
Agent No. Drug Name and Synonyms











1
durvalumab



Imfinzi



MEDI 4736



MEDI-4736



MEDI4736


2
avelumab



anti PD-L1, Merck KGaA



Bavencio



MSB-0010718C



MSB0010718C



PF 06834635



PF-06834635


3
atezolizumab



MPDL-3280A



MPDL3280A



RG 7446



RG-7446



RG7446



RG7746



RO-5541267



RO5541267



Tecentriq


4
WBP-3155



CS 1001



CS-1001



CS1001



WBP 3155


5
IO-103



IO 103



IO103


6
CX-072



CX072



PD-L1 probodies, CytomX Therapeutics


7
CA-170



AUPM-170



AUPM170



PD-L1 inhibitors, Aurigene Discovery



Technologies



PD-L1 inhibitors, Curis


8
BGB-A333



anti PD-L1 MAb, BeiGene



BGB A333



BGBA333


9
SHR-1316



HTI-1088



HTI1088



SHR1316


10
MSB-2311



MSB 2311



MSB2311


11
M-7824



M7824



MSB0011359C


12
LY-3300054



anti PD-L1 Mab, Eli Lilly



LY 3300054



LY3300054


13
KN-035



3D-2-02-0015



KN035


14
FS-118



FS118



LAG3/CD274 antibody, f-star


15
FAZ-053



anti-PD-L1 antibody, Novartis-2



FAZ053


16
CK-301



anti-PD-L1 antibody, Checkpoint



Therapeutics



anti-PD-L1 antibody, TG Therapeutics



CK301


17
BMS-936559



anti-PD-L1 antibody, Bristol-Myers



Squibb



BMS936559



MDX-1105



MDX1105


18
BCD-135



BCD135


19
AK-106, Akeso



AK106, Akeso


20
trastuzumab/PD-L1 fusion protein,



Avacta


21
STI-A1014



STI-1014



STI1014



STIA1014



ZKAB-001



ZKAB001


22
SNA-02



anti-PD-L1 aptamer, Fountain BioPharma



SNA 02



SNA02


23
sd-rxRNA anticancer therapy, RXi



Pharmaceuticals



SD-RXRNA, RXi Pharmaceuticals


24
rituximab/PD-L1 fusion protein, Avacta


25
PD-L1/LAG-3 bispecific programme,



Avacta


26
PD-L1 inhibitors, Hitgen



PDL1 inhibitors, Hitgen


27
PD-L1 gene therapy, enGene


28
PD-L1 CAR.TNK, Sorrento Therapeutics



PDL1.taNK, NantKwest



PDL1.taNK, Sorrento Therapeutics


29
PD-L1 antagonist, Arbutus Biopharma



checkpoint inhibitors, Arbutus Biopharma


30
PD-1/PD-L1 immune checkpoint



inhibitors, ImmunoBrain Checkpoint



PD-1/PD-L1 immune checkpoint



inhibitors, Lundbeck


31
OT-2



OT2



OT2


32
ND-021



ND 021



ND021



PD-L1 antibody, Numab


33
MT-5050



MT 5050



MT5050


34
MEDI-1109



MEDI 1109



MEDI1109



TNFRSF4/PD-L1 antibody, AstraZeneca


35
MCLA-145



CD274 antibody, Merus



MCLA145


36
MAX-10129



MAX 10129



MAX10129


37
KY-1043



KY1043


38
KY-1003



KY1003


39
KD-033



KD033


40
JS-003



CD274 antibody, Shanghai



JS003


41
JBI-426



JBI 426



JBI426


42
ipilimumab/PD-L1, Avacta



ipilimumab/PD-L1 fusion protein, Avacta


43
immuno-oncology therapy, Olipass


44
immuno-oncology programme, Avacta


45
IMM-25



IMM 25



IMM25


46
IMC-2102



CD274 antibody, ImmuneOncia-2



IMC 2102


47
IMC-2101



CD274/U1 bispecific antibody,



ImmuneOncia



IMC 2101


48
IMC-001



IMC 001



IMC001



STI-A 1015



STI-A-1015



STI-A1015



STIA1015


49
IKT-703



IKT 703



IKT703


50
IKT-201



IKT201


51
HLX-20



HLX20


52
GX-P2



GXP2


53
FPT-155



CD80-Fc, Five Prime



FPT155


54
CS-4100



CS 4100



CS4100


55
CBT-502



CBT502



TQB-2450



TQB2450


56
cancer therapy, VLP Therapeutics


57
BH-2941



anti-PD-1/PD-L1 BsAb, Hanmi



BH2941



PD-1/PD-L1 antibody, Hanmi


58
bevacizumab/PD-L1, Avacta



bevacizumab/PD-L1 fusion protein,



Avacta


59
AVA-004



anti PD-L1 affimers, Avacta



AVA004



PDL1-182 Fc, Avacta


60
AUPM-327



AUPM327



CA-327



CA327



PD-L1/TIM3 dual inhibitors, Aurigene



PD-L1/TIM3 dual inhibitors, Curis



TIM3/PD-L1 dual inhibitors, Aurigene



TIM3/PD-L1 dual inhibitors, Curis


61
AP-105, AP Biosciences



AP105, AP Biosciences


62
anti-PD-L1 RRV, Tacogen



cancer-selective RRVs, Tocagen


63
anti-PD-L1 antibody, Tikcro


64
ALPN-202



ALPN202


65
ALN-PDL



PD-L1 siRNA, Alnylam


66
triple modulator, Fate Therapeutics


67
Toca-531



Toca 531


68
STI-B010X



STIB010X


69
STI-A1010



STI-A100X



STI-A1011



STI-A1012



STIA100X



STIA1010



STIA1011



STIA1012


70
programmed death ligand (PD-L1)



inhibitors, Regeneron



programmed death ligand (PD-L1)



inhibitors, Sanofi


71
PD-L1 x CTLA-4 immune checkpoints



antibodies, IGM Biosciences


72
PD-L1 MAb, Kadmon Corporation



PD-L1 MAb, Nantong Jinghua



Pharmaceuticals


73
PD-L1 MAb, Abeome


74
PD-L1 inhibitor, Bristol-Myers Squibb


75
PD-L1 immune checkpoint antibodies,



IGM Biosciences


76
mAb B60-55



B60 55



B60-55



mAb B60 55


77
immune checkpoint inhibitors,



TheraVectys


78
IMM-2504



IMM 2504



IMM2504


79
IMM-2503



IMM 2503



IMM2503


80
IMM-2502



IMM 2502



IMM2502


81
HTI-1316



HTI1316


82
cancer immunotherapies, Immunotherapy



Nantibody


83
bispecific PD-L1/BCMA antibody,



Immune Pharmaceuticals


84
BIPI



atezolizumab/IL-2 immunocytomkine,



Shanghai Zhangjiang Biotech


85
BGB-108



BGB108



PD-L1 MAb



PDL1 MAb


86
BBI-801



BBI801


87
anticancers, ArQule



anticancers, Beryllium



anti-PD-L1 antibody, CoStim


88
anti-PD-L1 antibody, Novartis



anti-c-Met/PD-L1 bispecific antibody,


89
Sorrento Therapeutics



MET/PD-L1 antibody, Sorrento









In some embodiments, a PD-1-binding agent is glycosylated and one or more sites. As used herein, “glycan” is a sugar polymer (moiety) component of a glycoprotein. The term “glycan” encompasses free glycans, including glycans that have been cleaved or otherwise released from a glycoprotein. In some embodiments, present disclosure provides a composition comprising one or more glycoforms of a heavy chain, light chain, and/or antibody agent as described herein. In some embodiments, a glycan is N-linked to an Fc region. In some embodiments, a PD-1-binding agent is glycosylated at Asn297 (Kabat numbering).


The term “glycoform” is used herein to refer to a particular form of a glycoprotein. That is, when a glycoprotein includes a particular polypeptide that has the potential to be linked to different glycans or sets of glycans, then each different version of the glycoprotein (i.e., where the polypeptide is linked to a particular glycan or set of glycans) is referred to as a “glycoform.” In some embodiments, a provided composition comprises a plurality of glycoforms of one or more of an heavy chain, light chain, and/or antibody agent as described herein.


In some embodiments a PD-1-binding agent binds with high affinity to human and cynomolgus monkey PD-1. In some embodiments, binding of a PD-1-binding agent can be characterized by surface plasma resonance (SPR). In some embodiments, SPR measurements may demonstrate or confirm binding of a PD-1 signaling agent a to human and/or a cynomolgus monkey PD-1 Fc fusion. In some embodiments, a PD-1-binding agent binds human and cynomolgus PD-1 with a fast association rate, slow dissociation rate, and high affinity.


In some embodiments, antagonist activity of a PD-1-binding agent in blocking the PD-1/PD-L1 or PD-L2 interaction may be confirmed or determined using a flow cytometry-based assay that measured binding of labeled PD-L1 and PD-L2 expressed as a mouse IgG1 Fc fusion proteins (PD-L1 mFc or PD-L2 mFc) to PD-1-expressing cells. In some embodiments, a PD-1-binding agent can efficiently block PD-1/PD-L1 and PD-1/PD-L2 binding compared to an IgG4 isotype control.


In some embodiments, a PD-1-binding agent can effectively neutralize PD-1 activity (e.g., can inhibit binding of PD-1 to PD-L1 and PD-L2). In some embodiments, functional antagonist activity of a PD-1-binding agent may be confirmed or determined in a mixed lymphocyte reaction (MLR) demonstrating enhanced interleukin (IL)-2 production upon addition of a PD-1-binding agent. In some embodiments, a MLR assay may be carried out using primary human CD4+ T cells as responders and human dendritic cells as stimulators.


In some embodiments, a PD-1 signaling agent is expressed from a vector comprising one or more nucleic acid sequences encoding a PD-1-binding immunoglobulin heavy chain variable domain polypeptide and/or a PD-1-binding immunoglobulin light chain variable domain polypeptide. In some embodiments, a PD-1 signaling agent is expressed from a vector comprising one or more nucleic acid sequences encoding a PD-1-binding immunoglobulin heavy chain polypeptide and/or a PD-1-binding immunoglobulin light chain polypeptide. The vector can be, for example, a plasmid, episome, cosmid, viral vector (e.g., retroviral or adenoviral), or phage. Suitable vectors and methods of vector preparation are well known in the art (see, e.g., Sambrook et al., Molecular Cloning, a Laboratory Manual, 3rd edition, Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (2001), and Ausubel et al, Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, New York, N.Y. (1994)).


In some embodiment, vector(s) for expression of PD-1-binding agents further comprises expression control sequences, such as promoters, enhancers, polyadenylation signals, transcription terminators, internal ribosome entry sites (IRES), and the like, that provide for the expression of the coding sequence in a host cell. Exemplary expression control sequences are known in the art and described in, for example, Goeddel, Gene Expression Technology: Methods in Enzymology, Vol. 185, Academic Press, San Diego, Calif. (1990).


The vector(s) comprising the nucleic acid(s) encoding PD-1-binding agents of the present disclosure can be introduced into a host cell that is capable of expressing the polypeptides encoded thereby, including any suitable prokaryotic or eukaryotic cell. Some preferable qualities of host cells include easy and reliable growth, a reasonably fast growth rate, having well-characterized expression systems, and/or ease/efficient transformation or transfection.


In some embodiments, mammalian cells are utilized. A number of suitable mammalian host cells are known in the art, and many are available from the American Type Culture Collection (ATCC, Manassas, Va.). Examples of suitable mammalian cells include, but are not limited to, Chinese hamster ovary cells (CHO) (ATCC No. CCL61), CHO DHFR-cells (Urlaub et al, Proc. Natl. Acad. Sci. USA, 97: 4216-4220 (1980)), human embryonic kidney (HEK) 293 or 293T cells (ATCC No. CRL1573), and 3T3 cells (ATCC No. CCL92). Other suitable mammalian cell lines are the monkey COS-1 (ATCC No. CRL1650) and COS-7 cell lines (ATCC No. CRL1651), as well as the CV-1 cell line (ATCC No. CCL70).


Further exemplary mammalian host cells include primate cell lines and rodent cell lines, including transformed cell lines. Normal diploid cells, cell strains derived from in vitro culture of primary tissue, as well as primary explants, are also suitable. Other suitable mammalian cell lines include, but are not limited to, mouse neuroblastoma N2A cells, HeLa, mouse L-929 cells, and BHK or HaK hamster cell lines, all of which are available from the ATCC. Methods for selecting suitable mammalian host cells and methods for transformation, culture, amplification, screening, and purification of cells are known in the art.


In some embodiments, the mammalian cell is a human cell. For example, the mammalian cell can be a human lymphoid or lymphoid derived cell line, such as a cell line of pre-B lymphocyte origin. Examples of human lymphoid cells lines include, without limitation, RAMOS (CRL-1596), Daudi (CCL-213), EB-3 (CCL-85), DT40 (CRL-2111), 18-81 (Jack et al, Proc. Natl. Acad. Sci. USA, 85: 1581-1585 (1988)), Raji cells (CCL-86), and derivatives thereof.


In some embodiments, a PD-1-binding agent is formulated as a pharmaceutical composition, containing one or a combination of monoclonal antibodies, or antigen-binding portion(s) thereof, formulated with a pharmaceutically acceptable carrier. An anti-PD-1 antibody agent may be formulated alone or in combination with other drugs (e.g., as an adjuvant). For example, a PD-1-binding agent can be administered in combination with other agents for the treatment or prevention of the diseases disclosed herein (e.g., cancer).


Therapeutic compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. In many cases, it may be useful to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.


Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the ease of sterile powders is the preparation of sterile injectable solutions, such methods of preparation may include vacuum drying and freeze-drying (lyophilization) to yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.


In some embodiments, a therapeutic composition is formulated as a sterile liquid. In some embodiments, the composition is free from visible particles. In some embodiments, the composition is formulated in a buffer (e.g., a citrate buffer). In some embodiments, the composition comprises a PD-1-binding agent and two or more of the following: citrate, arginine, sodium chloride and polysorbate 80.


In some embodiments, a therapeutic composition of the present disclosure (e.g., a PD-1 binding agent) is aseptically filled into a clear glass vial. In some embodiments, such a glass vial is stoppered with a chlorobutyl elastomer stopper laminated with fluoropolymer and sealed with an aluminum overseal.


In some embodiments, a PD-1 signaling agent is stored at 2-8° C. In some embodiments, a drug product of the present disclosure is free of preservatives.


General Protocol


As described herein, provided methods comprise administering a PD-1 signaling agent to a patient, a subject, or a population of subjects according to a regimen that achieves clinical benefit.


Provided methods can provide various benefits (e.g., a clinical benefit). In embodiments, a method described herein achieves a clinical benefit. In embodiments, a clinical benefit is stable disease (SD). In embodiments, a clinical benefit is a partial response (PR). IN embodiments, a clinical benefit is a complete response (CR).


In embodiments, a combination therapy achieves a clinical benefit for each therapy administered to a patient. For example, a combination therapy may improve a clinical benefit obtained with a PD-1 inhibitor (e.g., any anti-PD-1 antibody described herein).


In embodiments, a patient or subject is an animal. In embodiments, a patient or subject is a human.


In some embodiments, the regimen comprises at least one parental dose of a PD-1 binding agent. In some embodiments, the regimen comprises a plurality of parental doses.


In some embodiments, the parental dose is an amount of a PD-1 signaling agent is within a range of about 5 to about 5000 mg (e.g., about 5 mg, about 10 mg, about 50 mg, about 100 mg, about 200 mg, about 300 mg, about 400 mg, about 500 mg, about 600 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mg, about 1100 mg, about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg, about 2000 mg, about 3000 mg, about 4000 mg, about 5000 mg, or a range defined by any two of the foregoing values). In some embodiments, the parental dose of a PD-1 signaling agent is 500 mg or 1000 mg.


In some embodiments, the dose is in an amount relative to body weight. In some embodiments, the parental dose of a PD-1 signaling agent is within a range of about 0.01 mg/kg to 100 mg/kg of animal or human body weight; however, doses below or above this exemplary range are within the scope of the invention. The daily parenteral dose can be about 0.01 mg/kg to about 50 mg/kg of total body weight (e.g., about 0.1 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 12 mg/kg, about 15 mg/kg, about 20 mg/kg, or a range defined by any two of the foregoing values).


In some embodiments, a composition that delivers a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered to a patient at a dose of about 1, 3 or 10 mg/kg. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 1, 3 or 10 mg/kg every two weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 1, 3 or 10 mg/kg every three weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 1, 3 or 10 mg/kg every four weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 1 mg/kg every three weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 3 mg/kg every three weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 10 mg/kg every three weeks.


In some embodiments, a composition that delivers a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered to a patient at a dose of about 400 mg. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 400 mg every two weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 400 mg every three weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 400 mg every four weeks.


In some embodiments, a composition that delivers a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered to a patient at a dose of about 500 mg. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 500 mg every two weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 500 mg every three weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 500 mg every four weeks.


In some embodiments, a composition that delivers a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered to a patient at a dose of about 800 mg. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 800 mg every three weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 800 mg every four weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 800 mg every six weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 800 ng every eight weeks.


In some embodiments, a composition that delivers a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered to a patient at a dose of about 1,000 mg. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 1,000 mg every three weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 1,000 mg every four weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 1,000 ng every five weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 1,000 mg every six weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 1,000 mg every seven weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 1,000 mg every eight weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 1,000 mg every nine weeks.


In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 500 mg every three weeks. In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a dose of about 1000 mg every six weeks.


In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a first dose of PD-1-binding agent for the first 2-6 dosing cycles (e.g., the first 3, 4, or 5 dosing cycles), and then delivers a second dose of a PD-1-binding agent for the subsequent dosing cycles until therapy is discontinued (e.g., due to disease progression or an adverse effect or as directed by a physician). In some embodiments, the duration of the first set of 2-6 dosing cycles (e.g., the first 3, 4, or 5 dosing cycles) is different from the duration of the subsequent dosing cycles. In embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a first dose of PD-1-binding agent once every three weeks for the first three dosing cycles, and then delivers a second dose of a PD-1-binding agent once every six weeks or more for the remaining dosing cycles (e.g., a second dose of a PD-1-binding agent once every six weeks for the remaining dosing cycles). In embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a first dose of PD-1-binding agent once every three weeks for the first four dosing cycles, and then delivers a second dose of a PD-1-binding agent once every six weeks or more for the remaining dosing cycles (e.g., a second dose of a PD-1-binding agent once every six weeks for the remaining dosing cycles). In embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a first dose of PD-1-binding agent once every three weeks for the first five dosing cycles, and then delivers a second dose of a PD-1-binding agent once every six weeks or for the remaining dosing cycles (e.g., a second dose of a PD-1-binding agent once every six weeks for the remaining dosing cycles). In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a first dose of PD-1-binding agent once every three weeks for the first 2-6 dosing cycles (e.g., the first 3, 4, or 5 dosing cycles), and then delivers a second dose of a PD-1-binding agent once every six weeks or until therapy is discontinued (e.g., due to disease progression or an adverse effect or as directed by a physician). In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that delivers a first dose of a PD-1-binding agent once every three weeks for the first 3, 4 or 5 dosing cycles (e.g., the first 4 dosing cycles), and then delivers a second dose of a PD-1-binding agent once every six weeks or more until therapy is discontinued (e.g., due to disease progression or an adverse effect or as directed by a physician). In embodiments, the method comprises delivering a second dose of PD-1 signaling agent once every six weeks until therapy is discontinued.


In some embodiments the first and/or second dose of a PD-1-binding agent (e.g., an anti-PD-1 antibody) is about 100 mg to about 2,000 mg (e.g., about 100 mg, about 200 mg, about 300 mg, about 400 mg, about 500 mg, about 600 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mug, about 1100 mg, about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mug, about 1600 mg, about 1700 mg, about 1800 mg, about 1900 mg, or about 2000 mg). In some embodiments the first close and the second dose are the same. In some embodiments, the first dose and the second dose are different. In embodiments the first dose is about 500 mg of a PD-1-binding agent (e.g., an anti-PD-1 antibody). In embodiments, the first dose is about 1000 mg of a PD-1-binding agent (e.g., an anti-PD-1 antibody).


In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that comprises administering an about 500 mg dose every 3 weeks for four doses followed by administering at least one about 1,000 mg dose every six weeks after the fourth dose of about 500 ng. In some embodiments, additional about 1,000 mg doses are administered every six weeks after the first about 1000 mg dose until no further clinical benefit is achieved. In some particular embodiments, a PD-1 signaling agent (e.g., an anti-PD1 antibody) is administered according to a dosing regimen that includes 500 mg for 4 cycles Q3W followed by 1000 mg Q6W.


In some embodiments, a PD-1-binding agent (e.g., an anti-PD-1 antibody) is administered according to a regimen that comprises administering a 400 mg dose every 3 weeks for four doses followed by administering at least one 800 mg dose every six weeks after the fourth 400 mg close. In some embodiments, additional 800 mg doses are administered every six weeks after the first 800 mg dose until no further clinical benefit is achieved. In some particular embodiments, a PD-1 signaling agent (e.g., an anti-PD1 antibody) is administered according to a dosing regimen that includes 400 mg for 4 cycles Q3W followed by 800 mg Q6W.


Therapeutic or prophylactic efficacy can be monitored by periodic assessment of treated patients. For repeated administrations over several days or longer, depending on the condition, the treatment can be repeated until a desired suppression of disease symptoms occurs. However, other dosage regimens may be useful and are within the scope of the invention.


The desired dosage can be delivered by a single bolus administration of the composition, by multiple bolus administrations of the composition, or by continuous infusion administration of the composition.


In some embodiments, a PD-1 signaling agent is administered to a patient or population of subjects who has exhibited response to prior therapy. In some embodiments, the patient or population of subjects has exhibited response to a prior cancer therapy.


In some embodiments, a PD-1 signaling agent is administered to a patient or population of subjects who has not exhibited response to prior therapy. In some embodiments, the patient or population of subjects has not received or exhibited response to a prior cancer therapy.


In embodiments, a subject is resistant to treatment with an agent that inhibits PD-1. In embodiments, a subject is refractory to treatment with an agent that inhibits PD-1. In embodiments, a method described herein sensitizes the subject to treatment with an agent that inhibits PD-1.


Combination Therapy


Provided herein are methods that comprise administering a first therapeutic agent (e.g., an immune checkpoint inhibitor) in combination with one or more additional therapeutic agents.


In embodiments, an anti-PD-1 therapy as described herein is administered in combination with one or more additional therapies (e.g., therapies as described herein). That is, a subject is treated with an anti-PD-1 therapy and one or more additional therapies is administered to a subject such that the subject receives each therapy.


In embodiments, an additional therapy is surgery. In embodiments, an additional therapy is radiotherapy. In embodiments, an additional therapy is chemotherapy. In embodiments, an additional therapy is immunotherapy.


In some embodiments, a PD-1 signaling agent is administered simultaneously or sequentially with an additional therapeutic agent, such as, for example, another antibody agent (e.g., an antibody agent that binds a checkpoint inhibitor and/or a chemotherapeutic agent). In some embodiments, a PD-1 signaling agent is administered before, during, or after administration of an additional therapeutic agent. In some embodiments, a PD-1 signaling agent is administered before, during, or after administration of a chemotherapeutic agent.


An anti-PD-1 antibody agent may be administered alone or in combination with other drugs (e.g., as an adjuvant). For example, the PD-1 binding agent can be administered in combination with other agents for the treatment or prevention of the diseases disclosed herein (e.g., cancer). In this respect, the PD-1 binding agent can be used in combination with at least one other anticancer agent including, for example, any chemotherapeutic agent known in the art, ionization radiation, small molecule anticancer agents, cancer vaccines, biological therapies (e.g., other monoclonal antibodies, cancer-killing viruses, gene therapy, and adoptive TF-cell transfer), and/or surgery.


Administration of a PD-1 signaling agent simultaneously or sequentially with an additional therapeutic agent is referred to herein as “combination therapy.” In combination therapy, a PD-1 signaling agent can be administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48, hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concurrently with, or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of the additional therapeutic agent to a subject in need thereof. In some embodiments a PD-1 signaling agent and an additional therapeutic agent are administered 1 minute apart, 10 minutes apart, 30 minutes apart, less than 1 hour apart, 1 hour to 2 hours apart, 2 hours to 3 hours apart, 3 hours to 4 hours apart, 4 hours to 5 hours apart, 5 hours to 6 hours apart, 6 hours to 7 hours apart, 7 hours to 8 hours apart, 8 hours to 9 hours apart, 9 hours to 10 hours apart, 10 hours to 11 hours apart, 11 hours to 12 hours apart, no more than 24 hours apart, or no more than 48 hours apart.


Check-Point Inhibitors


In embodiments, an additional therapy is an immunotherapy. In embodiments, an immunotherapy comprises administration of one or more further immune checkpoint inhibitors (e.g., administration of one, two, three, four, or more further immune checkpoint inhibitors).


Exemplary immune checkpoint targets for inhibition include: PD-1 (e.g., inhibition via anti-PD-1, anti-PD-L1, or anti-PD-L2 therapies), CTLA-4, TIM-3. TIGIT, LAGs (e.g., LAG-3), CEACAM (e.g., CEACAM-1, -3 and/or -5), VISTA, BTLA, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GALS, adenosine, TGFR (e.g., TGFR beta), B37-H1, B7-H4 (VTCN1), OX-40, CD137, CD40, IDO, and CSF-1R. Accordingly, agents that inhibit of any of these molecules can be used in combination with an anti-PD-1 therapy described herein.


In embodiments, an immune checkpoint inhibitor is a CTLA-4 inhibitor (e.g., an antibody, an antibody conjugate, or an antigen-binding fragment thereof). In embodiments, a CTLA-4 inhibitor is a small molecule, a nucleic acid, a polypeptide (e.g., an antibody), a carbohydrate, a lipid, a metal, or a toxin. In embodiments, a CTLA-4 inhibitor is a small molecule. In embodiments, a CTLA-4 inhibitor is a CTLA-4 binding agent. In embodiments, a CTLA-4 inhibitor is an antibody, an antibody conjugate, or an antigen-binding fragment thereof.


In embodiments, a CTLA-4 inhibitor is a CTLA-4 antibody described herein. In embodiments, a CTLA-4 inhibitor is ipilimumab (Yervoy), AGEN1884, or tremelimumab.


In embodiments, a checkpoint inhibitor is a small molecule, a nucleic acid, a polypeptide (e.g., an antibody), a carbohydrate, a lipid, a metal, a toxin, or a binding agent. In embodiments, a checkpoint inhibitor is an antibody, an antibody conjugate, or an antigen-binding fragment thereof.


In embodiments, an immune checkpoint inhibitor is an agent that inhibits TIM-3, CTLA-4, LAG-3, TIGIT, IDO or CSF1R.


For female patients of childbearing potential, it is preferable that the patient have a negative serum pregnancy test within 72 hours prior to the date of administration of the first dose of an anti-PD-1 binding agent. It is also preferable that female patients of childbearing potential and male patients agree to use 2 adequate methods of contraception with their partner. In some embodiments, a patient agrees to use 2 methods of contraception starting with the screening visit through 150 days after the last dose of study therapy.


V. Masked Anti-CTLA4 Binding Protein Preparation

The masked anti-CTLA4 binding proteins described herein are prepared using techniques available in the art, exemplary methods of which are described in more detail in the following sections.


I. Masked Anti-CTLA4 Binding Protein: Antibody Fragments


The present invention encompasses antibody fragments as masked anti-CTLA4 binding proteins. Masked antibody fragments may be generated by traditional means, such as enzymatic digestion, or by recombinant techniques. In certain circumstances there are advantages of using masked antibody fragments, rather than whole antibodies. For a review of certain antibody fragments, see Hudson et al. (2003) Nat. Med. 9:129-134.


Various techniques have been developed for the production of antibody fragments. Traditionally, these fragments were derived via proteolytic digestion of intact antibodies (see, e.g., Morimoto et al., Journal of Biochemical and Biophysical Methods 24:107-117 (1992); and Brennan et al., Science, 229:81 (1985)). However, these fragments can now be produced directly by recombinant host cells. Fab, Fv and ScFv antibody fragments can all be expressed in and secreted from E. coli and other cell types, thus allowing the facile production of large amounts of these masked fragments. Alternatively, masked Fab′-SH fragments can be directly recovered from culture media and chemically coupled to form F(ab′)2 fragments (Canter et al, Bio/Technology 10: 163-167 (1992)). According to another approach, tasked F(ab′)2 fragments can be isolated directly from recombinant host cell culture. Masked Fab and F(ab′)2 fragment with increased in vivo half-life comprising FcRN/salvage receptor binding epitope residues are described in U.S. Pat. No. 5,869,046. Other techniques for the production of masked antibody fragments will be apparent to the skilled practitioner. In certain embodiments, a masked antibody is a single chain Fv fragment (scFv). See WO 93/16185; U.S. Pat. Nos. 5,571,894; and 5,587,458. Fv and scFv are the only species with intact combining sites that are devoid of constant regions; thus, they may be suitable for reduced nonspecific binding during in vivo use. scFv fusion proteins may be constructed to yield fusion of an effector protein at either the amino or the carboxy terminus of an scFv. See Antibody Engineering, ed. Borrebaeck, supra. Also, bi-scFv comprising two scFvs linked via a polypeptide linker can be used as a bispecific antibody. Alternatively, multi-scFv comprising three or more scFvs may be used as a multispecific antibody.


The present invention includes a linear antibody (e.g., as described in U.S. Pat. No. 5,641,870) or a single chain immunoglobulin comprising heavy and light chain sequences of the antibody linked via an appropriate linker. Such linear antibodies or immunoglobulins may be monospecific or bispecific. Such a single chain immunoglobulin can be dimerized to thereby maintain a structure and activities similar to those of the antibody, which is originally a tetramer. Also, the antibody of the present invention may be an antibody that has a single heavy chain variable region and has no light chain sequence. Such an antibody, called a single domain antibody (sdAb) or a nanobody. These antibodies are also encompassed in the meaning of the functional fragment of the antibody according to the present invention.


2. Masked Anti-CTLA4 Binding Protein: Humanized Antibodies


The invention encompasses masked humanized antibodies. Humanized antibodies are masked according to the guidance provided herein. Various methods for humanizing non-human antibodies are known in the art. For example, a humanized antibody can have one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as “import” residues, which are typically taken from an “import” variable domain. Humanization can be essentially performed following the method of Winter (Jones et al. (1986) Nature 321:522-525; Riechmann et al. (1988) Nature 332:323-327; Verhoeyen et al. (1988) Science 239:1534-1536), by substituting hypervariable region sequences for the corresponding sequences of a human antibody. Accordingly, such “humanized” antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some hypervariable region residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.


3. Masked Anti-CTLA4 Binding Protein: Human Antibodies


Human anti-CTLA4 antibodies of the invention can be constructed by combining Fv clone variable domain sequence(s) selected from human-derived phage display libraries with known human constant domain sequences(s). Alternatively, human monoclonal anti-CTLA4 antibodies of the invention can be made by the hybridoma method. Human myeloma and murine-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described, for example, by Kozbor J. Immunol., 133: 3001 (1984); Brodeur et at, Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al., J. Immunol., 147: 86 (1991).


Human antibodies are masked according to the guidance provided herein.


4. Masked Anti-CTLA4 Binding Protein: Bispecific Antibodies


Bispecific antibodies are monoclonal antibodies that have binding specificities for at least two different antigens. In certain embodiments, bispecific antibodies are human or humanized antibodies. In certain embodiments, one of the binding specificities is for CTLA4 and the other is for any other antigen. In certain embodiments, bispecific antibodies may bind to two different epitopes of CTLA4. Bispecific antibodies may also be used to localize cytotoxic agents to cells which express CTLA4. Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g. F(ab′)2 bispecific antibodies). Bispecific antibodies are masked according to the guidance provided herein.


Methods for making bispecific antibodies are known in the art. See Milstein and Cuello, Nature, 305: 537 (1983), WO 93/08829 published May 13, 1993, Traunecker et al., EMBO J., 10: 3655 (1991); Kontermann and Brinkmann, Drug Discovery Today, 20(7):838-847. For further details of generating bispecific antibodies see, for example, Suresh et al., Methods in Enzymology, 121:210 (1986). Bispecific antibodies include cross-linked or “heteroconjugate” antibodies. For example, one of the antibodies in the heteroconjugate can be coupled to avidin, the other to biotin. Heteroconjugate antibodies may be made using any convenient cross-linking method. Suitable cross-linking agents are well known in the art, and are disclosed in U.S. Pat. No. 4,676,980, along with a number of cross-linking techniques.


5. Masked Anti-CTLA4 Binding Protein: Single-Domain Antibodies


In some embodiments, a single-domain antibody is masked in accordance with the guidance provided herein. A single-domain antibody is a single polypeptide chain comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody. In certain embodiments, a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham, Mass.; see, e.g., U.S. Pat. No. 6,248,516 B1). In one embodiment, a single-domain antibody consists of all or a portion of the heavy chain variable domain of an antibody.


6. Masked Anti-CTLA4 Binding Protein: Antibody Variants


In some embodiments, amino acid sequence modification(s) of the masked antibodies described herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the masked antibody. Amino acid sequence variants of the antibody may be prepared by introducing appropriate changes into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics. The amino acid alterations may be introduced in the subject antibody amino acid sequence at the time that sequence is made.


A useful method for identification of certain residues or regions of the antibody that are preferred locations for mutagenesis is called “alanine scanning mutagenesis” as described by Cunningham and Wells (1989) Science, 244:1081-1085. Here, a residue or group of target residues are identified (e.g., charged residues such as Arg, Asp, His, Lys, and Glu) and replaced by a neutral or negatively charged amino acid (e.g., alanine or polyalanine) to affect the interaction of the amino acids with antigen. Those amino acid locations demonstrating functional sensitivity to the substitutions then are refined by introducing further or other variants at, or for, the sites of substitution. Thus, while the site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be predetermined. For example, to analyze the performance of a mutation at a given site, Ala scanning or random mutagenesis is conducted at the target codon or region and the expressed immunoglobulins are screened for the desired activity.


Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme or a polypeptide which increases the serum half-life of the antibody.


In some embodiments, FcRn mutations that improve pharmacokinetics include, but are not limited to, M428L, T250Q/M428L, M252Y/S254T/T256E, P257I/N4341-H, D376V/N434H, P257I/Q3111, N434A, N434W, M428L/N434S, V259I/V308F, M252Y/S254T/T256E, V259I/V308F/M428L, T307Q/N434A, T307Q/N434S, T307Q/F380A/N434A, V308P/N434A, N4341H, V308P. In some embodiments, such mutations enhance antibody binding to FcRn at low pH but do not change the antibody affinity at neutral pH.


In certain embodiments, an antibody of the invention is altered to increase or decrease the extent to which the antibody is glycosylated. Glycosylation of polypeptides is typically either N-linked or O-linked. N-linked refers to the attachment of a carbohydrate moiety to the side chain of an asparagine residue. The tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site. O-linked glycosylation refers to the attachment of one of the sugars N-aceyigalactosanine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.


Addition or deletion of glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that one or more of the above-described tripeptide sequences (for N-linked glycosylation sites) is created or removed. The alteration may also be made by the addition, deletion, or substitution of one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).


Where the antibody comprises an Fe region, the carbohydrate attached thereto may be altered. For example, antibodies with a mature carbohydrate structure that lacks fucose attached to an Fc region of the antibody are described in US Pat Appl No US 2003/0157108 (Presta, L). See also US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd). Antibodies with a bisecting N-acetylglucosamine (GlcNAc) in the carbohydrate attached to an Fe region of the antibody are referenced in WO 2003/011878, Jean-Mairet et al. and U.S. Pat. No. 6,602,684, Umana et al. Antibodies with at least one galactose residue in the oligosaccharide attached to an Fc region of the antibody are reported in WO 1997/30087, Patel et al. See, also, WO 1998/58964 (Raju, S.) and WO 1999/22764 (Raju, S.) concerning antibodies with altered carbohydrate attached to the Fe region thereof. See also US 2005/0123546 (Umana et al.) on antigen-binding molecules with modified glycosylation.


In certain embodiments, a glycosylation variant comprises an Fe region, wherein a carbohydrate structure attached to the Fe region lacks fucose or has reduced fucose. Such variants have improved ADCC function. Optionally, the Fe region further comprises one or more amino acid substitutions therein which further improve ADCC, for example, substitutions at positions 298, 333, and/or 334 of the Fc region (FU numbering of residues). Examples of publications related to “afucosylated,” “defucosylated” or “fucose-deficient” antibodies include: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119: WO 2003/084570; WO 2005/035586; WO 2005/035778; WO2005/053742; Okazaki et al. J. Mol. Biol. 336:1239-1249 (2004); Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Examples of cell lines producing defucosylated antibodies include Lec13 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Pat Appl No US 2003/0157108 A1, Presta, L; and WO 2004/056312 A1, Adams et al., especially at Example 11), and knockout cell lines, such as alpha-1,6-fucosyltransferase gene, FUT8, knockout CHO cells (Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004)), and cells overexpressing β1,4-N-acetylglycosminyltransferase III (GnT-III) and Golgi μ-mannosidase II (ManII).


In any of the embodiments herein, the masked anti-CTLA4 binding proteins can be engineered to improve antibody-dependent cell-mediated cytotoxicity (ADCC) activity. In some embodiments, the masked anti-CTLA4 binding protein may be produced in a cell line having a alpha 1,6-fucosyltransferase (Fut8) knockout. In some further embodiments, the masked anti-CTLA4 binding protein may be produced in a cell line overexpressing β1,4-N-acetylglycosminyltransferase III (GnT-III). In further embodiments, the cell line additionally overexpresses Golgi μ-mannosidase II (ManII). In some of the embodiments herein, the masked anti-CTLA4 binding protein may comprise at least one amino acid substitution in the Fe region that improves ADCC activity.


In one embodiment, the masked antibody is altered to improve its serum half-life. To increase the serum half-life of the antibody, one may incorporate a FcRN/salvage receptor binding epitope into the antibody (especially an antibody fragment) as described in U.S. Pat. No. 5,739,277, for example. As used herein, the term “salvage receptor binding epitope” refers to an epitope of the Fe region of an IgG molecule (e.g., IgG1, IgG2, IgG3, or IgG4) that is responsible for increasing the in vivo serum half-life of the IgG molecule (US 2003/0190311, U.S. Pat. Nos. 6,821,505; 6,165,745; 5,624,821; 5,648,260; 6,165,745; 5,834,597).


Another type of variant is an amino acid substitution variant. These variants have at least one amino acid residue in the antibody molecule replaced by a different residue. Sites of interest for substitutional mutagenesis include the hypervariable regions, but FR alterations are also contemplated. Conservative substitutions are shown in Table 5 under the heading of “preferred substitutions.” If such substitutions result in a desirable change in biological activity, then more substantial changes, denominated “exemplary substitutions” in Table 5, or as further described below in reference to amino acid classes, may be introduced and the products screened.









TABLE 5







Amino Acid Substitutions









Original

Preferred


Residue
Exemplary Substitutions
Substitutions





Ala (A)
Val; Leu; Ile
Val


Arg (R)
Lys; Gln; Asn
Lys


Asn (N)
Gln; His; Asp, Lys; Arg
Gln


Asp (D)
Glu; Asn
Glu


Cys (C)
Ser; Ala
Ser


Gln (Q)
Asn; Glu
Asn


Glu (E)
Asp; Gln
Asp


Gly (G)
Ala
Ala


His (H)
Asn; Gln; Lys; Arg
Arg


Ile (I)
Leu; Val; Met; Ala; Phe;
Leu



Norleucine



Leu (L)
Norleucine; Ile; Val; Met; Ala;
Ile



Phe



Lys (K)
Arg; Gln; Asn
Arg


Met (M)
Leu; Phe; Ile
Leu


Phe (F)
Trp; Leu; Val; Ile; Ala; Tyr
Tyr


Pro (P)
Ala
Ala


Ser (S)
Thr
Thr


Thr (T)
Val; Ser
Ser


Trp (W)
Tyr; Phe
Tyr


Tyr (Y)
Trp; Phe; Thr; Ser
Phe


Val (V)
Ile; Leu; Met; Phe; Ala;
Leu



Norleucine









Substantial modifications in the biological properties of the antibody are accomplished by selecting substitutions that differ significantly in their effect on maintaining the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or c) the bulk of the side chain. Amino acids may be grouped according to similarities in the properties of their side chains (in A. L. Lehninger, in Biochemistry, second ed., pp. 73-75, Worth Publishers, New York (1975)):

    • (1) non-polar: Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M)
    • (2) uncharged polar: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q)
    • (3) acidic: Asp (D), Glu (F)
    • (4) basic: Lys (K), Arg (R), His (H)


Alternatively, naturally occurring residues may be divided into groups based on common side-chain properties:

    • (1) hydrophobic: Norleucine. Met, Ala, Val, Leu, Ile;
    • (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gin;
    • (3) acidic: Asp, Glu;
    • (4) basic: His, Lys, Arg;
    • (5) residues that influence chain orientation: Gly, Pro;
    • (6) aromatic: Trp, Tyr, Phe.


Non-conservative substitutions will entail exchanging a member of one of these classes for another class. Such substituted residues also may be introduced into the conservative substitution sites or, into the remaining (non-conserved) sites.


One type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g., a humanized or human antibody). Generally, the resulting variant(s) selected for further development will have modified (e.g., improved) biological properties relative to the parent antibody from which they are generated. A convenient way for generating such substitutional variants involves affinity maturation using phage display. Briefly, several hypervariable region sites (e.g., 6-7 sites) are mutated to generate all possible amino acid substitutions at each site. The antibodies thus generated are displayed from filamentous phage particles as fusions to at least part of a phage coat protein (e.g., the gene III product of M13) packaged within each particle. The phage-displayed variants are then screened for their biological activity (e.g., binding affinity). In order to identify candidate hypervariable region sites for modification, scanning mutagenesis (e.g., alanine scanning) can be performed to identify hypervariable region residues contributing significantly to antigen binding. Alternatively, or additionally, it may be beneficial to analyze a crystal structure of the antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues are candidates for substitution according to techniques known in the art, including those elaborated herein. Once such variants are generated, the panel of variants is subjected to screening using techniques known in the art, including those described herein, and antibodies with superior properties in one or more relevant assays may be selected for further development.


Nucleic acid molecules encoding amino acid sequence variants of the masked antibody are prepared by a variety of methods known in the art. These methods include, but are not limited to, isolation from a natural source (in the case of naturally occurring amino acid sequence variants) or preparation by oligonucleotide-mediated (or site-directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared variant or a non-variant version of the antibody.


It may be desirable to introduce one or more amino acid modifications in an Fc region of antibodies of the invention, thereby generating an Fc region variant. The Fe region variant may comprise a human Fc region sequence (e.g., a human IgG1, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions including that of a hinge cysteine.


1 In some embodiments, an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof, or activatable masked anti-CTLA4 bispecific antibody) provided herein has an IgG1 isotype with enhanced effector function. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof is afucosylated. In some embodiments, the activatable masked anti-CTLA4 bispecific antibody is afucosylated. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof has increased levels of mannose moieties. In some embodiments, the activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof has increased levels of bisecting glycan moieties. In some embodiments, the activatable masked anti-CTLA4 bispecific antibody has increased levels of mannose moieties. In some embodiments, the IgG1 comprises amino acid mutations.


In some embodiments, an activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof, or activatable masked anti-CTLA4 bispecific antibody provided herein has an IgG1 isotype (e.g., a human IgG1 isotype). In one embodiment, the IgG1 comprises the amino acid substitutions S298A, E333A, and K334A wherein the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions S239D and 1332E wherein the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions S239D, A330L, and I332E wherein the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions P247I and A339D or A339Q wherein the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions D280H, K290S with or without S298D or S298V wherein the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions F243L, R292P, and Y300L wherein the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions F243L, R292P, Y300L, and P3961L wherein the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions F243L, R292P, Y300L, V305I, and P396L wherein the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions G236A, S239D, and I332E wherein the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions K326A and E333A wherein the amino acid residues are numbered according to the ELU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions K326W and E333S wherein the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions K290E or K290N, S298G, T299A, and/or K326E wherein the amino acid residues are numbered according to the EU index as in Kabat.


In accordance with this description and the teachings of the art, it is contemplated that in some embodiments, an antibody of the invention may comprise one or more alterations as compared to the wild type counterpart antibody, e.g. in the Fe region. These antibodies would nonetheless retain substantially the same characteristics required for therapeutic utility as compared to their wild type counterpart. For example, it is thought that certain alterations can be made in the Fe region that would result in altered (i.e., either improved or diminished) C1q binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in WO99/51642. See also Duncan & Winter Nature 322:738-40 (1988); U.S. Pat. Nos. 5,648,260; 5,624,821; and WO94/29351 concerning other examples of Fc region variants. WO00/42072 (Presta) and WO 2004/056312 (Lowman) describe antibody variants with improved or diminished binding to FcRs. The content of these patent publications are specifically incorporated herein by reference. See, also, Shields et al. J. Biol. Chem. 9(2): 6591-6604 (2001). Antibodies with increased half-lives and improved binding to the neonatal Fe receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)), are described in US2005/0014934A1 (Hinton et al.). These antibodies comprise an Fe region with one or more substitutions therein which improve binding of the Fe region to FcRn. Polypeptide variants with altered Fe region amino acid sequences and increased or decreased C1q binding capability are described in U.S. Pat. No. 6,194,551B1, WO99/51642. The contents of those patent publications are specifically incorporated herein by reference. See, also, Idusogie et al. J. Immunol. 164: 4178-4184 (2000).


7. Masked Antibody-Drug Conjugates


The invention also provides masked antibody-drug conjugates (ADCs) comprising an activatable masked anti-CTLA4 binding protein provided herein conjugated to one or more cytotoxic agents, such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes.


In one embodiment, the one or more drugs conjugated to the antibody-drug conjugate, includes but is not limited to a maytansinoid (see U.S. Pat. Nos. 5,208,020, 5,416.064 and European Patent EP 0 425 235 B1); an auristatin such as monomethylauristatin drug moieties DE and DF (MMAE and MMAF) (see U.S. Pat. Nos. 5,635,483 and 5,780,588, and 7,498,298); a dolastatin; a calicheamicin or derivative thereof (see U.S. Pat. Nos. 5,712,374, 5,714,586, 5,739,116, 5,767,285, 5,770,701, 5,770,710, 5,773,001, and 5,877,296; Hinman et al, Cancer Res. 53:3336-3342 (1993); and Lode et al, Cancer Res. 58:2925-2928 (1998)); an anthracycline such as daunomycin or doxorubicin (see Kratz et al., Current Med. Chem. 13:477-523 (2006); Jeffrey et at, Bioorganic & Med. Chem. Letters 16:358-362 (2006); Torgov et al., Bioconj. Chem. 16:717-721 (2005); Nagy et al., Proc. Nat. Acad. Sci. USA 97:829-834 (2000); Dubowchik et al., Bioorg. & Med. Chem. Letters 12:1529-1532 (2002); King et al., J. Med. Chem. 45:4336-4343 (2002); and U.S. Pat. No. 6,630,579); methotrexate; vindesine; a taxane such as docetaxel, paclitaxel, larotaxel, tesetaxel, and ortataxel; a trichothecene; and CC1065.


In another embodiment the one or more drugs conjugated to the antibody-drug conjugate, includes but is not limited to an inhibitor of tubulin polymerization (e.g., maytansinoids and auristatins), DNA damaging agents (e.g., pyrrolobenzodiazepine (PBD) dimers, caicheanmicins, duocarmycins and indo-linobenzodiazepine dimers), and DNA synthesis inhibitors (e.g., exatecan derivative Dxd).


In another embodiment, an antibody-drug conjugate comprises an antibody as described herein conjugated to an enzymatically active toxin or fragment thereof, including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.


In another embodiment, an antibody-drug conjugate comprises an antibody as described herein conjugated to a radioactive atom to form a radioconjugate. A variety of radioactive isotopes are available for the production of radioconjugates. Examples include At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 and radioactive isotopes of Lu. When the radioconjugate is used for detection, it may comprise a radioactive atom for scintigraphic studies, for example tc99m or I123, or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, MRI), such as iodine-123 again, iodine-131, indium-111, fluorine-19, carbon-13, nitrogen-15, oxygen-17, gadolinium, manganese or iron.


Conjugates of an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) and cytotoxic agent may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N-maleiridomethyl) cyclohexane-1-carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipinmidate HCl), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraidehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediarine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, a ricin inrmunotoxin can be prepared as described in Vitetta et al., Science 238:1098 (1987), Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO94/11026. The linker may be a “cleavable linker” facilitating release of a cytotoxic drug in the cell. For example, an acid-labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker or disulfide-containing linker (Chari et al., Cancer Res. 52:127-131 (1992); U.S. Pat. No. 5,208,020) may be used.


The ADCs herein expressly contemplate, but are not limited to such Conjugates prepared with cross-linker reagents including, but not limited to, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SIPB, and SVSB (succinimidyl-(4-vinyilsulfone)benzoate) which are commercially available (e.g., from Pierce Biotechnology, Inc., Rockford, Ill., U.S.A).


8. Vectors, Host Cells, and Recombinant Methods


For recombinant production of an activatable masked anti-CTLA4 binding proteins of the invention, the nucleic acid encoding it is isolated and inserted into a replicable vector for further cloning (amplification of the DNA) or for expression. DNA encoding the antibody is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody). Many vectors are available. The choice of vector depends in part on the host cell to be used. Generally, host cells are of either prokaryotic or eukaryotic (generally mammalian) origin. It will be appreciated that constant regions of any isotype can be used for this purpose, including IgG, IgM, IgA, IgD, and IgE constant regions, and that such constant regions can be obtained from any human or animal species.


9. Generating Binding Proteins Using Prokaryotic Host Cells


a) Vector Construction


Polynucleotide sequences encoding polypeptide components of the activatable masked anti-CTLA4 binding proteins of the invention can be obtained using standard recombinant techniques. Desired polynucleotide sequences may be isolated and sequenced from antibody producing cells such as hybridoma cells. Alternatively, polynucleotides can be synthesized using nucleotide synthesizer or PCR techniques. Once obtained, sequences encoding the polypeptides are inserted into a recombinant vector capable of replicating and expressing heterologous polynucleotides in prokaryotic hosts. Many vectors that are available and known in the art can be used for the purpose of the present invention. Selection of an appropriate vector will depend mainly on the size of the nucleic acids to be inserted into the vector and the particular host cell to be transformed with the vector. Each vector contains various components, depending on its function (amplification or expression of heterologous polynucleotide, or both) and its compatibility with the particular host cell in which it resides. The vector components generally include, but are not limited to: an origin of replication, a selection marker gene, a promoter, a ribosome binding site (RBS), a signal sequence, the heterologous nucleic acid insert and a transcription termination sequence.


In general, plasmid vectors containing replicon and control sequences which are derived from species compatible with the host cell are used in connection with these hosts. The vector ordinarily carries a replication site, as well as marking sequences which are capable of providing phenotypic selection in transformed cells. For example, E. coli is typically transformed using pBR322, a plasmid derived from an E. coli species. pBR322 contains genes-encoding ampicillin (Amp) and tetracycline (Tet) resistance and thus provides easy means for identifying transformed cells. pBR322, its derivatives, or other microbial plasmids or bacteriophage may also contain, or be modified to contain, promoters which can be used by the microbial organism for expression of endogenous proteins. Examples of pBR322 derivatives used for expression of particular antibodies are described in detail in Carter et al., U.S. Pat. No. 5,648,237.


In addition, phage vectors containing replicon and control sequences that are compatible with the host microorganism can be used as transforming vectors in connection with these hosts. For example, bacteriophage such as λGEM™-11 may be utilized in making a recombinant vector which can be used to transform susceptible host cells such as E. coli LE392.


The expression vector of the invention may comprise two or more promoter-cistron pairs, encoding each of the polypeptide components. A promoter is an untranslated regulatory sequence located upstream (5′) to a cistron that modulates its expression. Prokaryotic promoters typically fall into two classes, inducible and constitutive. Inducible promoter is a promoter that initiates increased levels of transcription of the cistron under its control in response to changes in the culture condition, e.g. the presence or absence of a nutrient or a change in temperature.


A large number of promoters recognized by a variety of potential host cells are well known. The selected promoter can be operably linked to cistron DNA encoding the light or heavy chain by removing the promoter from the source DNA via restriction enzyme digestion and inserting the isolated promoter sequence into the vector of the invention. Both the native promoter sequence and many heterologous promoters may be used to direct amplification and/or expression of the target genes. In some embodiments, heterologous promoters are utilized, as they generally permit greater transcription and higher yields of expressed target gene as compared to the native target polypeptide promoter.


Promoters suitable for use with prokaryotic hosts include the PhoA promoter, the β-galactamase and lactose promoter systems, a tryptophan (Trp) promoter system and hybrid promoters such as the tac or the trc promoter. However, other promoters that are functional in bacteria (such as other known bacterial or phage promoters) are suitable as well. Their nucleotide sequences have been published, thereby enabling a skilled worker operably to ligate them to cistrons encoding the target light and heavy chains (Siebenlist et al. (1980) Cell 20: 269) using linkers or adaptors to supply any required restriction sites.


In one aspect of the invention, each cistron within the recombinant vector comprises a secretion signal sequence component that directs translocation of the expressed polypeptides across a membrane. In general, the signal sequence may be a component of the vector, or it may be a part of the target polypeptide DNA that is inserted into the vector. The signal sequence selected for the purpose of this invention should be one that is recognized and processed (i.e. cleaved by a signal peptidase) by the host cell. For prokaryotic host cells that do not recognize and process the signal sequences native to the heterologous polypeptides, the signal sequence is substituted by a prokaryotic signal sequence selected, for example, from the group consisting of the alkaline phosphatase, penicillinase, Ipp, or heat-stable enterotoxin II (STII) leaders, LamB, PhoE, PelB, OmpA and MBP. In one embodiment of the invention, the signal sequences used in both cistrons of the expression system are STII signal sequences or variants thereof.


In another aspect, the production of the immunoglobulins according to the invention can occur in the cytoplasm of the host cell, and therefore does not require the presence of secretion signal sequences within each cistron. In that regard, immunoglobulin light and heavy chains are expressed with or without the sequences for the masking peptide, linker sequence, etc., folded and assembled to form functional immunoglobulins within the cytoplasm. Certain host strains (e.g., the E. coli trxB-strains) provide cytoplasm conditions that are favorable for disulfide bond formation, thereby permitting proper folding and assembly of expressed protein subunits. Proba and Pluckthun Gene. 159:203 (1995).


Activatable masked anti-CTLA4 binding proteins of the invention can also be produced by using an expression system in which the quantitative ratio of expressed polypeptide components can be modulated in order to maximize the yield of secreted and properly assembled antibodies of the invention. Such modulation is accomplished at least in part by simultaneously modulating translational strengths for the polypeptide components.


Prokaryotic host cells suitable for expressing activatable masked anti-CTLA4 binding protein of the invention include Archaebacteria and Eubacteria, such as Gram-negative or Gram-positive organisms. Examples of useful bacteria include Escherichia(e.g., E. coli), Bacilli (e.g., B. subtilis), Enterobacteria, Pseudomonas species (e.g., P. aeruginosa), Salmonella typhimurium, Serratia marcescans, Klebsiella, Proteus, Shigella, Rhizobia, Vitreoscilla, or Paracoccus. In one embodiment, gram-negative cells are used. In one embodiment, E. coli cells are used as hosts for the invention. Examples of E. coli strains include strain W3110 (Bachmann, Cellular and Molecular Biology, vol. 2 (Washington, D.C.: American Society for Microbiology, 1987), pp. 1190-1219; ATCC Deposit No. 27,325) and derivatives thereof, including strain 33D3 having genotype W3110 ΔfhuA (ΔtonA) ptr3 lac Iq lacL8 ΔompTΔ(nmpc-fepE) degP41 kanR (U.S. Pat. No. 5,639,635). Other strains and derivatives thereof, such as E. coli 294 (ATCC 31,446), E. coli B, E. coliλ 1776 (ATCC 31,537) and E. coli RV308 (ATCC 31,608) are also suitable. These examples are illustrative rather than limiting. Methods for constructing derivatives of any of the above-mentioned bacteria having defined genotypes are known in the art and described in, for example, Bass et al., Proteins, 8:309-314 (1990). It is generally necessary to select the appropriate bacteria taking into consideration replicability of the replicon in the cells of a bacterium. For example, E. coli, Serratia, or Salmonella species can be suitably used as the host when well-known plasmids such as pBR322, pBR325, pACYC177, or pKN410 are used to supply the replicon. Typically, the host cell should secrete minimal amounts of proteolytic enzymes, and additional protease inhibitors may desirably be incorporated in the cell culture.


b) Binding Protein Production


Host cells are transformed with the above-described expression vectors and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.


Transformation means introducing DNA into the prokaryotic host so that the DNA is replicable, either as an extrachromosomal element or by chromosomal integrant. Depending on the host cell used, transformation is (lone using standard techniques appropriate to such cells. The calcium treatment employing calcium chloride is generally used for bacterial cells that contain substantial cell-wall barriers. Another method for transformation employs polyethylene glycol/DMSO. Yet another technique used is electroporation.


Prokaryotic cells used to produce the activatable masked anti-CTLA4 binding proteins of the invention are grown in media known in the art and suitable for culture of the selected host cells. Examples of suitable media include luria broth (LB) plus necessary nutrient supplements. In some embodiments, the media also contains a selection agent, chosen based on the construction of the expression vector, to selectively permit growth of prokaryotic cells containing the expression vector. For example, ampicillin is added to media for growth of cells expressing ampicillin resistant gene.


Any necessary supplements besides carbon, nitrogen, and inorganic phosphate sources may also be included at appropriate concentrations introduced alone or as a mixture with another supplement or medium such as a complex nitrogen source. Optionally the culture medium may contain one or more reducing agents selected from the group consisting of glutathione, cysteine, cystamine, thioglycollate, dithioerythritol and dithiothreitol.


The prokaryotic host cells are cultured at suitable temperatures. In certain embodiments, for E. coli growth, growth temperatures range from about 20° C., to about 39° C.; from about 25° C. to about 37° C.; or about 30° C. The pH of the medium may be any pH ranging from about 5 to about 9, depending mainly on the host organism. In certain embodiments, for E. coli, the pH is from about 6.8 to about 7.4, or about 7.0.


If an inducible promoter is used in the expression vector of the invention, protein expression is induced under conditions suitable for the activation of the promoter. In one aspect of the invention, PhoA promoters are used for controlling transcription of the polypeptides. Accordingly, the transformed host cells are cultured in a phosphate-limiting medium for induction. In certain embodiments, the phosphate-limiting medium is the C.R.A.P. medium (see, e.g., Simmons et al., J. Immunol. Methods (2002), 263:133-147). A variety of other inducers may be used, according to the vector construct employed, as is known in the art.


In one embodiment, the expressed activatable masked anti-CTLA4 binding proteins of the present invention are secreted into and recovered from the periplasm of the host cells. Protein recovery typically involves disrupting the microorganism, generally by such means as osmotic shock, sonication or lysis. Once cells are disrupted, cell debris or whole cells may be removed by centrifugation or filtration. The proteins may be further purified, for example, by affinity resin chromatography. Alternatively, proteins can be transported into the culture media and isolated therein. Cells may be removed from the culture and the culture supernatant being filtered and concentrated for further purification of the proteins produced. The expressed polypeptides can be further isolated and identified using commonly known methods such as polyacrylamide gel electrophoresis (PAGE) and Western blot assay.


In one aspect of the invention, activatable masked anti-CTLA4 binding protein production is conducted in large quantity by a fermentation process. Various large-scale fed-batch fermentation procedures are available for production of recombinant proteins. Large-scale fermentations have at least 1000 liters of capacity, and in certain embodiments, about 1,000 to 100,000 liters of capacity. These fermenters use agitator impellers to distribute oxygen and nutrients, especially glucose. Small scale fermentation refers generally to fermentation in a fermenter that is no more than approximately 100 liters in volumetric capacity, and can range from about 1 liter to about 100 liters.


In a fermentation process, induction of protein expression is typically initiated after the cells have been grown under suitable conditions to a desired density, e.g., an OD550 of about 180-220, at which stage the cells are in the early stationary phase. A variety of inducers may be used, according to the vector construct employed, as is known in the art and described above. Cells may be grown for shorter periods prior to induction. Cells are usually induced for about 12-50 hours, although longer or shorter induction time may be used.


To improve the production yield and quality of the polypeptides of the invention, various fermentation conditions can be modified. For example, to improve the proper assembly and folding of the secreted antibody polypeptides, additional vectors overexpressing chaperone proteins, such as Dsb proteins (DsbA, DsbB, DsbC, DsbD and or DsbG) or FkpA (a peptidylprolyl cis,trans-isomerase with chaperone activity) can be used to co-transform the host prokaryotic cells. The chaperone proteins have been demonstrated to facilitate the proper folding and solubility of heterologous proteins produced in bacterial host cells. Chen et al. (1999) J. Biol. Chem. 274:19601-19605; Ceorgiou et al., U.S. Pat. No. 6,083,715; Georgiou et al., U.S. Pat. No. 6,027,888; Bothmann and Pluckthun (2000) J. Biol. Chem. 275:17100-17105: Ranim and Pluckthun (2000) J. Biol. Chem. 275:17106-17113; Arie et al. (2001) Mol. Microbiol. 39:199-210.


To minimize proteolysis of expressed heterologous proteins (especially those that are proteolytically sensitive), certain host strains deficient for proteolytic enzymes can be used for the present invention. For example, host cell strains may be modified to effect genetic mutation(s) in the genes encoding known bacterial proteases such as Protease III, OmpT, DegP, Tsp, Protease I, Protease Mi, Protease V, Protease VI and combinations thereof. Some E. coli protease-deficient strains are available and described in, for example, Joly et al. (1998), supra; Georgiou et al., U.S. Pat. No. 5,264,365; Georgiou et al., U.S. Pat. No. 5,508,192; Hara et al., Microbial Drug Resistance, 2:63-72 (1996).


In one embodiment, E. coli strains deficient for proteolytic enzymes and transformed with plasmids overexpressing one or more chaperone proteins are used as host cells in the expression system of the invention.


c) Binding Protein Purification


In one embodiment, the masked antibody protein produced herein is further purified to obtain preparations that are substantially homogeneous for further assays and uses. Standard protein purification methods known in the art can be employed. The following procedures are exemplary of suitable purification procedures: fractionation on immunoaffinity or ion-exchange columns, ethanol precipitation, reverse phase HPLC, chromatography on silica or on a cation-exchange resin such as DEAE, chromatofocusing, SDS-PAGE, ammonium sulfate precipitation, and gel filtration using, for example, Sephadex G-75.


In one aspect, Protein A immobilized on a solid phase is used for immunoaffinity purification of the antibody products of the invention. Protein A is a 41 kD cell wall protein from Staphylococcus aureus which binds with a high affinity to the Fe region of antibodies. Lindmark et al (1983) J. Immunol. Meth, 62:1-13. The solid phase to which Protein A is immobilized can be a column comprising a glass or silica surface, or a controlled pore glass column or a silicic acid column. In some applications, the column is coated with a reagent, such as glycerol, to possibly prevent nonspecific adherence of contaminants.


As the first step of purification, a preparation derived from the cell culture as described above can be applied onto a Protein A immobilized solid phase to allow specific binding of the antibody of interest to Protein A. The solid phase would then be washed to remove contaminants non-specifically bound to the solid phase. Finally the antibody of interest is recovered from the solid phase by elution.


10. Generating Binding Proteins Using Eukaryotic Host Cells


A vector for use in a eukaryotic host cell generally includes one or more of the following non-limiting components: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence.


A vector for use in a eukaryotic host cell may also contain a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide of interest. The heterologous signal sequence selected may be one that is recognized and processed (i.e., cleaved by a signal peptidase) by the host cell. In mammalian cell expression, mammalian signal sequences as well as viral secretory leaders, for example, the herpes simplex gD signal, are available. The DNA for such a precursor region is ligated in reading frame to DNA encoding the antibody.


a) Origin of Replication


Generally, an origin of replication component is not needed for mammalian expression vectors. For example, the SV40 origin may typically be used only because it contains the early promoter.


b) Selection Gene Component


Expression and cloning vectors may contain a selection gene, also termed a selectable marker. Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins. e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, where relevant, or (c) supply critical nutrients not available from complex media.


One example of a selection scheme utilizes a drug to arrest growth of a host cell. Those cells that are successfully transformed with a heterologous gene produce a protein conferring drug resistance and thus survive the selection regimen. Examples of such dominant selection use the drugs neomycin, mycophenolic acid and hygromycin.


Another example of suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up the activatable masked anti-CTLA4 binding protein encoding nucleic acid, such as DHFR, thymidine kinase, metallothionein-I and -II, primate metallothionein genes, adenosine deaminase, ornithine decarboxylase, etc.


For example, in some embodiments, cells transformed with the DHFR selection gene are first identified by culturing all of the transformants in a culture medium that contains methotrexate (Mtx), a competitive antagonist of DHFR. In some embodiments, an appropriate host cell when wild-type DHFR is employed is the Chinese hamster ovary (CHO) cell line deficient in DHFR activity (e.g., ATCC CRL-9096).


Alternatively, host cells (particularly wild-type hosts that contain endogenous DHFR) transformed or co-transformed with DNA sequences encoding an activatable masked anti-CTLA4 binding protein, wild-type DHFR protein, and another selectable marker such as aminoglycoside 3′-phosphotransferase (APH) can be selected by cell growth in medium containing a selection agent for the selectable marker such as an aminoglycosidic antibiotic, e.g., kanamycin, neomycin, or G418. See U.S. Pat. No. 4,965,199. I-lost cells may include NS0, including cell lines deficient in glutamine synthetase (GS). Methods for the use of GS as a selectable marker for mammalian cells are described in U.S. Pat. Nos. 5,122,464 and 5,891,693.


c) Promoter Component


Expression and cloning vectors usually contain a promoter that is recognized by the host organism and is operably linked to nucleic acid encoding a activatable masked anti-CTLA4 binding protein of interest. Promoter sequences are known for eukaryotes. For example, virtually all eukaryotic genes have an AT-rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated. Another sequence found 70 to 80 bases upstream from the start of transcription of many genes is a CNCAAT region where N may be any nucleotide. At the 3′ end of most eukaryotic genes is an AAT AAA sequence that may be the signal for addition of the poly A tail to the 3′ end of the coding sequence. In certain embodiments, any or all of these sequences may be suitably inserted into eukaryotic expression vectors.


Transcription from vectors in mammalian host cells is controlled, for example, by promoters obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and Simian Virus 40 (SV40), from heterologous mammalian promoters, e.g., the actin promoter or an immunoglobulin promoter, from heat-shock promoters, provided such promoters are compatible with the host cell systems.


The early and late promoters of the SV40 virus are conveniently obtained as an SV40 restriction fragment that also contains the SV40 viral origin of replication. The immediate early promoter of the human cytomegalovirus is conveniently obtained as a HindIII F restriction fragment. A system for expressing DNA in mammalian hosts using the bovine papilloma virus as a vector is disclosed in U.S. Pat. No. 4,419,446. A modification of this system is described in U.S. Pat. No. 4,601,978. See also Reyes et al., Nature 297:598-601 (1982), describing expression of human β-interferon cDNA in murine cells under the control of a thymidine kinase promoter from herpes simplex virus. Alternatively, the Rous Sarcoma Virus long terminal repeat can be used as the promoter.


d) Enhancer Element Component


Transcription of DNA encoding an antibody of this invention by higher eukaryotes is often increased by inserting an enhancer sequence into the vector. Many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, α-fetoprotein, and insulin). Typically, however, one will use an enhancer from a eukaryotic cell virus. Examples include the SV40 enhancer on the late side of the replication origin (bp 100-270), the human cytomegalovirus early promoter enhancer, the murine cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers. See also Yaniv, Nature 297:17-18 (1982) describing enhancer elements for activation of eukaryotic promoters. The enhancer may be spliced into the vector at a position 5′ or 3′ to the antibody polypeptide-encoding sequence, but is generally located at a site 5′ from the promoter.


e) Transcription Termination Component


Expression vectors used in eukaryotic host cells may also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5′ and, occasionally 3′, untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding an antibody. One useful transcription termination component is the bovine growth hormone polyadenylation region. See WO94/11026 and the expression vector disclosed therein.


f) Selection and Transformation of Host Cells


Suitable host cells for cloning or expressing the DNA in the vectors herein include higher eukaryote cells described herein, including vertebrate host cells. Propagation of vertebrate cells in culture (tissue culture) has become a routine procedure. Examples of useful mammalian host cell lines are monkey kidney CVI line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells/-DHFR (CHO, Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)); murine sertoli cells (TM4, Mather, Biol. Reprod. 23:243-251 (1980)); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); murine mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982)): MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).


Host cells are transformed with the above-described-expression or cloning vectors for activatable masked anti-CTLA4 binding protein production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.


g) Culturing the Host Cells


The host cells used to produce activatable masked anti-CTLA4 binding proteins of this invention may be cultured in a variety of media. Commercially available media such as Ham's F10 (Sigma), Minimal Essential Medium ((MEM), Sigma), RPMI-1640 (Sigma), and Dulbecco's Modified Eagle's Medium ((DMEM), Sigma) are suitable for culturing the host cells. In addition, any of the media described in Ham et al., Meth. Enz. 58:44 (1979), Barnes et al., Anal. Biochem. 102:255 (1980), U.S. Pat. Nos. 4,767,704; 4,657,866; 4,927,762; 4,560,655; or 5,122,469; WO 90/03430; WO 87/00195; or U.S. Pat. Re. 30,985 may be used as culture media for the host cells. Any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as GENTAMYCIN™ drug), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other supplements may also be included at appropriate concentrations that would be known to those skilled in the art. The culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.


i) Purification of Binding Protein


When using recombinant techniques, the activatable masked anti-CTLA4 binding proteins can be produced intracellularly, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, may be removed, for example, by centrifugation or ultrafiltration. Where the activatable masked anti-CTLA4 binding protein is secreted into the medium, supernatants from such expression systems may be first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. A protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis, and antibiotics may be included to prevent the growth of adventitious contaminants.


The antibody composition prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being a convenient technique. The suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fe domain that is present in the antibody. Protein A can be used to purify antibodies that are based on human γ1, γ2, or γ4 heavy chains (Lindmark et al., J. Immunol. Methods 62:1-13 (1983)). Protein G is recommended for all murine isotypes and for human γ3 (Guss et al., EMBO J. 5:15671575 (1986)). The matrix to which the affinity ligand is attached may be agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose. Where the antibody comprises a CH3 domain, the Bakerbond ABX™ resin (J. T. Baker, Phillipsburg, N.J.) is useful for purification. Other techniques for protein purification such as fractionation on an ion-exchange column, ethanol precipitation, Reverse Phase HPLC, chromatography on silica, chromatography on heparin SEPHAROSE™ chromatography on an anion or cation exchange resin (such as a polyaspartic acid column), chromatofocusing, SDS-PAGE, and ammonium sulfate precipitation are also available depending on the antibody to be recovered.


Following any preliminary purification step(s), the mixture comprising the masked binding protein of interest and contaminants may be subjected to further purification, for example, by low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5-4.5, performed at low salt concentrations (e.g., from about 0-0.25M salt).


In general, various methodologies for preparing antibodies for use in research, testing, and clinical use are well-established in the art, consistent with the above-described methodologies and/or as deemed appropriate by one skilled in the art for a particular antibody of interest.


VI. Compositions

In some aspects, also provided herein are compositions (e.g., pharmaceutical composition) comprising any of the activatable masked anti-CTLA4 binding proteins described herein.


Therapeutic formulations are prepared for storage by mixing the active ingredient having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington: The Science and Practice of Pharmacy, 20th Ed., Lippincott Williams & Wiklins, Pub., Gennaro Ed., Philadelphia, Pa. 2000). Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers, antioxidants including ascorbic acid, methionine, Vitamin E, sodium metabisulfite; preservatives, isotonicifiers, stabilizers, metal complexes (e.g. Zn-protein complexes); chelating agents such as EDTA and/or non-ionic surfactants.


Buffers can be used to control the pH in a range which optimizes the therapeutic effectiveness, especially if stability is pH dependent. Buffers can be present at concentrations ranging from about 20 nM to about 250 mM. Suitable buffering agents for use with the present invention include both organic and inorganic acids and salts thereof. For example, citrate, phosphate, succinate, tartrate, fumarate, gluconate, oxalate, lactate, acetate. Additionally, buffers may be comprised of histidine and trimethylamine salts such as Tris.


Preservatives can be added to prevent microbial growth, and are typically present in a range from about 0.2%-1.0% (w/v). Suitable preservatives for use with the present invention include octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium halides (e.g., chloride, bromide, iodide), benzethonium chloride; thimerosal, phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol, 3-pentanol, and m-cresol.


Tonicity agents, sometimes known as “stabilizers” can be present to adjust or maintain the tonicity of liquid in a composition. When used with large, charged biomolecules such as proteins and antibodies, they are often termed “stabilizers” because they can interact with the charged groups of the amino acid side chains, thereby lessening the potential for inter and intra-molecular interactions. Tonicity agents can be present in any amount between about 0.1% to about 25% by weight or between about 1 to about 5% by weight, taking into account the relative amounts of the other ingredients. In some embodiments, tonicity agents include polyhydric sugar alcohols, trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol and mannitol.


Additional excipients include agents which can serve as one or more of the following: (1) bulking agents, (2) solubility enhancers, (3) stabilizers and (4) and agents preventing denaturation or adherence to the container wall. Such excipients include: polyhydric sugar alcohols (enumerated above); amino acids such as alanine, glycine, glutamine, asparagine, histidine, arginine, lysine, ornithine, leucine, 2-phenylalanine, glutamic acid, threonine, etc.; organic sugars or sugar alcohols such as sucrose, lactose, lactitol, trehalose, stachyose, mannose, sorbose, xylose, ribose, ribitol, myoinisitose, myoinisitol, galactose, galactitol, glycerol, cyclitols (e.g., inositol), polyethylene glycol; sulfur containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, α-monothioglycerol and sodium thio sulfate; low molecular weight proteins such as human serum albumin, bovine serum albumin, gelatin or other immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; monosaccharides (e.g., xylose, mannose, fructose, glucose; disaccharides (e.g., lactose, maltose, sucrose); trisaccharides such as raffinose; and polysaccharides such as dextrin or dextran.


Non-ionic surfactants or detergents (also known as “wetting agents”) can be present to help solubilize the therapeutic agent as well as to protect the therapeutic protein against agitation-induced aggregation, which also permits the formulation to be exposed to shear surface stress without causing denaturation of the active therapeutic protein or antibody. Non-ionic surfactants are present in a range of about 0.05 mg/ml to about 1.0 mg/ml or about 0.07 mg/ml to about 0.2 mg/ml. In some embodiments, non-ionic surfactants are present in a range of about 0.001% to about 0.1% w/v or about 0.01% to about 0.1% w/v or about 0.01% to about 0.025% w/v.


Suitable non-ionic surfactants include polysorbates (20, 40, 60, 65, 80, etc.), polyoxamers (184, 188, etc.), PLURONIC® polyols, TRITON®, polyoxyethylene sorbitan monoethers (TWEEN®-20, TWEEN®-80, etc.), lauromacrogol 400, polyoxyl 40 stearate, polyoxyethylene hydrogenated castor oil 10, 50 and 60, glycerol monostearate, sucrose fatty acid ester, methyl celluose and carboxymethyl cellulose. Anionic detergents that can be used include sodium lauryl sulfate, dioctyle sodium sulfosuccinate and dioctyl sodium sulfonate. Cationic detergents include benzalkonium chloride or benzethonium chloride.


In order for the formulations to be used for in vivo administration, they must be sterile. The formulation may be rendered sterile by filtration through sterile filtration membranes. The therapeutic compositions herein generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.


The route of administration is in accordance with known and accepted methods, such as by single or multiple bolus or infusion over a long period of time in a suitable manner, e.g., injection or infusion by subcutaneous, intravenous, intraperitoneal, intramuscular, intraarterial, intralesional or intraarticular routes, topical administration, inhalation or by sustained release or extended-release means.


An activatable masked anti-CTLA4 binding protein described herein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) can be used alone or in combination with other therapeutic agents such is in the methods described herein. The term “in combination with” encompasses two or more therapeutic agents (e.g., an activatable masked anti-CTLA4 binding protein and a therapeutic agent) that are included in the same or separate formulations. In some embodiments, “in combination with” refers to “simultaneous” administration, in which case administration of the activatable masked anti-CTLA4 binding protein of the invention occurs simultaneously to the administration of the one or more additional therapeutic agents (e.g., at the same time or within one hour between administration(s) of the activatable masked anti-CTLA4 binding protein and administration of the one or more additional therapeutic agents). In some embodiments, “in combination with” refers to sequential administration, in which case administration of the activatable masked anti-CTLA4 binding protein of the invention occurs prior to and/or following, administration of the one or more additional therapeutic agents (e.g., greater than one hour between administration(s) of the activatable masked anti-CTLA4 binding protein and administration of the one or more additional therapeutic agents). Agents contemplated herein include, but are not limited to, a cytotoxic agent, a cytokine, an agent targeting an immune checkpoint molecule, an agent targeting an immune stimulatory molecule, or a growth inhibitory agent.


The formulation herein may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. Alternatively, or in addition, the composition may comprise a cytotoxic agent, cytokine, agent targeting an immune checkpoint molecule or stimulatory molecule, or growth inhibitory agent. Such molecules are suitably present in combination in amounts that are effective for the purpose intended.


VII. Articles of Manufacture or Kits

In another aspect, an article of manufacture or kit is provided which comprises an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) described herein. The article of manufacture or kit may further comprise instructions for use of the binding proteins in the methods of the invention. Thus, in certain embodiments, the article of manufacture or kit comprises instructions for the use of an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) in methods for treating or preventing a disorder (e.g., a cancer) in an individual comprising administering to the individual an effective amount of an activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof). In certain embodiments, the individual is a human. In some embodiments, the individual has a disease selected from the group consisting of include leukemia, lymphoma, head and neck cancer, colorectal cancer, prostate cancer, pancreatic cancer, melanoma, breast cancer, neuroblastoma, lung cancer, ovarian cancer, osteosarcoma, bladder cancer, cervical cancer, liver cancer, kidney cancer, skin cancer or testicular cancer.


The article of manufacture or kit may further comprise a container. Suitable containers include, for example, bottles, vials (e.g., dual chamber vials), syringes (such as single or dual chamber syringes) and test tubes. The container may be formed from a variety of materials such as glass or plastic. The container holds the formulation. In some embodiments, the formulation is a lyophilized formulation.


The article of manufacture or kit may further comprise a label or a package insert, which is on or associated with the container, may indicate directions for reconstitution and/or use of the formulation. The label or package insert may further indicate that the formulation is useful or intended for subcutaneous, intravenous, or other modes of administration for treating or preventing a disorder (e.g., a cancer) in an individual. The container holding the formulation may be a single-use vial or a multi-use vial, which allows for repeat administrations of the reconstituted formulation. The article of manufacture or kit may further comprise a second container comprising a suitable diluent. The article of manufacture or kit may further include other materials desirable from a commercial, therapeutic, and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.


In a specific embodiment, the present invention provides kits for a single dose-administration unit. Such kits comprise a container of an aqueous formulation of therapeutic antibody, including both single or multi-chambered pre-filled syringes. Exemplary pre-filled syringes are available from Vetter GmbH, Ravensburg, Germany.


The article of manufacture or kit herein optionally further comprises a container comprising a second medicament, wherein the activatable masked anti-CTLA4 binding protein (e.g., activatable masked anti-CTLA4 antibody or antigen-binding fragment thereof) is a first medicament, and which article or kit further comprises instructions on the label or package insert for treating the subject with the second medicament, in an effective amount.


In another embodiment, provided herein is an article of manufacture or kit comprising the formulations described herein for administration in an auto-injector device. An auto-injector can be described as an injection device that upon activation, will deliver its contents without additional necessary action from the patient or administrator. They are particularly suited for self-medication of therapeutic formulations when the delivery rate must be constant and the time of delivery is greater than a few moments.


EXAMPLES

The invention will be more fully understood by reference to the following examples. They should not, however, be construed as limiting the scope of the invention. It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims.


Example 1. In Vivo Efficacy of CTLA-4 and PD4 Signaling Agent in B-hCTLA4 Mice

The present example demonstrates in vivo therapeutic efficacy of a masked anti-CTLA-4 (e.g., Antibody A) and a PD-1 signaling agent (e.g., RMPI-14) in B-hCTLA4 mice bearing advanced MC38 tumors.


MC38 a murine colon carcinoma cells were maintained under aseptic conditions in Dulbecco's Modified Eagle's medium (DMEM) supplemented with 10% Fetal Bovine Serum (FBS), 0.1 mM nonessential amino acids, 1 mM sodium pyruvate and 10 mM HEPES in a humidified incubator at 37° C. in an atmosphere with 5% CO2. Upon reaching 50-70% confluence, cells were passaged for a total of three passages, prior to in vivo implantation.


Female B-hCTLA4 mice (13-14-weeks old) were subcutaneously injected with MC38 tumor cells (0.5×106) in 0.1 mL serum-free medium in the right flank for tumor development. Tumor-bearing animals were randomized into 8 study groups of 8 mice when the mean tumor size reached approximately 150 mm3. As summarized in Table 6, included groups were Isotype Control (G1: 10 mg/kg), Antibody A monotherapy at 2 doses (G2: 0.3 mg/kg, G3: 1.0 mg/kg), RMPI-14 monotherapy (G4: 10 mg/kg), Combination therapy with RMPI-14 (10 mg/kg) with 2 doses of Antibody A (G5: 0.3 mg/kg, G6:1.0 mg/kg) and Ipilimumab monotherapy at 2 doses (G7: 0.3 mg/kg, G8: 1.0 mg/kg). Isotype control, Antibody A and ipilimumab were given to animals as a single IV injection whereas RMPI-14 were given Q3D three times by IP injection.









TABLE 6







Study Groups and Treatment Regimens











Group
Test Article
ROA
Dose level
Dosing Schedule





1
Isotype Control
I.V
 10 mg/kg
Day 0


2
ANTIBODY A
I.V
0.3 mg/kg
Day 0


3
ANTIBODY A
I.V
  1 mg/kg
Day 0


4
RMP1-14
I.P
 10 mg/kg
Day 0, 3, 6


5
ANTIBODY A
I.V
0.3 mg/kg
Day 0



RMP1-14
I.P
 10 mg/kg
Day 0, 3, 6


6
ANTIBODY A
I.V
  1 mg/kg
Day 0



RMP1-14
I.P
 10 mg/kg
Day 0, 3, 6


7
Ipilimumab*
I.V
0.3 mg/kg
Day 0


8
Ipilimumab*
I.V
  1 mg/kg
Day 0





*Ipilimumab utilized in this experiment is the clinical grade formulation obtained from pharmacy






Tumor volume (TV) and body weight (BW) were measured and recorded 2-3 times a week throughout the study. Beyond the dosing phase, animals were monitored until the study endpoint (Day 55) and individual animals were euthanized as each reached TV 2000 mi or any other humane endpoint. The end date of each animal was recorded for survival analysis (FIG. 4A-4D)


On Day 14 of the study, the TV (mean±SEM) of animals in G1 control group was 1445.78±131.99 mm3. A significant anti-tumor efficacy compared to the control was observed in G3 (Antibody A, 1.0 mg/kg), G5 (RMPI-14+Antibody A, 0.3 mg/kg) and 06 (RMPI-14+Antibody A, 1.0 mg/kg) resulting in TGI of 61%, 82.3% and 53%, respectively with TV (mean±SEM) of 648.70±178.44 mm3, 374.27±125.36 mm3 and 756.14±282.52 mm3, respectively on Day 14 (P<0.02, P=0.0002 and P<0.015, Kruskal Wallis test). G3 (Antibody A, 1.0 mg/kg) treatment also resulted in complete regression of 1 of 8 (12.5%) tumors and it remained tumor-free until the last observation day (Day 55). The above 3 treatments also demonstrated a significant survival benefit over the control (P=0.00221, 0.0008, 0.0063, respectively; Log-rank (Mantel-Cox) test).









TABLE 6







Tumor Growth inhibition at Day 14.














% TGI
P values*



Test Article
Dose level
(Day 14)
(Day 14)
















Isotype Control
 10 mg/kg
n/a




ANTIBODY A
0.3 mg/kg
34
0.0220



ANTIBODY A
  1 mg/kg
61
0.0034



RMP1-14
 10 mg/kg
40
0.1079



ANTIBODY A
0.3 mg/kg
82
0.003



RMP1-14
 10 mg/kg





ANTIBODY A
  1 mg/kg
54
0.0684



RMP1-14
 10 mg/kg





Ipilimumab
0.3 mg/kg
23
0.3953



Ipilimumab
  1 mg/kg
48
0.0123







A Two-way ANOVA with Dunnett's multiple comparisons post-test was performed to determine the statistical significance of treatment versus isotype control (*P < 0.05; **P < 0.01; ***P < 0.001; ****P < 0.0001).






BW changes were indifferent between the groups throughout the study, indicating all the treatments were well tolerated (FIGS. 2B and 3B). No unexpected clinical observations or deaths were noted during the study except for those euthanized due to tumor size endpoint or severe tumor ulceration.


In this study, even when the treatment was initiated at a later stage of tumor development a significant antitumor efficacy over the isotype control was observed by Antibody A monotherapy at 1.0 mg/kg and combination therapy with RMPI-14 and Antibody A (both 0.3 mg/kg (FIG. 2A) and 1.0 mg/kg (FIG. 3A) that also lead to survival benefit. Treatment with tumor selective anti-CTLA4 induced strong anti-tumor activity. Antibody A showed better anti-tumor activity when compared to ipilimumab. All mice in the control group developed tumors that rapidly grew whereas treatment with Antibody A in combination with anti-muPD-1 blocking antibodies resulted in delayed tumor growth. At 0.3 mpk dose of Antibody A, a synergistic effect was observed with anti-muPD-1 (RMPI-14) combination in the MC38 tumor model. All the treatments were well tolerated.


Example 2. Antibody A in Combination with Anti-PD1 Results in Immune Activation

In this example, immune activation was measured following combination treatment with masked anti-CTLA4 Antibody A and anti-PD1 described in Example 1. Following treatment, CD8/Treg ratio in the tumor (FIG. 5A), CD4+ICOS+ in the tumor draining lymph nodes (TDLNs) (FIG. 5B) and CD4+Ki-67+ in peripheral blood (FIG. 5C) was measured. Antibody A combination with anti-PD1 enhanced tumor selective PD and promotes CD4+ activation in tumor draining lymph nodes.













Seq



ID



No
Sequence







  1
Cys Asn Leu Ile Val Glu Gly His Cys





  2
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu





  3
Cys Lys His Ala Pro Tyr Ala Leu Cys





  4
Cys Pro Phe Pro Ala Lys Ile Leu Cys





  5
Cys Pro Gly Lys Gly Leu Pro Ser Cys





  6
Asn Trp Leu Gly Glu Trp Leu Pro Pro Gly Lys Val





  7
Gln Phe Ile Glu Cys Pro Asn Phe Pro Arg Gln Cys Pro Gly Lys Asn





  8
Val Arg Gln Gln Cys Ser Leu Asn Pro Gly Arg Cys Pro Tyr Leu Val





  9
Val Trp Gln Glu Cys His Thr Ala Pro Gln Leu Cys Pro Gly Lys Ile





 10
Asp Ser Tyr Thr Cys Arg Gly Pro Thr Trp Met Cys Ala Gly Asn Met





 11
Phe Asn His Asp Cys Ser Gly His Trp Met Arg Cys Leu Asp Gln Gln





 12
Asn Lys Ser Pro Cys Arg Pro Lys Met Val Ala Cys Tyr Gly Ile Leu





 13
Pro Thr Pro Gln Cys Trp Asn Gln Tyr Tyr Glu Cys Trp Ile Pro Ser





 14
Ser Gln Lys Cys Pro Trp Thr Lys Glu Thr Cys Met His Tyr Met





 15
Trp His Leu Ser Met Tyr Pro Lys Pro Pro Ala Glu





 16
Trp His Thr Asp Gly Phe Tyr Thr Arg Leu Pro Ala





 17
Cys Ile His Ala Pro Tyr Ala Lys Cys





 18
Cys Pro Ala Lys Ile Gly Gln Glu Cys





 19
Cys Pro Phe Pro Ala Leu Glu Leu Cys





 20
Cys Thr Lys Pro Ala Lys Ala Leu Cys





 21
Asp Thr Ala Thr Cys Tyr Thr Thr Thr Gly Trp Cys Glu Gly Met Val





 22
Asn Ser Asp Asn Cys Gly Pro Ala Lys Ser Thr Cys Met Tyr Asn Asp





 23
Pro Pro Gly Lys Cys Thr Gln Pro His Arg Cys Pro Pro Leu Asn





 24
Asp Asp Pro Val Cys Trp Asp Ser Asn Pro Thr Cys Gln Thr Ile Ala





 25
Ile Ser Asp Gln Cys Ser Val Leu Phe Leu Ser Cys Asn Thr Arg Val





 26
Ala Cys His Phe Pro His Pro Glu Gly Cys





 27
Cys Leu Pro Pro Phe Pro Thr Lys Cys





 28
Cys Pro Asp His Val Phe Pro Lys Cys





 29
Cys Trp Leu Pro Lys Pro Asp Met Cys





 30
Cys Trp Ser Trp Pro Ser Lys Ala Cys





 31
Cys Tyr Pro Phe Gly Lys Tyr Glu Cys





 32
Ala Leu Thr Pro Ala Lys Trp Leu Pro Ala Asp Asp





 33
Asp Asp Lys Glu Cys Asp Trp Met His Phe Ala Cys Thr Gly Pro Gln





 34
Asp Glu Met Lys Cys Ala Trp Ser Leu Glu Met Cys Val Arg Thr Ser





 35
Asp Pro Ile Leu Cys Pro Asn Thr Arg Met Ser Cys Asp Asn Gln Thr





 36
Gly Asn Ala Leu Tyr Asp Ser Pro Gly Thr Met Leu





 37
Lys Asn Tyr Glu Cys Arg Glu Val Met Pro Pro Cys Glu Pro Asn Thr





 38
Asn Ser Tyr Thr Ser Pro Tyr Trp Leu Pro Asp Ser





 39
Ser Leu Thr Pro Pro Tyr Trp Ile Pro Arg Glu Trp





 40
Ser Pro Leu Thr Pro His Asp Arg Pro Ser Phe Leu





 41
Thr Ala Asp Val Phe Ser Ser Ser Arg Tyr Thr Arg





 42
Thr Asp Leu Gln Cys Pro Pro Ser Ser Pro Ile Cys Gln Ile Glu His





 43
Thr Lys Cys His Cys Asp Gly Asn Cys Val Met Cys Tyr Gln Met Gln





 44
Thr Leu Ala Tyr Glu Thr Pro Leu Leu Trp Leu Pro





 45
Thr Asn Trp His Cys Asn Asn Asp Gly Ser Ser Cys Asn Val Arg Ala





 46
Cys Asn Leu Ile Val Gln Gly His Cys





 47
Met Pro Tyr Asp Leu Tyr His Pro





 48
Gly Gly Ile Gly Gln Leu Thr Ala





 49
Asp Leu Gly Arg Phe Gln Thr Phe





 50
Asp Ser Gly Gly Phe Met Leu Thr





 51
Thr Ser Val Leu Met Ala Ala Pro





 52
Thr Ser Glu Phe Val Phe Ala Pro Asp Gln





 53
Lys Leu Val Leu Pro Val Leu Pro





 54
Lys Pro Ile Leu Phe Phe Arg Leu





 55
Ala Asn Gln Leu Lys Gly





 56
Gln Ser Gln Leu Lys Glu





 57
His Glu Gln Leu Thr Val





 58
Pro Ala Asn Leu Val Ala Pro Asp Pro





 59
Pro Ala Pro Gly Val Tyr Pro Gly Pro





 60
Ala Pro Ala Gly Leu Ile Val Pro Tyr Asn





 61
Pro Gln Ala Leu Val Ala





 62
Val Gly Asn Leu Asn Phe





 63
Val Ala Asn Leu Leu Tyr Glu





 64
Val Tyr Asn Leu Met Asp





 65
Thr Phe Asn Ile Lys Gln





 66
Asp Leu Trp Lys Leu Leu Pro





 67
Pro Gly Ser Thr Lys Arg Ala





 68
Gln Gln Tyr Arg Ala Leu Lys Ser





 69
Tyr Val Pro Arg Ala Val Leu





 70
Gly Val Asn Lys Trp Pro Thr





 71
Leu Ala Gln Ala Val Arg Ser Ser





 72
Arg Ala Ala Ala Val Lys Ser Pro





 73
Asp Leu Leu Ala Val Val Ala Ala Ser





 74
Val Gln Thr Val Thr Trp Pro Asp





 75
Ala Ile Pro Met Ser Ile Pro Pro





 76
Gly Tyr Glu Val His His Gln Lys





 77
Val His His Gln Lys Leu Val Phe





 78
Ile Arg Arg Val Ser Tyr Ser Phe





 79
Met Pro Tyr Asp Leu Tyr His Pro Ile Leu Phe Phe Arg Leu





 80
Gly Gly Ile Gly Gln Leu Thr Ser Val Leu Ala Ala Pro





 81
Asp Ser Gly Gly Phe Met Leu Thr Leu Val Leu Pro Val Leu Pro





 82
Thr Ser Glu Phe Val Phe Ala Pro Asp Leu Gly Arg Phe Gln Thr Phe





 83
Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg





 84
Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Gly





 85
Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro His





 86
Val Pro Leu Ser Leu Tyr





 87
Thr Ser Ala Ser Gly Ala Ser Ala Ser Ala Ala





 88
Pro Ser Ser Pro Gly Gly Gly Ser Ser Pro





 89
Gly Gly Ser





 90
Gly Gly Gly Ser Ser Gly Gly Ser





 91
Gly Gly Ser Gly Gly





 92
Gly Gly Gly Ser





 93
Gly Ser





 94
Gly Ser Gly Gly Gly Ser Ser Gly Gly Ser





 95
Gly Ser Ser Gly Gly Ser





 96
Gly Gly Gly Ser Ser Gly Gly Ser Gly





 97
Gly Gly Ser Ala Gly Gly Ser





 98
Gly His Ser





 99
Gly Pro Ser





100
Gly Ala Ser





101
Ser Gly Gly Gly





102
Ser Gly Gly





103
Ser Gly Gly Ser Gly Gly





104
Ser Ser Gly





105
Gly Gly Gly Ser Gly Gly





106
Gly Gly





107
Gly Gly Gly





108
Gly Gly Gly Ser





109
Ser His Gly Gly





110
His Gly Gly Gly





111
Ser Gly Ala Ala





112
Ser Gly Pro Ala





113
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Pro Leu



Ser Leu Tyr Ser Gly Gly Gly





114
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Ala Gly Gly



Ser Val Pro Leu Ser Leu Tyr Gly Gly Gly





115
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Ser Thr Ser Thr Ser



Gly Arg Ser Ala Asn Pro Arg Gly Gly Ser





116
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Ser Thr Ser Ala Ser



Gly Ala Ser Ala Ser Ala Ala Gly Gly Ser





117
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Pro Ser Ser



Pro Gly Gly Gly Ser Ser Pro





118
Asp Asp Pro Val Cys Trp Asp Ser Asn Pro Thr Cys Gln Thr Ile Ala



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser





119
Ile Ser Asp Gln Cys Ser Val Leu Phe Leu Ser Cys Asn Thr Arg Val



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser





120
Ala Cys His Phe Pro His Pro Glu Gly Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser





121
Ala Cys Leu Pro Pro Phe Pro Thr Lys Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser





122
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser





123
Ala Cys Pro Asp His Val Phe Pro Lys Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser





124
Ala Cys Trp Leu Pro Lys Pro Asp Met Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser





125
Ala Cys Trp Ser Trp Pro Ser Lys Ala Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser





126
Ala Cys Tyr Pro Phe Gly Lys Tyr Glu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser





127
Ala Leu Thr Pro Ala Lys Trp Leu Pro Ala Asp Asp Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly



Gly Gly Ser





128
Asp Asp Lys Glu Cys Asp Trp Met His Phe Ala Cys Thr Gly Pro Gln



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser





129
Asp Glu Met Lys Cys Ala Trp Ser Leu Glu Met Cys Val Arg Thr Ser



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser





130
Asp Pro Ile Leu Cys Pro Asn Thr Arg Met Ser Cys Asp Asn Gln Thr



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser





131
Gly Asn Ala Leu Tyr Asp Ser Pro Gly Thr Met Leu Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly



Gly Gly Ser





132
Lys Asn Tyr Glu Cys Arg Glu Val Met Pro Pro Cys Glu Pro Asn Thr



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser





133
Asn Ser Tyr Thr Ser Pro Tyr Trp Leu Pro Asp Ser Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly



Gly Gly Ser





134
Ser Leu Thr Pro Pro Tyr Trp Ile Pro Arg Glu Trp Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly



Gly Gly Ser





135
Ser Pro Leu Thr Pro His Asp Arg Pro Ser Phe Leu Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly



Gly Gly Ser





136
Thr Ala Asp Val Phe Ser Ser Ser Arg Tyr Thr Arg Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly



Gly Gly Ser





137
Thr Asp Leu Gln Cys Pro Pro Ser Ser Pro Ile Cys Glu Ile Glu His



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser





138
Thr Lys Cys His Cys Asp Gly Asn Cys Val Met Cys Tyr Glu Met Gln



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser





139
Thr Leu Ala Tyr Glu Thr Pro Leu Leu Trp Leu Pro Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly



Gly Gly Ser





140
Thr Asn Trp His Cys Asn Asn Asp Gly Ser Ser Cys Asn Val Arg Ala



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser





141
Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Gly Ala Cys Asn Leu Ile Val



Glu Gly His Cys Gly Gly Ser Val Pro Leu Ser Leu Tyr Ser Gly Gly



Gly





142
Asp Tyr Lys Asp Asp Asp Asp Lys Gly Ala Cys Asn Leu Ile Val Glu



Gly His Cys Gly Gly Ser Val Pro Leu Ser Leu Tyr Ser Gly Gly Gly





143
Glu Gln Lys Leu Ile Ser Glu Gln Asp Leu Gly Ala Cys Asn Leu Ile



Val Glu Gly His Cys Gly Gly Ser Val Pro Leu Ser Leu Tyr Ser Gly



Gly Gly





144
Gly Leu Asn Asp Ile Phe Glu Ala Glu Lys Ile Glu Trp His Glu Gly



Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Pro Leu



Ser Leu Tyr Ser Gly Gly Gly





145
Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Gly Ala Cys Asn Leu Ile Val



Glu Gly His Cys Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro



Arg Gly Gly Ser





146
Asp Tyr Lys Asp Asp Asp Asp Lys Gly Ala Cys Asn Leu Ile Val Glu



Gly His Cys Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg



Gly Gly Ser





147
Glu Gln Lys Leu Ile Ser Glu Gln Asp Leu Gly Ala Cys Asn Leu Ile



Val Glu Gly His Cys Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn



Pro Arg Gly Gly Ser





148
Gly Leu Asn Asp Ile Phe Glu Ala Gln Lys Ile Glu Trp His Glu Gly



Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Ser Thr Ser Thr Ser



Gly Arg Ser Ala Asn Pro Arg Gly Gly Ser





149
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Met Pro Tyr



Asp Leu Tyr His Pro Ser Gly Gly Gly





150
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Gly Gly Ile



Gly Gln Leu Thr Ala Ser Gly Gly Gly





151
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Asp Leu Gly



Arg Phe Gln Thr Phe Ser Gly Gly Gly





152
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Asp Ser Gly



Gly Phe Met Leu Thr Ser Gly Gly Gly





153
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Thr Ser Val



Leu Met Ala Ala Pro Ser Gly Gly Gly





154
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Thr Ser Glu



Phe Val Phe Ala Pro Asp Gln Ser Gly Gly Gly





155
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Lys Leu Val



Leu Pro Val Leu Pro Ser Gly Gly Gly





156
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Lys Pro Ile



Leu Phe Phe Arg Leu Ser Gly Gly Gly





157
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Ala Asn Gln



Leu Lys Gly Ser Gly Gly Gly





158
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Gln Ser Gln



Leu Lys Glu Ser Gly Gly Gly





159
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser His Glu Gln



Leu Thr Val Ser Gly Gly Gly





160
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Pro Ala Asn



Leu Val Ala Pro Asp Pro Ser Gly Gly Gly





161
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Pro Ala Pro



Gly Val Tyr Pro Gly Pro Ser Gly Gly Gly





162
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Ala Pro Ala



Gly Leu Ile Val Pro Tyr Asn Ser Gly Gly Gly





163
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Pro Gln Ala



Leu Val Ala Ser Gly Gly Gly





164
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Gly Asn



Leu Asn Phe Ser Gly Gly Gly





165
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Ala Asn



Leu Leu Tyr Glu Ser Gly Gly Gly





166
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Tyr Asn



Leu Met Asp Ser Gly Gly Gly





167
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Thr Phe Asn



Ile Lys Gln Ser Gly Gly Gly





168
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Asp Leu Trp



Lys Leu Leu Pro Ser Gly Gly Gly





169
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Pro Gly Ser



Thr Lys Arg Ala Ser Gly Gly Gly





170
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Gln Gln Tyr



Arg Ala Leu Lys Ser Ser Gly Gly Gly





171
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Tyr Val Pro



Arg Ala Val Leu Ser Gly Gly Gly





172
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Gly Val Asn



Lys Trp Pro Thr Ser Gly Gly Gly





173
Ala Cys Asn Leu Ile Val Gly Gly His Cys Gly Gly Ser Leu Ala Gln



Ala Val Arg Ser Ser Ser Gly Gly Gly





174
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Arg Ala Ala



Ala Val Lys Ser Pro Ser Gly Gly Gly





175
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Asp Leu Leu



Ala Val Val Ala Ala Ser Ser Gly Gly Gly





176
Ala Cys Asn Leu Ile Val Gly Gly His Cys Gly Gly Ser Val Gln Thr



Val Thr Trp Pro Asp Ser Gly Gly Gly





177
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Ala Ile Pro



Met Ser Ile Pro Pro Ser Gly Gly Gly





178
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Gly Tyr Glu



Val His His Gln Lys Ser Gly Gly Gly





179
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val His His



Gln Lys Leu Val Phe Ser Gly Gly Gly





180
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Ile Arg Arg



Val Ser Tyr Ser Phe Ser Gly Gly Gly





181
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Met Pro Tyr



Asp Leu Tyr His Pro Ile Leu Phe Phe Arg Leu Ser Gly Gly Gly





182
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Gly Gly Ile



Gly Gln Leu Thr Ser Val Leu Met Ala Ala Pro Ser Gly Gly Gly





183
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Asp Ser Gly



Gly Phe Met Leu Thr Leu Val Leu Pro Val Leu Pro Ser Gly Gly Gly





184
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Thr Ser Glu



Phe Val Phe Ala Pro Asp Leu Gly Arg Phe Gln Thr Phe Ser Gly Gly



Gly





185
Ala Cys Asn Leu Ile Val Gln Gly His Cys Gly Gly Ser Val Pro Leu



Ser Leu Tyr Ser Gly Gly Gly





186
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly His Ser Val Pro Leu



Ser Leu Tyr Ser His Gly Gly





187
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Pro Leu



Ser Leu Tyr Ser His Gly Gly





188
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly His Ser Val Pro Leu



Ser Leu Tyr Ser Gly Gly Gly





189
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Pro Leu



Ser Leu Tyr His Gly Gly Gly





190
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly His Ser Val Pro Leu



Ser Leu Tyr His Gly Gly Gly





191
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Pro Ser Val Pro Leu



Ser Leu Tyr Ser Gly Ala Ala





192
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Ala Ser Val Pro Leu



Ser Leu Tyr Ser Gly Pro Ala





193
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Pro Ser Val Pro Leu



Ser Leu Tyr Ser Gly Pro Ala





194
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly





195
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Ser Gly Gly Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg



Ser Gly Gly





196
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser



Gly Gly





197
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly



Gly





198
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly





199
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Ser Gly Gly





200
Ala Cys Lys His Ala Pro Tyr Ala Leu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly





201
Ala Cys Pro Phe Pro Ala Lys Ile Leu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly





202
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly





203
Asn Trp Leu Gly Glu Trp Leu Pro Pro Gly Lys Val Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser



Gly Gly





204
Gln Phe Ile Glu Cys Pro Asn Phe Pro Arg Gln Cys Pro Gly Lys Asn



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly





205
Val Arg Gln Gln Cys Ser Leu Asn Pro Gly Arg Cys Pro Tyr Leu Val



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly





206
Val Trp Gln Glu Cys His Thr Ala Pro Gln Leu Cys Pro Gly Lys Ile



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly





207
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Gly Ser Ser Gly





208
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro His Ser Gly Gly





209
Asp Ser Tyr Thr Cys Arg Gly Pro Thr Trp Met Cys Ala Gly Asn Met



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly





210
Phe Asn His Asp Cys Ser Gly His Trp Met Arg Cys Leu Asp Gln Gln



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly





211
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Gly Ser Val Pro Leu Ser Leu Tyr Ser Gly Gly Ser Gly Gly





212
Asn Lys Ser Pro Cys Arg Pro Lys Met Val Ala Cys Tyr Gly Ile Leu



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly





213
Pro Thr Pro Gln Cys Trp Asn Gln Tyr Tyr Glu Cys Trp Ile Pro Ser



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly





214
Ser Gln Lys Cys Pro Trp Thr Lys Glu Thr Cys Met His Tyr Met Gly



Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn



Pro Arg Ser Gly Gly





215
Trp His Leu Ser Met Tyr Pro Lys Pro Pro Ala Glu Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser



Gly Gly





216
Trp His Thr Asp Gly Phe Tyr Thr Arg Leu Pro Ala Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser



Gly Gly





217
Ala Cys Ile His Ala Pro Tyr Ala Lys Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly





218
Ala Cys Pro Ala Lys Ile Gly Gln Glu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly





219
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly





220
Ala Cys Thr Lys Pro Ala Lys Ala Leu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly





221
Asp Thr Ala Thr Cys Tyr Thr Thr Thr Gly Trp Cys Glu Gly Met Val



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly





222
Asn Ser Asp Asn Cys Gly Pro Ala Lys Ser Thr Cys Met Tyr Asn Asp



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly





223
Pro Pro Gly Lys Cys Thr Gln Pro His Arg Cys Pro Pro Leu Asn Gly



Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn



Pro Arg Ser Gly Gly





224
Ala Cys Ile His Ala Pro Tyr Ala Lys Cys Gly Ser Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser



Gly Gly





225
Ala Cys Pro Ala Lys Ile Gly Gln Glu Cys Gly Ser Ser Gly Gly Ser



Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly





226
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser Gly Gly





227
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Gly Ser Thr Ser



Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly





228
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Gly Ser Ser Gly



Gly Ser Gly Val Pro Leu Ser Leu Tyr Ser Gly Gly





229
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Ser Thr Ser Thr Ser



Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly





230
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Ser Thr Ser Thr



Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly





231
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Gly Ser Thr Ser



Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly





232
Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Leu Gly



Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His Ser



Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser



Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro



Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile



Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly



Ser His Val Pro





233
Glu Ala Lys Leu Gln Glu Ser Gly Pro Val Leu Val Lys Pro Gly Ala



Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr



Tyr Met Asn Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile



Gly Val Ile Asn Pro Tyr Asn Gly Asp Thr Ser Tyr Asn Gln Lys Phe



Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr



Met Glu Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys



Ala Arg Tyr Tyr Gly Ser Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu



Ile Thr Val Ser Ser Ala





234
Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala



Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser



Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp



Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val



Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met



Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser



Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys



Ser Phe Asn Arg Asn Glu Cys





235
Lys Thr Thr Ala Pro Ser Val Tyr Pro Leu Ala Pro Val Cys Gly Asp



Thr Thr Gly Ser Ser Val Thr Leu Gly Cys Leu Val Lys Gly Tyr Phe



Pro Glu Pro Val Thr Leu Thr Trp Asn Ser Gly Ser Leu Ser Ser Gly



Val His Thr Phe Pro Ala Val Leu Gln Ser Asp Leu Tyr Thr Leu Ser



Ser Ser Val Thr Val Thr Ser Ser Thr Trp Pro Ser Gln Ser Ile Thr



Cys Asn Val Ala His Pro Ala Ser Ser Thr Lys Val Asp Lys Lys Ile



Glu Pro Arg Gly Pro Thr Ile Lys Pro Cys Pro Pro Cys Lys Cys Pro



Ala Pro Asn Leu Leu Gly Gly Pro Ser Val Phe Ile Phe Pro Pro Lys



Ile Lys Asp Val Leu Met Ile Ser Leu Ser Pro Ile Val Thr Cys Val



Val Val Asp Val Ser Glu Asp Asp Pro Asp Val Gln Ile Ser Trp Phe



Val Asn Asn Val Glu Val His Thr Ala Gln Thr Gln Thr His Arg Glu



Asp Tyr Asn Ser Thr Leu Arg Val Val Ser Ala Leu Pro Ile Gln His



Gln Asp Trp Met Ser Gly Lys Glu Phe Lys Cys Lys Val Asn Asn Lys



Asp Leu Pro Ala Pro Ile Glu Arg Thr Ile Ser Lys Pro Lys Gly Ser



Val Arg Ala Pro Gln Val Tyr Val Leu Pro Pro Pro Glu Gln Glu Met



Thr Lys Lys Gln Val Thr Leu Thr Cys Met Val Thr Asp Phe Met Pro



Glu Asp Ile Tyr Val Glu Trp Thr Asn Asn Gly Lys Thr Glu Leu Asn



Tyr Lys Asn Thr Glu Pro Val Leu Asp Ser Asp Gly Ser Tyr Phe Met



Tyr Ser Lys Leu Arg Val Glu Lys Lys Asn Trp Val Glu Arg Asn Ser



Tyr Ser Cys Ser Val Val His Glu Gly Leu His Asn His His Thr Thr



Lys Ser Phe Ser Arg Thr Pro Gly Lys





236
Lys Thr Thr Pro Pro Ser Val Tyr Pro Leu Ala Pro Gly Cys Gly Asp



Thr Thr Gly Ser Ser Val Thr Leu Gly Cys Leu Val Lys Gly Tyr Phe



Pro Glu Ser Val Thr Val Thr Trp Asn Ser Gly Ser Leu Ser Ser Ser



Val His Thr Phe Pro Ala Leu Leu Gln Ser Gly Leu Tyr Thr Met Ser



Ser Ser Val Thr Val Pro Ser Ser Thr Trp Pro Ser Gln Thr Val Thr



Cys Ser Val Ala His Pro Ala Ser Ser Thr Thr Val Asp Lys Lys Leu



Glu Pro Ser Gly Pro Ile Ser Thr Ile Asn Pro Cys Pro Pro Cys Lys



Glu Cys His Lys Cys Pro Ala Pro Asn Leu Glu Gly Gly Pro Ser Val



Phe Ile Phe Pro Pro Asn Ile Lys Asp Val Leu Met Ile Ser Leu Thr



Pro Lys Val Thr Cys Val Val Val Asp Val Ser Glu Asp Asp Pro Asp



Val Gln Ile Ser Trp Phe Val Asn Asn Val Glu Val His Thr Ala Gln



Thr Gln Thr His Arg Glu Asp Tyr Asn Ser Thr Ile Arg Val Val Ser



Thr Leu Pro Ile Gln His Gln Asp Trp Met Ser Gly Lys Glu Phe Lys



Cys Lys Val Asn Asn Lys Asp Leu Pro Ser Pro Ile Glu Arg Thr Ile



Ser Lys Ile Lys Gly Leu Val Arg Ala Pro Gln Val Tyr Ile Leu Pro



Pro Pro Ala Glu Gln Leu Ser Arg Lys Asp Val Ser Leu Thr Cys Leu



Val Val Gly Phe Asn Pro Gly Asp Ile Ser Val Glu Trp Thr Ser Asn



Gly His Thr Glu Gln Asn Tyr Lys Asp Thr Ala Pro Val Leu Asp Ser



Asp Gly Ser Tyr Phe Ile Tyr Ser Lys Leu Asn Met Lys Thr Ser Lys



Trp Glu Lys Thr Asp Ser Phe Ser Cys Asn Val Arg His Glu Gly Leu



Lys Asn Tyr Tyr Leu Lys Lys Thr Ile Ser Arg Ser Pro Gly Lys





237
Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Ser Leu Gly



Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His Ser



Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser



Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro



Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile



Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly



Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys



Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu



Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe



Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg



Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser



Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu



Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser



Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





238
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Pro Leu



Ser Leu Tyr Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





239
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Ala Gly Gly



Ser Val Pro Leu Ser Leu Tyr Gly Gly Gly Asp Ile Val Met Thr Gln



Thr Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser



Cys Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu



Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr



Lys Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu



Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr



Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro



Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly



Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn



Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn



Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser



Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr



Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe



Asn Arg Asn Glu Cys





240
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Ser Thr Ser Thr Ser



Gly Arg Ser Ala Asn Pro Arg Gly Gly Ser Asp Ile Val Met Thr Gln



Thr Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser



Cys Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu



Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr



Lys Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu



Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr



Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro



Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly



Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asn Ile Asn



Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn



Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser



Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr



Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe



Asn Arg Asn Glu Cys





241
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Ser Thr Ser Ala Ser



Gly Ala Ser Ala Ser Ala Ala Gly Gly Ser Asp Ile Val Met Thr Gln



Thr Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser



Cys Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu



Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr



Lys Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu



Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr



Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro



Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly



Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn



Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn



Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser



Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr



Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe



Asn Arg Asn Glu Cys





242
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Pro Ser Ser



Pro Gly Gly Gly Ser Ser Pro Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





243
Asp Asp Pro Val Cys Trp Asp Ser Asn Pro Thr Cys Gln Thr Ile Ala



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





244
Ile Ser Asp Gln Cys Ser Val Leu Phe Leu Ser Cys Asn Thr Arg Val



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





245
Ala Cys His Phe Pro His Pro Glu Gly Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Ser Leu



Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His



Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln



Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val



Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys



Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln



Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile



Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser



Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn



Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu



Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp



Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr



Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr



Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





246
Ala Cys Leu Pro Pro Phe Pro Thr Lys Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Ser Leu



Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His



Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln



Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val



Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys



Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln



Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile



Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser



Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn



Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu



Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp



Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr



Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr



Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





247
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Ser Leu



Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His



Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln



Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val



Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys



Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln



Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile



Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser



Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn



Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu



Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp



Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr



Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr



Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





248
Ala Cys Pro Asp His Val Phe Pro Lys Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Ser Leu



Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser lIe Val His



Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln



Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val



Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys



Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln



Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile



Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser



Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn



Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu



Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp



Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr



Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr



Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





249
Ala Cys Trp Leu Pro Lys Pro Asp Met Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Ser Leu



Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His



Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln



Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val



Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys



Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln



Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile



Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser



Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn



Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu



Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp



Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr



Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr



Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





250
Ala Cys Trp Ser Trp Pro Ser Lys Ala Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Ser Leu



Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His



Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln



Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val



Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys



Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln



Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile



Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser



Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn



Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu



Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp



Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr



Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr



Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





251
Ala Cys Tyr Pro Phe Gly Lys Tyr Glu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Ser Leu



Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His



Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln



Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val



Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys



Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln



Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile



Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser



Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn



Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu



Arg Gln Asn Gly Val Leu Ala Ser Trp Thr Asp Gln Asp Ser Lys Asp



Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr



Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr



Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





252
Ala Leu Thr Pro Ala Lys Trp Leu Pro Ala Asp Asp Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly



Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val



Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile



Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro



Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser



Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr



Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys



Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu



Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro



Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu



Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly



Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser



Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp



Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr



Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





253
Asp Asp Lys Glu Cys Asp Trp Met His Phe Ala Cys Thr Gly Pro Gln



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





254
Asp Glu Met Lys Cys Ala Trp Ser Leu Glu Met Cys Val Arg Thr Ser



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser ASp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





255
Asp Pro Ile Leu Cys Pro Asn Thr Arg Met Ser Cys Asp Asn Gln Thr



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asp Arg Asn



Glu Cys





256
Gly Asn Ala Leu Tyr Asp Ser Pro Gly Thr Met Leu Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly



Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val



Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile



Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro



Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser



Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr



Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys



Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu



Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro



Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu



Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly



Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser



Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp



Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr



Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





257
Lys Asn Tyr Glu Cys Arg Glu Val Met Pro Pro Cys Glu Pro Asn Thr



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





258
Asn Ser Tyr Thr Ser Pro Tyr Trp Leu Pro Asp Ser Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly



Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val



Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile



Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro



Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser



Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr



Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys



Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu



Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro



Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu



Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly



Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser



Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp



Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr



Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





259
Ser Leu Thr Pro Pro Tyr Trp Ile Pro Arg Glu Trp Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly



Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val



Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile



Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro



Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser



Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr



Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys



Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu



Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro



Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu



Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly



Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser



Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp



Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr



Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





260
Ser Pro Leu Thr Pro His Asp Arg Pro Ser Phe Leu Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly



Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val



Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile



Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro



Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser



Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr



Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys



Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu



Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro



Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu



Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly



Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asn Ser



Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp



Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr



Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





261
Thr Ala Asp Val Phe Ser Ser Ser Arg Tyr Thr Arg Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly



Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val



Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile



Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro



Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser



Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr



Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys



Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu



Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro



Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu



Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly



Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser



Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp



Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr



Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





262
Thr Asp Leu Gln Cys Pro Pro Ser Ser Pro Ile Cys Gln Ile Glu His



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





263
Thr Lys Cys His Cys Asp Gly Asn Cys Val Met Cys Tyr Gln Met Gln



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





264
Thr Leu Ala Tyr Glu Thr Pro Leu Leu Trp Leu Pro Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly



Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val



Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile



Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro



Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser



Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr



Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys



Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu



Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro



Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu



Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly



Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser



Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp



Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr



Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





265
Thr Asn Trp His Cys Asn Asn Asp Gly Ser Ser Cys Asn Val Arg Ala



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Gly Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





266
Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Gly Ala Cys Asn Leu Ile Val



Glu Gly His Cys Gly Gly Ser Val Pro Leu Ser Leu Tyr Ser Gly Gly



Gly Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Ser Leu



Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His



Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln



Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val



Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys



Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln



Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile



Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser



Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn



Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu



Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp



Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr



Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr



Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





267
Asp Tyr Lyr Asp Asp Asp Asp Lys Gly Ala Cys Asn Leu Ile Val Glu



Gly His Cys Gly Gly Ser Val Pro Leu Ser Leu Tyr Ser Gly Gly Gly



Asp Ile Val Met Thr Glu Thr Thr Leu Ser Leu Pro Val Ser Leu Gly



Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His Ser



Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser



Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro



Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile



Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly



Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys



Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu



Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe



Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg



Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser



Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu



Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser



Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





268
Glu Gln Lys Leu Ile Ser Glu Gln Asp Leu Gly Ala Cys Asn Leu Ile



Val Glu Gly His Cys Gly Gly Ser Val Pro Leu Ser Leu Tyr Ser Gly



Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Ser



Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val



His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly



Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly



Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu



Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe



Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu



Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser



Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn



Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser



Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys



Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu



Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser



Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





269
Gly Leu Asn Asp Ile Phe Glu Ala Gln Lys Ile Glu Trp His Glu Gly



Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Pro Leu



Ser Leu Tyr Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asp Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asp Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Gln Cys





270
Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Gly Ala Cys Asn Leu Ile Val



Glu Gly His Cys Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro



Arg Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro



Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser



Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys



Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe



Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe



Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr



Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys



Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro



Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe



Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp



Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp



Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys



Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys



Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





271
Asp Tyr Lys Asp Asp Asp Asp Lys Gly Ala Cys Asn Leu Ile Val Glu



Gly His Cys Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg



Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val



Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile



Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro



Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser



Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr



Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys



Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu



Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro



Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu



Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly



Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser



Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp



Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr



Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





272
Glu Gln Lys Leu Ile Ser Glu Gln Asp Leu Gly Ala Cys Asn Leu Ile



Val Glu Gly His Cys Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn



Pro Arg Gly Gly Ser Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu



Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln



Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln



Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg



Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp



Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr



Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr



Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe



Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys



Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile



Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln



Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr



Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His



Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





273
Gly Leu Asn Asp Ile Phe Glu Ala Gln Lys Ile Glu Trp His Glu Gly



Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Ser Thr Ser Thr Ser



Gly Arg Ser Ala Asn Pro Arg Gly Gly Ser Asp Ile Val Met Thr Gln



Thr Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser



Cys Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu



Glu Trp Tyr Leu Glu Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr



Lys Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu



Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr



Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro



Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly



Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn



Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn



Ser Trp Thr Asp Glu Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser



Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr



Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe



Asn Arg Asn Glu Cys





274
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Met Pro Tyr



Asp Leu Tyr His Pro Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





275
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Gly Gly Ile



Gly Gln Leu Thr Ala Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





276
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Asp Leu Gly



Arg Phe Gln Thr Phe Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Gln Ser Ile Val His Ser Asn gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Glu Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





277
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Asp Ser Gly



Gly Phe Met Leu Thr Ser Gly Gly Gly Asn Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





278
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Thr Ser Val



Leu Met Ala Ala Pro Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





279
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Thr Ser Glu



Phe Val Phe Ala Pro Asp Gln Ser Gly Gly Gly Asp Ile Val Met Thr



Gln Thr Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile



Ser Cys Arg Ser Ser Glu Ser Ile Val His Ser Asn Gly Asn Thr Tyr



Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile



Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly



Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala



Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr



Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala



Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly



Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile



Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu



Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser



Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr



Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser



Phe Asn Arg Asn Glu Cys





280
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Lys Leu Val



Leu Pro Val Leu Pro Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





281
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Lys Pro Ile



Leu Phe Phe Arg Leu Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





282
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Ala Asn Gln



Leu Lys Gly Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





283
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Gln Ser Gln



Leu Lys Glu Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





284
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser His Glu Gln



Leu Thr Val Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





285
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Pro Ala Asn



Leu Val Ala Pro Asp Pro Ser Gly Gly Gly Asp Ile Val Met Thr Gln



Thr Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser



Cys Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu



Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr



Lys Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu



Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr



Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro



Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly



Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn



Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn



Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser



Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr



Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe



Asn Arg Asn Glu Cys





286
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Pro Ala Pro



Gly Val Tyr Pro Gly Pro Ser Gly Gly Gly Asp Ile Val Met Thr Gln



Thr Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser



Cys Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu



Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr



Lys Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu



Asp Leu Gly Val Tyr Tyr Cys Phe Glu Gly Ser His Val Pro Tyr Thr



Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro



Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly



Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn



Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn



Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser



Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr



Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe



Asn Arg Asn Glu Cys





287
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Ala Pro Ala



Gly Leu Ile Val Pro Tyr Asn Ser Gly Gly Gly Asp Ile Val Met Thr



Gln Thr Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile



Ser Cys Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr



Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile



Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly



Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala



Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr



Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala



Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly



Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile



Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu



Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser



Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr



Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser



Phe Asn Arg Asn Glu Cys





288
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Pro Gln Ala



Leu Val Ala Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





289
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Gly Asn



Leu Asn Phc Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





290
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Ala Asn



Leu Leu Tyr Glu Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr



Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg



Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp



Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val



Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser



Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu



Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly



Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val



Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser



Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys



Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp



Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu



Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu



Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg



Asn Glu Cys





291
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Tyr Asn



Leu Met Asp Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asn Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





292
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Thr Phe Asn



Ile Lys Gln Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





293
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Asp Leu Trp



Lys Leu Leu Pro Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr



Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg



Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp



Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val



Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser



Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu



Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly



Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val



Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser



Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys



Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp



Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu



Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu



Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg



Asn Glu Cys





294
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Pro Gly Ser



Thr Lys Arg Ala Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr



Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg



Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp



Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val



Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser



Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu



Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly



Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val



Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser



Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys



Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp



Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu



Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu



Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg



Asn Glu Cys





295
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Gln Gln Tyr



Arg Ala Leu Lys Ser Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





296
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Tyr Val Pro



Arg Ala Val Leu Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr



Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg



Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp



Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val



Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser



Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu



Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly



Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val



Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser



Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys



Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp



Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu



Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu



Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg



Asn Glu Cys





297
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Gly Val Asn



Lys Trp Pro Thr Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr



Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg



Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp



Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val



Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser



Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu



Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly



Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val



Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser



Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys



Trp Lys Ile Asp Gly Ser Glu Arg Glu Asn Gly Val Leu Asn Ser Trp



Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu



Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu



Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg



Asn Glu Cys





298
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Leu Ala Gln



Ala Val Arg Ser Ser Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





299
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Arg Ala Ala



Ala Val Lys Ser Pro Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





300
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Asp Leu Leu



Ala Val Val Ala Ala Ser Ser Gly Gly Gly Asp Ile Val Met Thr Gln



Thr Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser



Cys Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu



Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr



Lys Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Thr Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu



Asp Leu Gly Val Tyr Tyr Cys Phe Glu Gly Ser His Val Pro Tyr Thr



Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro



Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly



Ala Ser Val Val Cys Phe Leu Asn Asn Thr Tyr Pro Lys Asp Ile Asn



Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn



Ser Trp Thr Asp Glu Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser



Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr



Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe



Asn Arg Asn Glu Cys





301
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Gln Thr



Val Thr Trp Pro Asp Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Thr Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





302
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Ala Ile Pro



Met Ser Ile Pro Pro Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Thr Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Thr Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Gln Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





303
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Gly Tyr Glu



Val His His Glu Lys Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Glu Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





304
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val His His



Gln Lys Leu Val Phe Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Gln Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





305
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Ile Arg Arg



Val Ser Tyr Ser Phe Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr



Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys



Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu



Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys



Val Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly



Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp



Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe



Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr



Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala



Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val



Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser



Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr



Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys



Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn



Arg Asn Glu Cys





306
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Met Pro Tyr



Asp Leu Tyr His Pro Ile Leu Phe Phe Arg Leu Ser Gly Gly Gly Asp



Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Ser Leu Gly Asp



Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His Ser Asn



Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro



Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro Asp



Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser



Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser



His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg



Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln



Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr



Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln



Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr



Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg



His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro



Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





307
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Gly Gly Ile



Gly Gln Leu Thr Ser Val Leu Met Ala Ala Pro Ser Gly Gly Gly Asp



Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Ser Leu Gly Asp



Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His Ser Asn



Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro



Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro Asp



Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser



Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser



His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg



Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln



Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr



Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln



Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr



Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg



His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro



Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





308
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Asp Ser Gly



Gly Phe Met Leu Thr Leu Val Leu Pro Val Leu Pro Ser Gly Gly Gly



Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Ser Leu Gly



Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His Ser



Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser



Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro



Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile



Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly



Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys



Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu



Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe



Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg



Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser



Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu



Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser



Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





309
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Thr Ser Glu



Phe Val Phe Ala Pro Asp Leu Gly Arg Phe Gln Thr Phe Ser Gly Gly



Gly Asp Ile Val Met Thr Gln Thr Thr Leu Ser Leu Pro Val Ser Leu



Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His



Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln



Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val



Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys



Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln



Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile



Lys Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser



Glu Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn



Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu



Arg Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp



Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr



Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr



Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys





310
Ala Cys Asn Leu Ile Val Gln Gly His Cys Gly Gly Ser Val Pro Leu



Ser Leu Tyr Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gnu Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





311
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly His Ser Val Pro Leu



Ser Leu Tyr Ser His Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





312
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Leu



Ser Leu Tyr Ser His Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Glu Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





313
Ala Cys Asn Leu Ile Val Gly His Cys Gly His Ser Val Pro Leu



Ser Leu Tyr Ser Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





314
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Gly Ser Val Pro Leu



Ser Leu Tyr His Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





315
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly His Ser Val Pro Leu



Ser Leu Tyr His Gly Gly Gly Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Gln Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Gln Arg Glu Asn Gly Val Leu Asn Ser Trp Thr



Asp Glu Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





316
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Pro Ser Val Pro Leu



Ser Leu Tyr Ser Gly Ala Ala Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Gln Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





317
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Ala Ser Val Pro Leu



Ser Leu Tyr Ser Gly Pro Ala Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile TYr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





318
Ala Cys Asn Leu Ile Val Glu Gly His Cys Gly Pro Ser Val Pro Leu



Ser Leu Tyr Ser Gly Pro Ala Asp Ile Val Met Thr Gln Thr Thr Leu



Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser



Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr



Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser



Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly



Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly



Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val Ser



Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser Val



Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys Trp



Lys Ile Asp Gly Ser Glu Arg Glu Asn Gly Val Leu Asn Ser Trp Thr



Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr



Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu Ala



Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg Asn



Glu Cys





319
Glu Ala Lys Leu Glu Gln Ser Gly Pro Val Leu Val Lys Pro Gly Ala



Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr



Tyr Met Asn Trp Val Lys Glu Ser His Gly Lys Ser Leu Glu Trp Ile



Gly Val Ile Asn Pro Tyr Asn Gly Asp Thr Ser Tyr Asn Gln Lys Phe



Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr



Met Glu Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys



Ala Arg Tyr Tyr Gly Ser Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu



Ile Thr Val Ser Ser Ala Lys Thr Thr ala Pro Ser Val Tyr Pro Leu



Ala Pro Val Cys Gly Asp Thr Thr Gly Ser Ser Val Thr Leu Gly Cys



Leu Val Lys Gly Tyr Phe Pro Glu Pro Val Thr Leu Thr Trp Asn Ser



Gly Ser Leu Ser Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser



Asp Leu Tyr Thr Leu Ser Ser Ser Val Thr Val Thr Ser Ser Thr Trp



Pro Ser Gln Ser Ile Thr Cys Asn Val Ala His Pro Ala Ser Ser Thr



Lys Val Asp Lys Lys Ile Glu Pro Arg Gly Pro Thr Ile Lys Pro Cys



Pro Pro Cys Lys Cys Pro Ala Pro Asn Leu Leu Gly Gly Pro Ser Val



Phe Ile Phe Pro Pro Lys Ile Lys Asp Val Leu Met Ile Ser Leu Ser



Pro Ile Val Thr Cys Val Val Val Asp Val Ser Glu Asp Asp Pro Asp



Val Gln Ile Ser Trp Phe Val Asn Asn Val Glu Val His Thr Ala Gln



Thr Gln Thr His Arg Glu Asp Tyr Asn Ser Thr Leu Arg Val Val Ser



Ala Leu Pro Ile Glu His Glu Asp Trp Met Ser Gly Lys Glu Phe Lys



Cys Lys Val Asn Asn Lys Asp Leu Pro Ala Pro Ile Gln Arg Thr Ile



Ser Lys Pro Lys Gly Ser Val Arg Ala Pro Glu Val Tyr Val Leu Pro



Pro Pro Glu Gln Glu Met Thr Lys Lys Gln Val Thr Leu Thr Cys Met



Val Thr Asp Phe Met Pro Glu Asp Ile Tyr Val Glu Trp Thr Asn Asn



Gly Lys Thr Glu Leu Asn Tyr Lys Asn Thr Glu Pro Val Leu Asp Ser



Asp Gly Ser Tyr Phe Met Tyr Ser Lys Leu Arg Val Glu Lys Lys Asn



Trp Val Glu Arg Asn Ser Tyr Ser Cys Ser Val Val His Glu Gly Leu



His Asn His His Thr Thr Lys Ser Phe Ser Arg Thr Pro Gly Lys





320
Glu Ala Lys Leu Gln Glu Ser Gly Pro Val Leu Val Lys Pro Gly Ala



Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr



Tyr Met Asn Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile



Gly Val Ile Asn Pro Tyr Asn Gly Asp Thr Ser Tyr Asn Gln Lys Phe



Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr



Met Glu Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys



Ala Arg Tyr Tyr Gly Ser Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu



Ile Thr Val Ser Ser Ala Lys Thr Thr Pro Pro Ser Val Tyr Pro Leu



Ala Pro Gly Cys Gly Asp Thr Thr Gly Ser Ser Val Thr Leu Gly Cys



Leu Val Lys Gly Tyr Phe Pro Glu Ser Val Thr Val Thr Trp Asn Ser



Gly Ser Leu Ser Ser Ser Val His Thr Phe Pro Ala Leu Leu Gln Ser



Gly Leu Tyr Thr Met Ser Ser Ser Val Thr Val Pro Ser Ser Thr Trp



Pro Ser Gln Thr Val Thr Cys Ser Val Ala His Pro Ala Ser Ser Thr



Thr Val Asp Lys Lys Leu Glu Pro Ser Gly Pro Ile Ser Thr Ile Asn



Pro Cys Pro Pro Cys Lys Glu Cys His Lys Cys Pro Ala Pro Asn Leu



Gln Gly Gly Pro Ser Val Phe Ile Phe Pro Pro Asn Ile Lys Asp Val



Leu Met Ile Ser Leu Thr Pro Lys Val Thr Cys Val Val Val Asp Val



Ser Glu Asp Asp Pro Asp Val Gln Ile Ser Trp Phe Val Asn Asn Val



Glu Val His Thr Ala Gln Thr Gln Thr His Arg Glu Asp Tyr Asn Ser



Thr Ile Arg Val Val Ser Thr Leu Pro Ile Glu His Glu Asp Trp Met



Ser Gly Lys Glu Phe Lys Cys Lys Val Asn Asn Lys Asp Leu Pro Ser



Pro Ile Glu Arg Thr Ile Ser Lys Ile Lys Gly Leu Val Arg Alp Pro



Gln Val Tyr Ile Leu Pro Pro Pro Ala Glu Gln Leu Ser Arg Lys Asp



Val Ser Leu Thr Cys Leu Val Val Gly Phe Asn Pro Gly Asp Ile Ser



Val Glu Trp Thr Ser Asn Gly His Thr Glu Glu Asn Tyr Lys Asp Thr



Ala Pro Val Leu Asp Ser Asp Gly Ser Tyr Phe Ile Tyr Ser Lys Leu



Asn Met Lys Thr Ser Lys Trp Glu Lys Thr Asp Ser Phe Ser Cys Asn



Val Arg His Glu Gly Leu Lys Asn Tyr Tyr Leu Lys Lys Thr Ile Ser



Arg Ser Pro Gly Lys





321
Asp Ile Val Met Thr Gln Thr Pro Leu Ser Leu Ser Val Thr Pro Gly



Gln Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Leu Leu Asn Ser



Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu Gln Lys Pro Gly Val Ser



Pro Gln Leu Leu Ile Tyr Leu Val Ser Lys Leu Gly Ser Gly Val Pro



Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile



Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Val Gln Gly



Thr His Asp Pro Trp Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys



Arg





322
Glu Ile Val Leu Thr Gln Ser Pro Asp Phe Gln Ser Val Thr Pro Lys



Glu Lys Val Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met



Tyr Trp Tyr Gln Gln Lys Pro Asp Gln Ser Pro Lys Leu Trp Val His



Gly Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu



Asp Ala Ala Thr Tyr Tyr Cys His His Trp Ser Asn Thr Gln Trp Thr



Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg





323
Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Glu



Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr His Thr Ile Thr Ser Gly



Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro Gly Lys Gly Met Glu Trp



Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr Asn Tyr Asn Pro Ser Leu



Lys Ser Arg Val Thr Ile Ser Arg Asp Thr Ser Lys Asn Gln Phe Phe



Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys



Ala Ser Met Met Val Pro His Tyr Tyr Val Met Asp Ala Trp Gly Gln



Gly Thr Leu Val Thr Val Ser Ser Ala





324
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser



Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr



Phe Met Asn Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Gly Trp Met



Gly Arg Val Asp Pro Glu Gln Gly Arg Ala Asp Tyr Ala Glu Lys Phe



Lys Lys Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr



Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys



Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe Ala Tyr Trp Gly Gln Gly



Thr Leu Val Thr Val Ser Ser Ala





325
Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln



Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr



Pro Arg Glu Ala Lys Val Glu Trp Lys Val Asp Asn Ala Leu Gln Ser



Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr



Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys



His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro



Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





326
Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser



Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe



Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly



Val His Thr Phe Pro Ala Val Leu Glu Ser Ser Gly Leu Tyr Ser Leu



Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr



Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys



Val Glu Pro Lys Ser CyS Asp Lys Thr His Thr Cys Pro Pro Cys Pro



Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys



Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val



Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr



Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Gln



Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His



Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys



Ala Leu Pro Ala Pro Ile Gln Lys Thr Ile Ser Lys Ala Lys Gly Gln



Pro Arg Glu Pro Glu Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu



Thr Lys Asn Glu Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro



Ser Asp Ile Ala Val Gln Trp Glu Ser Asn Gly Glu Pro Glu Asn Asn



Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu



Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Glu Gln Gly Asn Val



Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Glu



Lys Ser Leu Ser Leu Ser Pro Gly Lys





327
Asp Ile Val Met Thr Gln Thr Pro Leu Ser Leu Ser Val Thr Pro Gly



Gln Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Leu Leu Asn Ser



Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu Gln Lys Pro Gly Gln Ser



Pro Gln Leu Leu Ile Tyr Leu Val Ser Lys Leu Gly Ser Gly Val Pro



Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile



Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Val Gln Gly



Thr His Asp Pro Trp Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys



Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu



Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe



Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln



Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser



Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu



Lys His Lys Val Tyr Ala Cys Glu Val Thr His Glu Gly Leu Ser Ser



Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





328
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Asp Ile Val Met Thr Glu Thr Pro Leu Ser



Leu Ser Val Thr Pro Gly Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser



Gln Ser Leu Leu Asn Ser Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu



Gln Lys Pro Gly Gln Ser Pro Glu Leu Leu Ile Tyr Leu Val Ser Lys



Leu Gly Ser Gly Val Pro Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr



Asp Phr Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val



Tyr Tyr Cys Val Gln Gly Thr His Asp Pro Trp Thr Phe Gly Gly Gly



Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile



Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val



Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys



Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu



Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu



Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr



His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu



Cys





329
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Ser Gly Gly Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg



Ser Gly Gly Asp Ile Val Met Thr Gln Thr Pro Leu Ser Leu Ser Val



Thr Pro Gly Gln Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Leu



Leu Asn Ser Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu Gln Lys Pro



Gly Gln Ser Pro Gln Leu Leu Ile Tyr Leu Val Ser Lys Leu Gly Ser



Gly Val Pro Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr



Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys



Val Gln Gly Thr His Asp Pro Trp Thr Phe Gly Gly Gly Thr Lys Val



Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro



Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu



Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn



Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser



Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala



Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly



Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





330
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser



Gly Gly Asp Ile Val Met Thr Gln Thr Pro Leu Ser Leu Ser Val Thr



Pro Gly Gln Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Leu Leu



Asn Ser Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu Gln Lys Pro Gly



Gln Ser Pro Gln Leu Leu Ile Tyr Leu Val Ser Lys Leu Gly Ser Gly



Val Pro Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu



Lys Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Val



Gln Gly Thr His Asp Pro Trp Thr Phe Gly Gly Gly Thr Lys Val Glu



Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser



Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn



Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala



Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys



Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp



Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu



Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





331
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly



Gly Asp Ile Val Met Thr Gln Thr Pro Leu Ser Leu Ser Val Thr Pro



Gly Gln Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Leu Leu Asn



Ser Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu Gln Lys Pro Gly Gln



Ser Pro Gln Leu Leu Ile Tyr Leu Val Ser Lys Leu Gly Ser Gly Val



Pro Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys



Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Val Glu



Gly Thr His Asp Pro Trp Thr Phe Gly Gly Gly Thr Lys Val Glu Ile



Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp



Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn



Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu



Gln Ser Gly Asn Ser Glu Gln Ser Val Thr Glu Gln Asp Ser Lys Asp



Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr



Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Glu Gly Leu Ser



Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





332
Met Gln Thr Arg Cys Lys Glp Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Asp Ile Val Met Thr Glu Thr Pro Leu Ser Leu Ser Val Thr Pro Gly



Gln Pro Ala Ser Ile Ser Cys Arg Ser Ser Glu Ser Leu Leu Asn Ser



Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu Gln Lys Pro Gly Gln Ser



Pro Gln Leu Leu Ile Tyr Leu Val Ser Lys Leu Gly Ser Gly Val Pro



Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile



Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Val Gln Gly



Thr His Asp Pro Trp Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys



Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu



Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe



Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln



Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser



Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu



Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser



Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





333
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Ser Gly Gly Asp Ile Val Met Thr Gln Thr Pro Leu Ser Leu Ser Val



Thr Pro Gly Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Leu



Leu Asn Ser Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu Gln Lys Pro



Gly Gln Ser Pro Glu Leu Leu Ile Tyr Leu Val Ser Lys Leu Gly Ser



Gly Val Pro Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr



Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys



Val Gln Gly Thr His Asp Pro Trp Thr Phe Gly Gly Gly Thr Lys Val



Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro



Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu



Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn



Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser



Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala



Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly



Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





334
Glu Ile Val Leu Thr Gln Ser Pro Asp Phe Gln Ser Val Thr Pro Lys



Glu Lys Val Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met



Tyr Trp Tyr Glu Gln Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His



Gly Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu



Asp Ala Ala Thr Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr



Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro



Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr



Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys



Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu



Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser



Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala



Cys Glu Val Thr His Glu Gly Leu Ser Ser Pro Val Thr Lys Ser Phe



Asn Arg Gly Glu Cys





335
Ala Cys Lys His Ala Pro Tyr Ala Leu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Glu Ile Val Leu Thr Glu Ser Pro Asp Phe Glu Ser Val Thr Pro Lys



Glu Lys Val Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met



Tyr Trp Tyr Glu Gln Lys Pro Asp Gln Ser Pro Lys Leu Trp Val His



Gly Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu



Asp Ala Ala Thr Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr



Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro



Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr



Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys



Val Gln Trp Lys Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Gln Glu



Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser



Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala



Cys Glu Val Thr His Glu Gly Leu Ser Ser Pro Val Thr Lys Ser Phe



Asn Arg Gly Gln Cys





336
Ala Cys Pro Phe Pro Ala Lys Ile Leu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Glu Ile Val Leu Thr Glu Ser Pro Asp Phe Gln Ser Val Thr Pro Lys



Glu Lys Val Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met



Tyr Trp Tyr Glu Gln Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His



Gly Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu



Asp Ala Ala Thr Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr



Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro



Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr



Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys



Val Gln Trp Lys Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln



Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser



Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala



Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe



Asn Arg Gly Glu Cys





337
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Glu Ile Val Leu Thr Glu Ser Pro Asp Phe Glu Ser Val Thr Pro Lys



Glu Lys Val Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met



Tyr Trp Tyr Glu Gln Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His



Gly Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu



Asp Ala Ala Thr Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr



Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro



Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Glu Leu Lys Ser Gly Thr



Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys



Val Glu Trp Lys Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln



Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser



Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala



Cys Glu Val Thr His Glu Gly Leu Ser Ser Pro Val Thr Lys Ser Phe



Asn Arg Gly Glu Cys





338
Asn Trp Leu Gly Glu Trp Leu Pro Pro Gly Lys Val Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser



Gly Gly Glu Ile Val Leu Thr Glu Ser Pro Asp Phe Glu Ser Val Thr



Pro Lys Glu Lys Val Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser



Tyr Met Tyr Trp Tyr Glu Gln Lys Pro Asp Glu Ser Pro Lys Leu Trp



Val His Gly Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser



Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu



Ala Glu Asp Ala Ala Thr Tyr Tyr Cys His His Trp Ser Asn Thr Gln



Trp Thr Phe Gly Gly Gly Thr Lys Val Stu Ile Lys Arg Thr Val Ala



Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser



Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu



Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser



Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu



Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val



Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys



Ser Phe Asn Arg Gly Glu Cys





339
Gln Phe Ile Glu Cys Pro Asn Phe Pro Arg Glu Cys Pro Gly Lys Asn



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Glu Ile Val Leu Thr Glu Ser Pro Asp Phe



Gln Ser Val Thr Pro Lys Glu Lys Val Thr Ile Thr Cys Ser Ala Asn



Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Glu Gln Lys Pro Asp Glu Ser



Pro Lys Leu Trp Val His Gly Thr Ser Asn Leu Ala Ser Gly Val Pro



Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile



Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr Tyr Tyr Cys His His Trp



Ser Asn Thr Glu Trp Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys



Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu



Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe



Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln



Ser Gly Asn Ser Glu Gln Ser Val Thr Glu Gln Asp Ser Lys Asp Ser



Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu



Lys His Lys Val Tyr Ala Sys Glu Val Thr His Glu Gly Leu Ser Ser



Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





340
Val Arg Gln Gln Cys Ser Leu Asn Pro Gly Arg Cys Pro Tyr Leu Val



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Glu Ile Val Leu Thr Gln Ser Pro Asp Phe



Gln Ser Val Thr Pro Lys Glu Lys Val Thr Ile Thr Cys Ser Ala Asn



Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Glu Gln Lys Pro Asp Glu Ser



Pro Lys Leu Trp Val His Gly Thr Ser Asn Leu Ala Ser Gly Val Pro



Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile



Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr Tyr Tyr Cys His His Trp



Ser Asn Thr Glu Trp Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys



Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu



Gln Leu Lys Ser Gly Thr Ala Ser Val Val Sys Leu Leu Asn Asn Phe



Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln



Ser Gly Asn Ser Glu Gln Ser Val Thr Glu Gln Asp Ser Lys Asp Ser



Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu



Lys His Lys Val Tyr Ala Sys Glu Val Thr His Glu Gly Leu Ser Ser



Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





341
Val Trp Gln Glu Cys His Thr Ala Pro Glu Leu Cys Pro Gly Lys Ile



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Gln Ile Val Leu Thr Glu Ser Pro Asp Phe



Gln Ser Val Thr Pro Lys Val Lys Val Thr Ile Thr Cys Ser Ala Asn



Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Gln Glu Lys Pro Asp Glu Ser



Pro Lys Leu Trp Val His Gly Thr Ser Asn Leu Ala Ser Gly Val Pro



Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile



Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr Tyr Tyr Cys His His Trp



Ser Asn Thr Glu Trp Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys



Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu



Gln Leu Lys Ser Gly Thr Ala Ser Val Val Sys Leu Leu Asn Asn Phe



Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys Val Asp Asn Ala Leu Gln



Ser Gly Asn Ser Glu Gln Ser Val Thr Glu Gln Asp Ser Lys Asp Ser



Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu



Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser



Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





342
Asp Ser Tyr Thr Cys Arg Gly Pro Thr Trp Met Cys Ala Gly Asn Met



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Asp Ile Val Met Thr Glu Thr Pro Leu Ser



Leu Ser Val Thr Pro Gly Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser



Gln Ser Leu Leu Asn Ser Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu



Gln Lys Pro Gly Gln Ser Pro Gln Leu Leu Ile Tyr Leu Val Ser Lys



Leu Gly Ser Gly Val Pro Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr



Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val



Tyr Tyr Cys Val Glu Gly Thr His Asp Pro Trp Thr Phe Gly Gly Gly



Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile



Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val



Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys



Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Glu



Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu



Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr



His Glu Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu



Cys





343
Phe Asn His Asp Cys Ser Gly His Trp Met Arg Cys Leu Asp Gln Gln



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Asp Ile Val Met Thr Glu Thr Pro Leu Ser



Leu Ser Val Thr Pro Gly Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser



Gln Ser Leu Leu Asn Ser Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu



Gln Lys Pro Gly Gln Ser Pro Glu Leu Leu Ile Tyr Leu Val Ser Lys



Leu Gly Ser Gly Val Pro Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr



Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val



Tyr Tyr Cys Val Gln Gly Thr His Asp Pro Trp Thr Phe Gly Gly Gly



Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile



Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val



Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys



Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Glu



Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu



Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr



His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu



Cys





344
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Gly Ser Val Pro Leu Ser Leu Tyr Ser Gly Gly Ser Gly Gly



Asp Ile Val Met Thr Glu Thr Pro Leu Ser Leu Ser Val Thr Pro Gly



Gln Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Leu Leu Asn Ser



Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu Gln Lys Pro Gly Gln Ser



Pro Gln Leu Leu Ile Tyr Leu Val Ser Lys Leu Gly Ser Gly Val Pro



Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile



Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Val Gln Gly



Thr His Asp Pro Trp Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys



Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu



Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe



Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln



Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser



Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu



Lys His Lys Val Tyr Ala Cys Glu Val Thr His Glu Gly Leu Ser Ser



Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





345
Asn Lys Ser Pro Cys Arg Pro Lys Met Val Ala Cys Tyr Gly Ile Leu



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Asp Ile Val Met Thr Gln Thr Pro Lue Ser



Leu Ser Val Thr Pro Gly Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser



Gln Ser Leu Leu Asn Ser Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu



Gln Lys Pro Gly Gln Ser Pro Gln Leu Leu Ile Tyr Leu Val Ser Lys



Leu Gly Ser Gly Val Pro Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr



Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val



Tyr Tyr Cys Val Gln Gly Thr His Asp Pro Trp Thr Phe Gly Gly Gly



Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile



Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val



Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys



Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Glu



Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu



Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Gly Val Thr



His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu



Cys





346
Pro Thr Pro Gln Cys Trp Asn Gln Tyr Tyr Glu Cys Trp Ile Pro Ser



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Asp Ile Val Met Thr Gln Thr Pro Leu Ser



Leu Ser Val Thr Pro Gly Gln Pro Ala Ser Ile Ser Cys Arg Ser Ser



Gln Ser Leu Leu Asn Ser Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu



Gln Lys Pro Gly Gln Ser Pro Gln Leu Leu Ile Tyr Leu Val Ser Lys



Leu Gly Ser Gly Val Pro Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr



Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val



Tyr Tyr Cys Val Glu Gly Thr His Asp Pro Trp Thr Phe Gly Gly Gly



Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile



Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val



Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys



Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu



Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu



Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr



His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu



Cys





347
Ser Gln Lys Cys Pro Trp Thr Lys Glu Thr Cys Met His Tyr Met Gly



Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn



Pro Arg Ser Gly Gly Asp Ile Val Met Thr Gln Thr Pro Leu Ser Leu



Ser Val Thr Pro Gly Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln



Ser Leu Leu Asn Ser Asn Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu Gln



Lys Pro Gly Glu Ser Pro Glu Leu Leu Ile Tyr Leu Val Ser Lys Leu



Gly Ser Gly Val Pro Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp



Phe Thr Leu Lys Ile Ser Arg Val Gln Ala Glu Asp Val Gly Val Tyr



Tyr Cys Val Glu Gly Thr His Asp Pro Trp Thr Phe Gly Gly Gly Thr



Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe



Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys



Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys Val



Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Glu Gln



Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser



Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His



Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





348
Trp His Leu Ser Met Tyr Pro Lys Pro Pro Ala Glu Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser



Gly Gly Asp Ile Val Met Thr Glu Thr Pro Leu Ser Leu Ser Val Thr



Pro Gly Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Glu Ser Leu Leu



Asn Ser Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu Glu Lys Pro Gly



Gln Ser Pro Glu Leu Leu Ile Tyr Leu Val Ser Lys Leu Gly Ser Gly



Val Pro Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu



Lys Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Val



Glu Gly Thr His Asp Pro Trp Thr Phe Gly Gly Gly Thr Lys Val Glu



Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser



Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn



Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala



Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Glu Gln Asp Ser Lys



Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp



Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Glu Gly Leu



Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





349
Trp His Thr Asp Gly Phe Tyr Thr Arg Leu Pro Ala Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser



Gly Gly Asp Ile Val Met Thr Gln Thr Pro Leu Ser Leu Ser Val Thr



Pro Gly Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Glu Ser Leu Leu



Asn Ser Asp Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu Glu Lys Pro Gly



Glu Ser Pro Glu Leu Leu Ile Tyr Leu Val Ser Lys Leu Gly Ser Gly



Val Pro Asn Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu



Lys Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Val



Glu Gly Thr His Asp Pro Trp Thr Phe Gly Gly Gly Thr Lys Val Glu



Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser



Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn



Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala



Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Glu Glu Asp Ser Lys



Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp



Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Glu Gly Leu



Ser Ser Pro Val Tin Lys Ser Phe Asn Arg Gly Glu Cys





350
Glu Ile Val Leu Thr Glu Ser Pro Asp Phe Gln Ser Val Thr Pro Lys



Glu Lys Val Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met



Tyr Trp Tyr Glu Gln Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His



Gly Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu



Asp Ala Ala Thr Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr



Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro



Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr



Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys



Val Glu Trp Lys Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln



Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser



Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala



Cys Glu Val Thr His Glu Gly Leu Ser Ser Pro Val Thr Lys Ser Phe



Asn Arg Gly Glu Cys





351
Ala Cys Ile His Ala Pro Tyr Ala Lys Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Glu Ile Val Leu Thr Glu Ser Pro Asp Phe Gln Ser Val Thr Pro Lys



Glu Lys Val Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met



Tyr Trp Tyr Glu Gln Lys Pro Asp Gln Ser Pro Lys Leu Trp Val His



Gly Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu



Asp Ala Ala Thr Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr



Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro



Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr



Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys



Val Glu Trp Lys Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln



Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser



Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala



Cys Glu Val Thr His Glu Gly Leu Ser Ser Pro Val Thr Lys Ser Phe



Asn Arg Gly Glu Cys





352
Ala Cys Ile His Ala Pro Tyr Ala Lys Cys Gly Ser Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser



Gly Gly Glu Ile Val Leu Thr Glu Ser Pro Asp Phe Glu Ser Val Thr



Pro Lys Glu Lys Val Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser



Tyr Met Tyr Trp Tyr Glu Gln Lys Pro Asp Glu Ser Pro Lys Leu Trp



Val His Gly Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser



Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu



Ala Glu Asp Ala Ala Thr Tyr Tyr Cys His His Trp Ser Asn Thr Gln



Trp Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala



Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser



Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu



Ala Lys Val Glu Trp Lys Val Asp Asn Ala Leu Glu Ser Gly Asn Ser



Gln Gln Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu



Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val



Tyr Ala Cys Glu Val Thr His Glu Gly Leu Ser Ser Pro Val Thr Lys



Ser Phe Asn Arg Gly Glu Cys





353
Ala Cys Pro Ala Lys Ile Gly Glu Gln Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Glu Ile Val Leu Thr Glu Ser Pro Asp Phe Glu Ser Val Thr Pro Lys



Glu Lys Val Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met



Tyr Trp Tyr Glu Gln Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His



Gly Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu



Asp Ala Ala Thr Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr



Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro



Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr



Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys



Val Gln Trp Lys Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln



Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser



Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala



Cys Glu Val Thr His Glu Gly Leu Ser Ser Pro Val Thr Lys Ser Phe



Asn Arg Gly Glu Cys





354
Ala Cys Pro Ala Lys Ile Gly Glu Gln Cys Gly Ser Ser Gly Gly Ser



Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly Glu Ile



Val Leu Thr Glu Ser Pro Asp Phe Glu Ser Val Thr Pro Lys Glu Lys



Val Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp



Tyr Glu Gln Lys Pro Asp Gln Ser Pro Lys Leu Trp Val His Gly Thr



Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser



Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala



Ala Thr Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr Phe Gly



Gly Gly Thr Lys Val Gln Ile Lys Arg Thr Val Ala Ala Pro Ser Val



Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser



Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Glu



Trp Lys Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln Ser Val



Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu



Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu



Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg



Gly Glu Cys





355
Ala Cys Pro Phe Pro Ala Leu Gln Leu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Glu Ile Val Leu Thr Gln Ser Pro Asp Phe Glu Ser Val Thr Pro Lys



Glu Lys Val Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met



Tyr Trp Tyr Glu Gln Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His



Gly Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu



Asp Ala Ala Thr Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr



Phe Gly Gly Gly Thr Lys Val Gln Ile Lys Arg Thr Val Ala Ala Pro



Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr



Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys



Val Glu Trp Lys Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Glu



Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser



Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala



Cys Gln Val Thr His Glu Gly Leu Ser Ser Pro Val Thr Lys Ser Phe



Asn Arg Gly Glu Cys





356
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Gly



Ser Gly Gly Glu Ile Val Leu Thr Glu Ser Pro Asp Phe Gln Ser Val



Thr Pro Lys Glu Lys Val Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu



Ser Tyr Met Tyr Trp Tyr Gln Gln Lys Pro Asn Glu Ser Pro Lys Leu



Trp Val His Gly Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe



Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu



Glu Ala Glu Asp Ala Ala Thr Tyr Tyr Cys His His Trp Ser Asn Thr



Gln Trp Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val



Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys



Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg



Glu Ala Lys Val Glu Trp Lys Val Asp Asn Ala Leu Glu Ser Gly Asn



Ser Glu Gln Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thf Tyr Ser



Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys



Val Tyr Ala Cys Glu Val Thr His Glu Gly Leu Ser Ser Pro Val Thr



Lys Ser Phe Asn Arg Gly Glu Cys





357
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Gly Ser Thr Ser



Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly Glu Ile Val Leu



Thr Glu Ser Pro Asp Phe Glu Ser Val Thr Pro Lys Glu Lys Val Thr



Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Glu



Gln Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His Gly Thr Ser Asn



Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr



Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr



Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr Phe Gly Gly Gly



Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile



Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val



Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys



Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Gln



Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu



Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr



His Glu Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu



Cys





358
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Gly Ser Ser Gly



Gly Ser Gly Val Pro Leu Ser Leu Tyr Ser Gly Gly Glu Ile Val Leu



Thr Glu Ser Pro Asp Phe Glu Ser Val Thr Pro Lys Glu Lys Val Thr



Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Glu



Glu Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His Gly Thr Ser Asn



Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr



Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr



Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr Phe Gly Gly Gly



Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile



Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly TN- Ala Ser Val Val



Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys



Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Glu



Glu Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu



Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr



His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu



Cys





359
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Ser Thr Ser Thr Ser



Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly Glu Ile Val Leu Thr Glu



Ser Pro Asp Phe Glu Ser Val Thr Pro Lys Glu Lys Val Thr Ile Thr



Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Glu Gln Lys



Pro Asp Glu Ser Pro Lys Leu Trp Val His Gly Thr Ser Asn Leu Ala



Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Thr



Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr Tyr Tyr



Cys His His Trp Ser Asn Thr Gln Trp Thr Phe Gly Gly Gly Thr Lys



Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Thr Pro



Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu



Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys Val Asp



Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Glu Gln Asp



Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys



Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Glu



Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





360
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Ser Thr Ser Thr



Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly Glu Ile Val Leu Thr



Glu Ser Pro Asp Thr Glu Ser Val Thr Pro Lys Glu Lys Val Thr Ile



Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Glu Gln



Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His Gly Thr Ser Asn Leu



Ala Ser Gly Val Pro Ser Arg Thr Ser Gly Ser Gly Ser Gly Thr Asp



Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr Tyr



Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr Thr Gly Gly Gly Thr



Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe



Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys



Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys Val



Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Glu Gln



Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser



Lys Ala Asn Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His



Glu Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





361
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Gly Ser Thr Ser



Thr Ser Gly Arg Ser Ala Asn Pro Arg Gly Gly Glu Ile Val Leu Thr



Gln Ser Pro Asp Phe Glu Ser Val Thr Pro Lys Glu Lys Val Thr Ile



Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Glu Gln



Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His Gly Thr Ser Asn Leu



Ala Ser Gly Val Pro Ser Arg Thr Ser Gly Ser Gly Ser Gly Thr Asp



Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr Tyr



Tyr Cys His His Trp Ser Asn Ihr Glu Trp Thr Phe Gly Gly Gly Thr



Lys Val Glu Ile Lys Arg Thr Val Abs Ala Pro Ser Val Thr Ile Phe



Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys



Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val



Asp Asn Ala Leu Glu Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln



Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser



Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Aia Cys Glu Val Thr His



Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





362
Ala Cys Thr Lys Pro Ala Lys Aa Leu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Glu Ile Val Leu Thr Glu Ser Pro Asp Phe Glu Ser Val Thr Pro Lys



Glu Lys Val Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met



Tyr Trp Tyr Glu Gln Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His



Gly Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser



Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu



Asp Ala Ala Thr Tyr Tyr Cys His His Trp Ser Asn Thr Gln Trp Thr



Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro



Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Glu Leu Lys Ser Gly Thr



Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys



Val Glu Trp Lys Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln



Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser



Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala



Cys Glu Val Thr His Glu Gly Leu Ser Ser Pro Val Thr Lys Ser Phe



Asn Arg Gly Glu Cys





363
Asp Thr Ala Thr Cys Tyr Thr Thr Thr Gly Trp Cys Glu Gly Met Val



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Glu Ile Val Leu Thr Glu Ser Pro Asp Phe



Glu Ser Val Thr Pro Lys Glu Lys Val Thr Ile Thr Cys Ser Ala Asn



Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Glu Gln Lys Pro Asp Glu Ser



Pro Lys Leu Trp Val His Gly Thr Ser Asn Leu Ala Ser Gly Val Pro



Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile



Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr Tyr Tyr Cys His His Trp



Ser Asn Thr Glu Trp Thr Phe Gly Gly Gly Tht Lys Val Glu Ile Lys



Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu



Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe



Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys Val Asp Asn Ala Leu Glu



Ser Gly Asn Ser Glu Gln Ser Val Thr Glu Gln Asp Ser Lys Asp Ser



Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu



Lys His Lys Val Tyr Ala Cys Glu Val Thr His Glu Gly Leu Ser Ser



Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





364
Asn Ser Asp Asn Cys Gly Pro Ala Lys Ser Thr Cys Met Tyr Asn Asp



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Glu Ile Val Leu Thr Glu Ser Pro Asp Phe



Gln Ser Val Thr Pro Lys Glu Lys Val Thr Ile Thr Cys Ser Ala Asn



Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Glu Gln Lys Pro Asp Gln Ser



Pro Lys Leu Trp Val His Gly Thr Ser Asn Leu Ala Ser Gly Val Pro



Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile



Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr Tyr Tyr Cys His His Trp



Ser Asn Thr Glu Trp Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys



Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu



Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe



Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys Val Asp Asn Ala Leu Glu



Ser Gly Asn Ser Glu Gln Ser Val Thr Glu Gln Asp Ser Lys Asp Ser



Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu



Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser



Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





365
Pro Pro Gly Lys Cys Thr Glu Pro His Arg Cys Pro Pro Leu Asn Gly



Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn



Pro Arg Ser Gly Gly Glu Ile Val Leu Thr Gln Ser Pro Asp Phe Glu



Ser Val Thr Pro Lys Glu Lys Val Thr Ile Thr Cys Ser Ala Asn Ser



Ala Leu Ser Tyr Met Tyr Trp Tyr Glu Gln Lys Pro Asp Gln Ser Pro



Lys Leu Trp Val His Gly Thr Ser Asn Leu Ala Ser Gly Val Pro Ser



Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn



Ser Leu Glu Ala Glu Asp Ala Ala Thr Tyr Tyr Cys His His Trp Ser



Asn Thr Gln Trp Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg



Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln



Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr



Pro Arg Glu Ala Lys Val Glu Trp Lys Val Asp Asn Ala Leu Glu Ser



Gly Asn Ser Glu Gln Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr



Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys



His Lys Val Tyr Ala Cys Glu Val Thr His Glu Gly Leu Ser Ser Pro



Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





366
Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Ser Pro Ser Glu



Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr His Thr Ile Thr Ser Gly



Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro Gly Lys Gly Met Glu Trp



Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr Asn Tyr Asn Pro Ser Leu



Lys Ser Arg Val Thr Ile Ser Arg Asp Thr Ser Lys Asn Glu Phe Phe



Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys



Ala Ser Met Met Val Pro His Tyr Tyr Val Met Asp Ala Trp Gly Glu



Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val



Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala



Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser



Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val



Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro



Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys



Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp



Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly



Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile



Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu



Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His



Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg



Val Val Ser Val Leu Thr Val Leu His Glu Asp Trp Leu Asn Gly Lys



Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu



Lys Thr Ile Ser Lys Ala Lyc Gly Gln Pro Arg Glu Pro Glu Val Tyr



Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asp Glu Val Ser Leu



Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp



Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val



Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp



Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His



Glu Ala Leu His Asn His Tyr Thr Glu Lys Ser Leu Ser Leu Ser Pro



Gly Lys





367
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Glu Val Gln Leu Glu Gln Ser Gly Pro Gly



Leu Val Lys Pro Ser Glu Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr



His Thr Ile Thr Ser Gly Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro



Gly Lys Gly Met Glu Trp Ile Gly Tye Ile Ser Tyr Ser Gly Asn Thr



Asn Tyr Asn Pro Ser Leu Lys Ser Arg Val Thr Ile Ser Arg Asp Thr



Ser Lys Asn Glu Phe Phe Leu Lys Leu Ser Ser Val Thr Ala Ala Asp



Thr Ala Val Tyr Tyr Cys Ala Ser Met Met Val Pro His Tyr Tyr Val



Met Asp Ala Trp Gly Glu Gly Thr Leu Val Thr Val Ser Ser Ala Ser



Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr



Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro



Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val



His Thr Phe Pro Ala Val Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser



Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile



Cys Asn Val Asn His Lys Pro Ser Asn Thi Lys Val Asp Lys Lys Val



Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala



Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro



Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val



Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val



Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln



Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Glu



Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala



Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro



Arg Glu Pro Glu Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr



Lys Asn Glu Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser



Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr



Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu TYr



Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe



Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys



Ser Leu Ser Leu Ser Pro Gly Lys





368
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Ser Gly Gly Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg



Ser Gly Gly Glu Val Glu Leu Glu Gln Ser Gly Pro Gly Leu Val Lys



Pro Ser Glu Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr His Thr Ile



Thr Ser Gly Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro Gly Lys Gly



Met Glu Trp Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr Asn Tyr Asn



Pro Ser Leu Lys Ser Arg Val Thr Ile Ser Arg Asp Thr Ser Lys Asn



Gln Phe Phe Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val



Tyr Tyr Cys Ala Sc: Met Met Val Pro His Tyr Tyr Val Met Asp Ala



Trp Gly Glu Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly



Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly



Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val



Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe



Pro Ala Val Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val



Thr Val Pro Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val



Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys



Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu



Leu Gly Gly Pro Ser Val Pho Leu Phe Pro Pro Lys Pro Lys Asp Thr



Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val



Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asn Gly Val



Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Gln Glu Tyr Asn Ser



Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Glu Asp Trp Leu



Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala



Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro



Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln



Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala



Val Glu Trp Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr



Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu



Thr Val Asp Lys Ser Arg Trp Glu Gln Gly Asn Val Phe Ser Cys Ser



Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser



Leu Ser Pro Gly Lys





369
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser



Gly Gly Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro



Ser Glu Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr His Thr Ile Thr



Ser Gly Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro Gly Lys Gly Met



Glu Trp Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr Asn Tyr Asn Pro



Ser Leu Lys Ser Arg Val Thr Ile Ser Arg Asp Thr Ser Lys Asn Glu



Phe Phe Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr



Tyr Cys Ala Ser Met Met Val Pro His Tyr Tyr Val Met Asp Ala Trp



Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro



Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr



Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr



Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro



Ala Val Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr



Val Pro Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val Asn



His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser



Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu



Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu



Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser



His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu



Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr



Tyr Arg Val Val Ser Val Leu Thr Val Leu His Glu Asp Trp Leu Asn



Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro



Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro Gln



Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val



Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val



Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro



Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr



Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val



Met His Glu Ala Leu His Asn His Tyr Thr Glu Lys Ser Leu Ser Leu



Ser Pro Gly Lys





370
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly



Gly Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser



Glu Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr His Thr Ile Thr Ser



Gly Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro Gly Lys Gly Met Glu



Trp Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr Asn Tyr Asn Pro Ser



Leu Lys Ser Arg Val Thr Ile Ser Arg Asp Thr Ser Lys Asn Gln Phe



Phe Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr



Cys Ala Ser Met Met Val Pro His TYr Tyr Val Met Asp Ala Trp Gly



Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser



Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala



Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val



Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala



Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val



Pro Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val Asn His



Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys



Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly



Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met



Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His



Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val



His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr ASn Ser Thr Tyr



Arg Val Val Ser Val Leu Thr Val Leu His Glu Asp Trp Leu Asn Gly



Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile



Glu Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro Gln Val



Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser



Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu



Trp Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro



Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val



Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met



His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser



Pro Gly Lys





371
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Glu



Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr His Thr Ile Thr Ser Gly



Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro Gly Lys Gly Met Glu Trp



Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr Asn Tyr Asn Pro Ser Leu



Lys Ser Arg Val Thr Ile Ser Arg Asp Thr Ser Lys Asn Gln Phe Phe



Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys



Ala Ser Met Met Val Pro His Tyr Tyr Val Met Asp Ala Trp Gly Gln



Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val



Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala



Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser



Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val



Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro



Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val Asn His Lys



Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp



Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly



Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile



Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu



Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His



Asn Ala Lys Thr Lys Pro Arg Glu Gln Glu Tyr Asn Ser Thr Tyr Arg



Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys



Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu



Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Glu Val Tyr



Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu



Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp



Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val



Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp



Lys Ser Arg Trp Glu Gln Gly Asn Val Phe Ser Cys Ser Val Met His



Glu Ala Leu His Asn His Tyr Thr Glu Lys Ser Leu Ser Leu Ser Pro



Gly Lys





372
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Ser Gly Gly Glu Val Glu Leu Glu Gln Ser Gly Pro Gly Leu Val Lys



Pro Ser Glu Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr His Thr Ile



Thr Ser Gly Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro Gly Lys Gly



Met Glu Trp Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr Asn Tyr Asn



Pro Ser Leu Lys Ser Arg Val Thr Ile Ser Arg Asp Thr Ser Lys Asn



Gln Phe Phe Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val



Tyr Tyr Cys Ala Ser Met Met Val Pro His Tyr Tyr Val Met Asp Ala



Trp Gly Glu Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly



Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly



Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val



Thr Val Ser Imp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe



Pro Ala Val Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val



Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val



Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys



Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu



Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asn Thr



Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val



Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val



Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Gln Glu Tyr Asn Ser



Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Glu Asp Trp Leu



Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala



Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro



Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Glu



Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala



Val Glu Trp Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr



Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu



Thr Val Asp Lys Ser Ala Trp Glu Gln Gly Asn Val Phe Ser Cys Ser



Val Met His Glu Ala Leu His Asn His Tyr Thr Glu Lys Ser Leu Ser



Leu Ser Pro Gly Lys





373
Ala Cys Lys His Ala Pro Tyr Ala Leu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Gln Val Glu Leu Val Glu Ser Gly Ala Glu Val Lys Lys Pro Gly Ser



Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr



Phe Met Asn Trp Val Arg Glu Ala Pro Gly Glu Gly Leu Glu Trp Met



Gly Arg Val Asp Pro Glu Gln Gly Arg Ala Asp Tyr Ala Glu Lys Phe



Lys Lys Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr



Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys



Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe Ala Tyr Trp Gly Gln Gly



Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe



Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu



Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp



Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu



Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser



Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val Asn His Lys Pro



Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys



Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro



Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Leu Ser



Arg Thr Pro Glu Val Thr Cys Val Val Val Asn Val Ser His Glu Asp



Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Gln Val His Asn



Ala Lys Thr Lys Pro Arg Gln Glu Gln Tyr Asn Ser Thr Tyr Arg Val



Val Ser Val Leu Thr Val Leu His Glu Asp Trp Leu Asn Gly Lys Glu



Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys



Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro Glu Val Tyr Thr



Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Glu Val Ser Leu Thr



Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu



Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu



Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lvs Leu Thr Val Asp Lys



Ser Arg Trp Glu Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu



Ala Leu His Asn His TVr Thr Glu Lys Ser Leu Ser Leu Ser Pro Gly



Lys





374
Ala Cys Pro Phe Pro Ala Lys Ile Leu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser



Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr



Phe Met Asn Trp Val Arg Glu Ala Pro Gly Glu Gly Leu Glu Trp Met



Gly Arg Val Asp Pro Glu Gln Gly Arg Ala Asp Tyr Ala Glu Lys Phe



Lys Lys Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr



Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys



Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe Ala Tyr Trp Gly Glu Gly



Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe



Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu



Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp



Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu



Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser



Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro



Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys



Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro



Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser



Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp



Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn



Ala Lys Thr Lys Pro Arg Glu Gln Glu Tyr Asn Ser Thr Tyr Arg Val



Val Ser Val Leu Thr Val Leu His Glu Asp Trp Leu Asn Gly Lys Glu



Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys



Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro Glu Val Tyr Thr



Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Glu Val Ser Leu Thr



Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu



Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu



Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys



Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu



Ala Leu His Asn His Tyr Thr Glu Lys Ser Leu Ser Leu Ser Pro Gly



Lys





375
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Gln Val Gln Leu Val Glu Ser Gly Ala Glu Val Lys Lys Pro Gly Ser



Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr



Phe Met Asn Trp Val Arg Glu Ala Pro Gly Glu Gly Leu Gkl Trp Met



Gly Arg Val Asp Pro Glu Gln Gly Arg Ala Asp Tyr Ala Glu Lys Phe



Lys Lys Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr



Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys



Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe Ala Tyr Trp Gly Glu Gly



Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe



Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thi Ala Ala Leu



Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp



Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu



Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser



Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro



Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys



Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro



Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser



Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp



Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn



Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val



Val Ser Val Leu Thr Val Leu His Glu Asp Trp Leu Asn Gly Lys Glu



Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys



Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro Glu Val Tyr Thr



Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Glu Val Ser Leu Thr



Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu



Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu



Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys



Ser Arg Trp Glu Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu



Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Ley Ser Pro Gly



Lys





376
Asn Trp Leu Gly Glu Trp Leu Pro Pro Gly Lys Val Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser



Gly Gly Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro



Gly Ser Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr



Asn Tyr Phe Met Asn Trp Val Arg Glu Ala Pro Gly Glu Gly Leu Glu



Trp Met Gly Arg Val Asp Pro Glu Gln Gly Arg Ala Asp Tyr Ala Glu



Lys Phe Lys Lys Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr



Ala Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr



Tyr Cys Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe Ala Tyr Trp Gly



Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser



Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala



Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val



Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala



Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val



Pro Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val Asn His



Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys



Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly



Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met



Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His



Glu Asp Pro Gln Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val



His Asn Ala Lys Thr Lys Pro Arg Glu Gln Glu Tyr Asn Ser Thr Tyr



Arg Val Val Ser Val Leu Thr Val Leu His Glu Asp Trp Leu Asn Gly



Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile



Glu Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro Glu Val



Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Glu Val Ser



Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu



Trp Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro



Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val



Asp Lys Ser Arg Trp Glu Gln Gly Asn Val Phe Ser Cys Ser Val Met



His Glu Ala Leu His Asn His Tyr Thr Glu Lys Ser Leu Ser Leu Ser



Pro Gly Lys





377
Gln Phe Ile Glu Cys Pro Asn Phe Pro Arg Glu Cys Pro Gly Lys Asn



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Gln Val Glu Leu Val Gln Ser Gly Ala Glu



Val Lys Lys Pro Gly Ser Ser Val Lys Val Ser Cys Lys Ala Ser Gly



Tyr Thr Phe Thr Asn Tyr Phe Met Asn Trp Val Arg Gln Ala Pro Gly



Gln Gly Leu Glu Trp Met Gly Arg Val Asp Pro Glu Gln Gly Arg Ala



Asp Tyr Ala Glu Lys Phe Lys Lys Arg Val Thr Ile Thr Ala Asp Lys



Ser Thr Ser Thr Ala Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu Asp



Thr Ala Val Tyr Tyr Cys Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe



Ala Tyr Trp Gly Glu Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr



Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser



Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu



Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His



Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser



Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys



Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu



Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro



Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys



Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val



Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp



Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr



Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Glu Asp



Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu



Pro Ala Pro Ile Stu Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg



Glu Pro Glu Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys



Asn Glu Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp



Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys



Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser



Lys Leu Thr Val Asp Lys Ser Arg Trp Glu Gln Gly Asn Val Phe Ser



Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser



Leu Ser Leu Ser Pro Gly Lys





378
Val Arg Gln Gln Cys Ser Leu Asn Pro Gly Arg Cys Pro Tyr Leu Val



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Gln Val Glu Leu Val Glu Ser Gly Ala Glu



Val Lys Lys Pro Gly Ser Ser Val Lys Val Ser Cys Lys Ala Ser Gly



Tyr Thr Phe Thr Asn Tyr Phe Met Asn Trp Val Arg Glu Ala Pro Gly



Gln Gly Leu Glu Trp Met Gly Arg Val Asp Pro Glu Gln Gly Arg Ala



Asp Tyr Ala Glu Lys Phe Lys Lys Arg Val Thr Ile Thr Ala Asp Lys



Ser Thr Ser Thr Ala Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu Asp



Thr Ala Val Tyr Tyr Cys Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe



Ala Tyr Trp Gly Glu Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr



Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser



Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu



Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His



Thr Phe Pro Ala Val Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser Ser



Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys



Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu



Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro



Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys



Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val



Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp



Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Gln Gln Tyr



Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp



Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu



Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg



Glu Pro Glu Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys



Asn Glu Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp



Ile Ala Val Glu Trp Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys



Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser



Lys Leu Thr Val Asp Lys Ser Arg Trp Glu Gln Gly Asn Val Phe Ser



Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser



Leu Ser Leu Ser Pro Gly Lys





379
Val Trp Gln Glu Cys His Thr Ala Pro Glu Leu Cys Pro Gly Lys Ile



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Gln Val Glu Leu Val Glu Ser Gly Ala Glu



Val Lys Lys Pro Gly Ser Ser Val Lys Val Ser Cys Lys Ala Ser Gly



Tyr Thr Phe Thr Asn Tyr Phe Met Asn Trp Val Arg Glu Ala Pro Gly



Gln Gly Leu Glu Trp Met Gly Arg Val Asp Pro Glu Glu Gly Arg Ala



Asp Tyr Ala Glu Lys Phe Lys Lys Arg Val Thr Ile Thr Ala Asp Lys



Ser Thr Ser Thr Ala Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu Asp



Thr Ala Val Tyr Tyr Cys Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe



Ala Tyr Trp Gly Glu Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr



Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser



Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu



Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His



Thr Phe Pro Ala Val Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser Ser



Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys



Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Gln



Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro



Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys



Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val



Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp



Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Gln Glu Tyr



Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Glu Asp



Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu



Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg



Glu Pro Glu Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys



Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp



Ile Ala Val Glu Trp Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys



Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser



Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser



Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Glu Lys Ser



Leu Ser Lru Ser Pro Gly Lys





380
Gln Val Gln Leu Val Gln Sr Gly Ala Glu Val Lys Lys Pro Gly Ser



Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr



Phe Met Asn Trp Val Arg Glu Ala Pro Gly Gln Gly Leu Glu Trp Met



Gly Arg Val Asp Pro Glu Gln Gly Arg Ala Asp Tyr Ala Glu Lys Phe



Lys Lys Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr



Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys



Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe Ala Tyr Trp Gly Glu Gly



Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe



Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu



Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp



Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu



Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser



Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val Asn His Lys Pro



Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys



Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro



Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser



Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp



Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn



Ala Lys Thr Lys Pro Arg Glu Gln Glu Tyr Asn Ser Thr Tyr Arg Val



Val Ser Val Leu Thr Val Leu His Glu Asp Trp Leu Asn Gly Lys Glu



Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys



Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro Gln Val Tyr Thr



Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Glu Val Ser Leu Thr



Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu



Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu



Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys



Ser Arg Trp Glu Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu



Ala Leu His Asn His Tyr Thr Glu Lys Ser Leu Ser Leu Ser Pro Gly



Lys





381
Met Glu Thr Arg Cys Lys Gbu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Gly Ser Ser Gly



Gln Val Glu Leu Glu Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Glu



Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr His Thr Ile Thr Ser Gly



Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro Gly Lys Gly Met Glu Trp



Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr Asn Tyr Asn Pro Ser Leu



Lys Ser Arg Val Thr Ile Ser Arg Asp Thr Ser Lys Asn Glu Phe Phe



Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys



Ala Ser Met Met Val Pro His Tyr Tyr Val Met Asp Ala Trp Gly Gln



Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val



Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala



Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser



Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val



Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro



Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val Asn His Lys



Pro Ser Asn Thr Lys Val Asp Lys Lys Val Gto Pro Lys Ser Cys Asp



Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly



Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile



Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu



Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His



Asn Ala Lys Thr Lys Pro Arg Glu Gln Glu Tyr Asn Ser Thr Tyr Arg



Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys



Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu



Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro Glu Val Tyr



Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu



Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp



Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val



Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp



Lys Ser Arg Trp Glu Gln Gly Asp Val Phe Ser Cys Ser Val Met His



Glu Ala Leu His Asn His Tyr Thr Glu Lys Ser Leu Ser Leu Ser Pro



Gly Lys





382
Met Glu Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro His Ser Gly Gly



Gln Val Glu Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Glu



Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr His Thr Ile Thr Ser Gly



Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro Gly Lys Gly Met Glu Trp



Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr Asn Tyr Asn Pro Ser Leu



Lys Ser Arg Val Thr Ile Ser Arg Asp Thr Ser Lys Asn Glu Phe Phe



Leu Lys Leu Ser Se/ Val Thr Ala Ala Asp Thr Ala Val Tyr Tyl Cys



Ala Ser Met Met Val Pro His Tyr Tyr Val Met Asp Ala Trp Gly Glu



Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val



Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala



Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser



Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val



Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro



Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val Asn His Lys



Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp



Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly



Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile



Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu



Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His



Asn Ala Lys Thr Lys Pro Arg Glu Gln Gln Tyr Asn Ser Thr Tyr Arg



Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys



Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu



Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro Glu Val Tyr



Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Glu Val Ser Leu



Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp



Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val



Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp



Lys Ser Arg Trp Glu Gln Gly Asn Val Phe Ser Cys Ser Val Met His



Glu Ala Leu His Asn His Tyr Thr Glu Lys Ser Leu Ser Leu Ser Pro



Gly Lys





383
Asp Ser Tyr Thr Cys Arg Gly Pro Thr Trp Met Cys Ala Gly Asn Met



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Gln Val Glu Leu Glu Gln Ser Gly Pro Gly



Leu Val Lys Pro Ser Glu Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr



His Thr Ile Thr Ser Gly Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro



Gly Lys Gly Met Glu Trp Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr



Asn Tyr Asn Pro Ser Leu Lys Ser Arg Val Thr Ile Ser Arg Asp Thr



Ser Lys Asn Glu Phe Phe Leu Lys Leu Ser Ser Val Thr Ala Ala Asp



Thr Ala Val Tyr Tyr Cys Ala Ser Met Met Val Pro His Tyr Tyr Val



Met Asp Ala Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser



Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr



Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro



Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val



His Thr Phe Pro Ala Val Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser



Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile



Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val



Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala



Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro



Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val



Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val



Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Gln Glu



Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Glu



Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala



Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro



Arg Glu Pro Glu Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr



Lys Asn Glu Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser



Asp Ile Ala Val Glu Trp Gln Ser Asn Gly Glu Pro Glu Asn Asn Tyr



Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr



Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Glu Gln Gly Asn Val Phe



Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Glu Lys



Ser Leu Ser Leu Ser Pro Gly Lys





384
Phe Asn His Asp Cys Ser Gly His Trp Met Arg Cys Leu Asp Glu Gln



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Gln Val Glu Leu Glu Gln Ser Gly Pro Gly



Leu Val Lys Pro Ser Glu Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr



His Thr Ile Thr Ser Gly Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro



Gly Lys Gly Met Glu Trp Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr



Asn Tyr Asn Pro Ser Leu Lys Ser Arg Val Thr Ile Ser Arg Asp Thr



Ser Lys Asn Glu Phe Phe Leu Lys Leu Ser Ser Val Thr Ala Ala Asp



Thr Ala Val Tyr Tyr Cys Ala Ser Met Met Val Pro His Tyr Tyr Val



Met Asp Ala Trp Gly Glu Gly Thr Leu Val Thr Val Ser Ser Ala Ser



Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr



Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro



Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val



His Thr Phe Pro Ala Val Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser



Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile



Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val



Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala



Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro



Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val



Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val



Asp Gly Val Gln Val His Asn Ala Lys Thr Lys Pro Arg Gln Glu Gln



Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Glu



Asp Trp Ley Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala



Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Glp Pro



Arg Glu Pro Glu Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr



Lys Asn Glu Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser



Asp Ile Ala Val-Glu Trp Gln Ser Asn Gly Glu Pro Glu Asn Asn Tyr



Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr



Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe



Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Glu Lys



Ser Leu Ser Leu Ser Pro Gly Lys





385
Met Gln Thr Arg Cys Lys Glu Tyr Pro Arg Trp Cys Glu His Trp Leu



Gly Gly Gly Ser Val Pro Leu Ser Leu Tyr Ser Gly Gly Ser Gly Gly



Gln Val Glu Leu Glu Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Glu



Thr Leu Ser Leu Thr Cys Ser Val Thr Tye His Thr Ile Thr Ser Gly



Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro Gly Lys ply Met Glu Trp



Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr Asn Tyr Asn Pro Ser Leu



Lys Ser Arg Val Thr Ile Ser Arg Asp Thr Ser Lys Asn Gln Phe Phe



Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tye Tyr Cys



Ala Ser Met Met Val Pro His Tyr Tyr Val Met Asp Ala Trp Gly Gln



Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val



Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala



Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser



Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val



Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro



Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys



Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro LYS Ser Cys Asp



Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly



Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile



Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu



Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His



Asn Ala Lys Thr Lys Pro Arg Glu Gln Glu Tyr Asn Ser Thr Tyr Arg



Val Val Ser Val Leu Thr Val Leu His Glu Asp Trp Leu Asn Gly Lys



Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu



Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro Glu Val Tyr



Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Glu Val Ser Leu



Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp



Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val



Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp



Lys Ser Arg Trp Glu Gln Gly Asn Val Ile Ser Cys Ser Val Met His



Glu Ala Leu His Asn His Tyr Thr Glu Lys Ser Leu Ser Leu Ser Pro



Gly Lys





386
Asn Lys Ser Pro Cys Arg Pro Lys Met Val Ala Cys Tyr Gly Ile Leu



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Glu Val Glu Leu Glu Glu Ser Gly Pro Gly



Leu Val Lys Pro Ser Glu Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr



His Thr Ile Thr Ser Gly Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro



Gly Lys Gly Met Glu Trp Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr



Asn Tyr Asn Pro Ser Leu Lys Ser Arg Val Thr Ile Ser Arg Asp Thr



Ser Lys Asn Glu Phe Phe Leu Lys Leu Ser Ser Val Thr Ala Ala Asp



Thr Ala Val Tyr Tyr Cys Ala Ser Met Met Val Pro His Tyr Tyr Val



Met Asp Ala Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser



Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr



Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro



Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val



His Thr Phe Pro Ala Val Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser



Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile



Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val



Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala



Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro



Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val



Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val



Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln



Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Glu



Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala



Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro



Arg Glu Pro Glu Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr



Lys Asn Glu Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser



Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr



Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Cly Ser Phe Phe Leu Tyr



Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Glu Gln Gly Asn Val Phe



Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Glu Lys



Ser Leu Ser Leu Ser Pro Gly Lys





387
Pro Thr Pro Glu Cys Trp Asn Glu Tyr Tyr Glu Cys Trp Ile Pro Ser



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Glu Val Glu Leu Glu Gln Ser Gly Pro Gly



Leu Val Lys Pro Ser Glu Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr



His Thr Ile Thr Ser Gly Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro



Gly Lys Gly Met Glu Trp Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr



Asn Tyr Asn Pro Ser Leu Lys Ser Arg Val Thr Ile Ser Arg Asp Thr



Ser Lys Asn Glu Phe Phe Leu Lys Leu Ser Ser Val Thr Ala Ala Asp



Thr Ala Val Tyr Tyr Cys Ala Ser Met Met Val Pro His Tyr Tyr Val



Met Asp Ala Trp Gly Glu Gly Thr Leu Val Thr Val Ser Ser Ala Ser



Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr



Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro



Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val



His Thr Phe Pro Ala Val Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser



Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Glu Thr Tvr Ile



Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val



Glu Pro Lys Ser Cys Asp Lso Thr His Thr Cys Pro Pro Cys Pro Ala



Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro



Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val



Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val



Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Gln Gln



Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Glu



Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala



Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro



Arg Glu Pro Glu Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr



Lys Asn Glu Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser



Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr



Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr



Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Glu Gln Gly Asn Val Phe



Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Glu Lys



Ser Leu Ser Leu Ser Pro Gly Lys





388
Ser Gln Lys Cys Pro Trp Thr Lys Glu Thr Cys Met His Tyr Met Gly



Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn



Pro Arg Ser Gly Gly Glu Val Gln Leu Glu Gln Ser Gly Pro Gly Leu



Val Lys Pro Ser Glu Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr His



Thr Ile Thr Ser Gly Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro Gly



Lys Gly Met Gln Trp Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr Asn



Tyr Asn Pro Ser Leu Lys Ser Arg Val Thr Ile Ser Arg Asp Thr Ser



Lys Asn Glu Phe Phe Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr



Ala Val Tyr Tyr Cys Ala Ser Met Met Val Pro His Tyr Tyr Val Met



Asp Ala Trp Gly Glu Gly Thr Leu Val Thr Val Ser Arg Ala Ser Thr



Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser



Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu



Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His



Thr Phe Pro Ala Val Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser Ser



Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys



Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu



Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro



Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys



Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val PIT Cys Val Val Val



Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp



Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Gln Glu Gln Tyr



Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Glu Asp



Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu



Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg



Glu Pro Glu Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys



Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp



Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys



Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser



Lys Leu Thr Val Asp Lys Ser Arg Trp Glu Gln Gly Asn Val Phe Ser



Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser



Leu Ser Leu Ser Pro Gly Lys





389
Trp His Leu Ser Met Tyr Pro Lys Pro Pro Ala Glu Gly Gly Gly Ser



Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser



Gly Gly Glu Val Glu Leu Glu Gln Ser Gly Pro Gly Leu Val Lys Pro



Ser Glu Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr His Thr Ile Thr



Ser Gly Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro Gly Lye Gly Met



Glu Trp Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr Asn Tyr Asn Pro



Ser Leu Lys Ser Arg Val Thr Ile Ser Arg Asp Thr Ser Lys Asn Gln



Phe Phe Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr



Tyr Cys Ala Ser Met Met Val Pro His Tyr Tyr Val Met Asp Ala Trp



Gly Glu Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro



Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr



Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr



Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro



Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr



Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn



His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser



Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu



Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu



Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser



His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu



Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Glu Tyr Asn Ser Thr



Tyr Arg Val Val Ser Val Leu Thr Val Leu His Glu Asp Trp Leu Asn



Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro



Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro Gln



Val Tyr Thr Leu Pro Pro Ser Arg Asp 610 Leu Thr Lys Asn Glu Val



Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val



Glu Trp Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro



Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr



Val Asp Lys Ser Arg Trp Glu Gln Gly Asn Val Phe Ser Cys Ser Val



Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu



Ser Pro Gly Lys





390
Trp His Thr Asp Gly Phe Tyr Thr Arg Leu Pro Ala Gly Gly Gly Ser



Ser Gby Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser



Gly Gly Glu Val Glu Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro



Ser Glu Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr His Thr Ile Thr



Ser Gly Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro Gby Lys Gly Met



Glu Ttp Ile Gly Tyr Ile Ser Tyr Ser Gly Asn Thr Asn Tyr Asn Pro



Ser Leu Lys Ser Arg Val Thr Ile Ser Arg Asp Thr Ser Lys Asn Gln



Phe Phe Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr



Tyr Cys Ala Ser Met Met Val Pro His Tyr Tyr Val Met Asp Ala Trp



Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro



Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr



Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr



Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro



Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr



Val Pro Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val Asn



His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser



Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu



Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu



Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser



His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu



Val His Asn Ala Lys Thr Lys Pro Arg Glu Gln Glu Tyr Asn Ser Thr



Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn



Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro



Ile Glu Lys Thr fie Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro Glu



Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Glu Val



Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val



Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro



Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr



Val Asp Lys Ser Arg Trp Glu Gln Gly Asn Val Phe Ser Cys Ser Val



Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu



Ser Pro Gly Lys





391
Ala Cys Ile His Ala Pro Tyr Ala Lys Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Gln Val Glu Leu Val Glu Ser Gly Ala Glu Val Lys Lys Pro Gly Ser



Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr



Phe Met Asn Trp Val Arg Glu Ala Pro Gly Gln Gly Leu Glu Trp Met



Gly Arg Val Asp Pro Gln Glu Gly Arg Ala Asp Tyr Ala Glu Lys Phe



Lys Lys Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr



Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys



Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe Ala Tyr Trp Gly Gln Gly



Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe



Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu



Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp



Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu



Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser



Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val Asn His Lys Pro



Ser Asn Thr Lys Val Asp Lys Lys Val Gln Pro Lys Ser Cys Asp Lys



Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro



Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser



Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp



Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn



Ala Lys Thr Lys Pro Arg Glu Glu Glu Tyr Asn Ser Thr Tyr Arg Val



Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu



Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys



Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg GIU Pro Glu Val Tyr Thr



Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Glu Val Ser Leu Thr



Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu



Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu



Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys



Ser Arg Trp Glu Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu



Ala Leu His Asn His Tyr Thr Glu Lys Ser Leu Ser Leu Ser Pro Gly



Lys





392
Ala Cys Pro Ala Lys Ile Gly Gln Glu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Gln Val Glu Leu Val Glu Ser Gly Ala Glu Val Lys Lys Pro Gly Ser



Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr



Phe Met Asn Trp Val Arg Glu Ala Pro Gly Glu Gly Leu Glu Trp Met



Gly Arg Val Asp Pro Glu Gln Gly Arg Aia Asp Tyr Ala Glu Lys Phe



Lys Lys Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr



Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys



Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe Ala Tyr Trp Gly Gln Gly



Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe



Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu



Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp



Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu



Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser



Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val Asn His Lys Pro



Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys



Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro



Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser



Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp



Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn



Ala Lys Thr Lys Pro Arg Glu Gln Gln Tyr Asn Ser Thr Tyr Arg Val



Val Ser Val Leu Thr Val Leu His Glu Asn Trp Leu Asn Gly Lys Glu



Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys



Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Glu Val Tyr Thr



Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Glu Val Ser Leu Thr



Cys Leu Val Lys Gly Phe Tyr Pro Ser Asn Ile Ala Val Glu Trp Glu



Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu



Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys



Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu



Ala Leu His Asn His Tyr Thr Glu Lys Ser Leu Ser Leu Ser Pro Gly



Lys





393
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Gln Val Glu Leu Val Glu Ser Gly Ala Glu Val Lys Lys Pro Gly Ser



Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr



Phe Met Asn Trp Val Arg Glu Ala Pro Gly Glu Gly Leu Glu Trp Met



Gly Arg Val Asp Pro Glu Gln Gly Arg Ala Asp Tyr Ala Glu Lys Phe



Lys Lys Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr



Met Glu Leu Ser Ser Leu Arg Ser GLI Asp Thr Ala Val Tyr Tyr Cys



Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe Ala Tyr Trp Gly Gln Gly



Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe



Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu



Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp



Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu



Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser



Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val Asn His Lys Pro



Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys



Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro



Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser



Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp



Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn



Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val



Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu



Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys



Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Glu Val Tyr Thr



Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Glu Val Ser Leu Thr



Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu



Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu



Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys



Ser Arg Trp Glu Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu



Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly



Lys





394
Ala Cys Thr Lys Pro Ala Lys Ala Leu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn Pro Arg Ser Gly Gly



Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser



Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr



Phe Met Asn Trp Val Arg Glu Ala Pro Gly Gln Gly Leu Glu Trp Met



Gly Arg Val Asp Pro Glu Gln Gly Arg Ala Asp Tyr Ala Glu Lys Phe



Lys Lys Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr



Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys



Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe Ala Tyr Trp Gly Glu Gly



Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe



Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu



Gly Cys Leu Val Lys Asp Tyr Rho Pro Glu Pro Val Thr Val Ser Trp



Asn Ser Gly Ala Leu Thr Ser sly Val His Thr Phe Pro Ala Val Leu



Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser



Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val Asn His Lys Pro



Ser Asn Thr Lys Val Asp Lys Lys Val Stu Pro Lys Ser Cys Asp Lys



Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro



Ser Val Rho Leu Rho Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser



Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp



Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn



Ala Lys Thr Lys Pro Arg Glu Gln Gln Tyr Asn Ser Thr Tyr Arg Val



Val Ser Val Leu Thr Val Leu His Glu Asp Trp Leu Asn Gly Lys Glu



Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys



Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Ile Val TYr Thr



Leu Pro Pro Ser Arg Asn Glu Leu Thr Lys Asn Gln Val Ser Leu Thr



Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Gln Trp Glu



Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu



Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys



Ser Arg Trp Glu Gln Gly Asa Val Phe Ser Cys Ser Val Met His Glu



Ala Leu His Asn His Tyr Thr Glu Lys Ser Leu Ser Leu Ser Pro Gly



Lys





395
Asp Thr Ala Thr Cys Tyr Thr Thr Thr Gly Trp Cys Glu Gly Met Val



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Glu Val Glu Leu Val Glu Ser Gly Ala Glu



Val his Lys Pro Gly Ser Ser Val Lys Val Ser Cys Lys Ala Ser Gly



Tyr Thr Phe Thr Asn Tyr Phe Met Asn Trp Val Arg Gln Ala Pro Gly



Gln Gly Leu Glu Trp Met Gly Arg Val Asp Pro Glu Gln Gly Arg Ala



Asp Tyr Ala Glu Lys Phe Lys Lys Arg Val Thr Ile Thr Ala Asp Lys



Ser Thr Ser Thr Ala Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu Asp



Thr Ala Val Tyr Tyr Cys Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe



Ala Tyr Trp Gly Glu Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr



Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser



Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Thr Pro Glu



Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His



Thr Phe Pro Ala Val Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser Ser



Val Val Thr Val Pro Ser Ser Ser Ley Gly Thr Gln Thr Tyr lIe Cys



Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu



Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro



Glu Leu Leu Gly Gly Pro Ser Val Thr Leu Phe Pro Pro Lys Pro Lys



Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val



Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp



Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Gln Glu Tyr



Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Glu Asp



Trp Leu Asn Gly Lys Gln Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu



Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg



Glu Pro Glu Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys



Asn Glu Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp



Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys



Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser



Lys Leu Thr Val Asp Lys Ser Arg Trp Glu Gln Gly Asn Val Phe Ser



Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Glu Lys Ser



Leu Ser Leu Ser Pro Gly Lys





396
Asn Ser Asp Asn Cys Gly Pro Ala Lys Ser Cys Met Tyr Asn Asp



Gly Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala



Asn Pro Arg Ser Gly Gly Gln Val Gln Leu Val Gln Ser Gly Ala Glu



Val Lys Lys Pro Gly Ser Ser Val Lys Val Ser Cys Lys Ala Ser Gly



Tyr Thr Phe Thr Asn Tyr Phe Met Asn Trp Val Arg Gln Ala Pro Gly



Gln Gly Leu Glu Trp Met Gly Arg Val Asp Pro Glu Gln Gly Arg Ala



Asp Tyr Ala Glu Lys Phe Lys Lys Arg Val Thr Ile Thr Ala Asp Lys



Ser Thr Ser Thr Ala Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu Asp



Thr Ala Val Tyr Tyr Cys Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe



Ala Tyr Trp Gly Glu Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr



Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser



Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Thr Pro Glu



Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His



Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser



Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys



Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu



Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro



Glu Leu Leu Giv Gly Pro Ser Val Phe Leu Thr Pro Pro Lys Pro Lys



Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val



Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp



Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr



Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp



Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu



Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg



Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys



Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp



Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys



Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Thr Phe Leu Tyr Ser



Lys Leu Thr Val Asp Lys Ser Arg Trp Glu Gln Gly Asn Val Phe Ser



Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser



Leu Ser Leu Ser Pro Gly Lys





397
Pro Pro Gly Lys Cys Thr Gln Pro His Arg Cys Pro Pro Leu Asn Gly



Gly Gly Ser Ser Gly Gly Ser Thr Ser Thr Ser Gly Arg Ser Ala Asn



Pro Arg Ser Gly Gly Glu Val Glu Leu Val Glu Ser Gly Ala Glu Val



Lys Lys Pro Gly Ser Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr



Thr Phe Thr Asn Tyr Phe Met Asn Trp Val Arg Glu Ala Pro Gly Gln



Gly Leu Glu Trp Met Gly Arg Val Asp Pro Glu Gln Gly Arg Ala Asp



Tyr Ala Glu Lys Thr Lys Lys Arg Val Thr Ile Thr Ala Asp Lys Ser



Thr Ser Thr Ala Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr



Ala Val Tyr Tyr Cys Ala Arg Arg Ala Met Asp Asn Tyr Gly Thr Ala



Tyr Trp Gly Glu Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys



Gly Pro Ser Val Thr Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly



Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro



Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr



Thr Pro Ala Val Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val



Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn



Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro



Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu



Leu Leu Gly Gly Pro Ser Val Phe Leu Thr Pro Pro Lys Pro Lys Asp



Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp



Val Ser His Glu Asp Pro Glu Val Lys Thr Asn Trp Tyr Val Asp Gly



Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Gln Glu Tyr Asn



Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Glu Asp Trp



Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro



Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu



Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn



Gln Val Ser Lea Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile



Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr



Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys



Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys



Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu



Ser Leu Ser Pro Gly Lys





398
Tyr Pro Tyr Asp Val Pro Asp Tyr Ala





399
Asp Tyr Lys Asp Asp Asp Asp Lys





400
Glu Gln Lys Leu Ile Ser Glu Glu Asp Leu





401
Gly Leu Asn Asn Ile Phe Gl Ala Gln Lys Ile Glu Trp His Glu





402
Gln Ser Leu Leu Asn Ser Asp Gly Asn Thr Tyr





403
Leu Val Ser





404
Val Gln Gly Thr His Asp Pro





405
Tyr His Thr Ile Thr Ser Gly Tyr





406
Ile Ser Tyr Ser Gly Asn Thr





407
Ala Ser Met Met Val Pro His Tyr Tyr Val Met Asp Ala





408
Ser Ala Leu Ser Tyr Met





409
Gly Thr Ser





410
His His Trp Ser Asn Thr Gln





411
Gly Tyr Thr Phe Thr Asn Tyr Phe





412
Val Asp Pro Glu Gln Gly Arg Ala Asp





413
Arg Arg Ala Met Asp Asn Tyr Gly Phe Ala Tyr





414
Gly Ser Gly Gly Ser Gly





415
Gly Gly Ser Gly Gly Ser





416
Gly Gly Pro Gly Ser Ser Pro





417
Gly Gly Ser Ser Pro Pro





418
Ser Ser Pro Ser Pro Ser Gly Gly





419
Gly Ser Pro Gly Ser Pro





420
Ser Ser Gly Gly Ser Gly Pro





421
Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser



Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr



Phe Met Asn Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met



Gly Arg VaI Asp Pro Glu Gln Gly Arg Ala Asp Tyr Ala Glu Lys Phe



Lys Lys Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr



Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Lys



Ala Arg Arg Ala Met Asp Asn Tyr Gly Phe Ala Tyr Trp Gly Glu Gly



Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe



Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser GlY Gly Thr Ala Ala Leu



Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp



Asn Ser Gly Ala Lau Thr Ser Gly Val His Thr Phe Pro Ala Val Leu



Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser



Ser Ser Leu Gly Thr Glu Thr Tyr Ile Cys Asn Val Asn His Lys Pro



Ser Asn Thr Lys Val Asp Lys Lys Val Gln Pro Lys Ser Cys Asp Lys



Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro



Asp Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser



Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp



Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn



Ala Lys Thr Lys Pro Arg Glu Gln Gln Tyr Asn Ser Thr Tyr Arg Val



Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu



Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Glu Glu Lys



Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr



Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr



Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu



Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu



Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys



Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu



Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly



Lys





422
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Ser Ser Gly Gly Ser Gly



Pro Asp Ser Gly Gly Phe Met Leu Thr Ser Gly Gly Glu Ile Val Leu



Thr Gln Ser Pro Asp Phe Gln Ser Val Thr Pro Lys Glu Lys Val Thr



Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Gln



Gln Lys Pro Asp Gln Ser Pro Lys Leu Trp Val His Gly Thr Ser Asn



Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr



Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr



Tyr Tyr Cys His His Trp Ser Asn Thr Gln Trp Thr Phe Gly Gly Gly



Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile



Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val



Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys



Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Glu



Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu



Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys GIU Val Thr



His Glu Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu



Cys





423
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Gly Ser Ser Gly



Gly Ser Gly Gly Ser Gly Gly Ser Gly Ser Gly Gly Glu Ile Val Leu



Thr Glu Ser Pro Asp Phe Gln Ser Val Thr Pro Lys Glu Lys Val Thr



Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Gln



Gln Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His Gly Thr Ser Asn



Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr



Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr



Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr Phe Gly Gly Gly



Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile



Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val



Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys



Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Glu



Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu



Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr



His Glu Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu



Cys





424
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Gly Ser Gly Gly Ser



Val Pro Leu Ser Leu Tyr Ser Gly Gly Glu Ile Val Leu Thr Gln Ser



Pro Asp Phe Gln Ser Val Thr Pro Lys Glu Lys Val Thr Ile Thr Cys



Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Gln Gln Lys Pro



Asp Gln Ser Pro Lys Leu Trp Val His Gly Thr Ser Asn Leu Ala Ser



Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr



Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr Tyr Tyr Cys



His His Trp Ser Asn Thr Glu Trp Thr Phe Gly Gly Gly Thr Lys Val



Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro



Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu



Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys Val Asp Asn



Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser



Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala



Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly



Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





425
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Gly Pro Gly Ser Ser



Pro Met Pro Tyr Asp Leu Tyr His Pro Ser Gly Gly Glu Ile Val Leu



Thr Gln Ser Pro Asp Phe Glu Ser Val Thr Pro Lys Glu Lys Val Thr



Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Glu



Gln Lys Pro Asp Gln Ser Pro Lys Leu Trp Val His Gly Thr Ser Asn



Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr



Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr



Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr Phe Gly Gly Gly



Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile



Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val



Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys



Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Glu



Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu



Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr



His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu



Cys





426
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Gly Ser Pro Pro



His Glu Gln Leu Thr Val Ser Gly Gly Glu Ile Val Leu Thr Glu Ser



Pro Asp Phe Glu Ser Val Thr Pro Lys Glu Lys Val Thr Ile Thr Cys



Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Glu Gln Lys Pro



Asp Glu Ser Pro Lys Leu Trp Val His Gly Thr Ser Asn Leu Ala Ser



Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr



Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr Tyr Tyr Cys



His His Trp Ser Asn Thr Glu Trp Thr Phe Gly Gly Gly Thr Lys Val



Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro



Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu



Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Glu Trp Lys Val Asp Asn



Ala Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Glu Gln Asp Ser



Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala



Asp Tyr Glu Lys His Lys Val Tyr Ala eys Glu Val Thr His Glu Gly



Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





427
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Gly Gly Ser Gly Gly Ser Gly Ser Gly Gly Glu Ile Val Leu



Thr Glu Ser Pro Asp Phe Glu Ser Val Thr Pro Lys Glu Lys Val Thr



Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Glu



Gln Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His Gly Thr Ser Asn



Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr



Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr



Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr Phe Gly Gly Gly



Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile



Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val



Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys



Val Asp Asn Ala Leu Glu Ser Gly Asn Ser Glu Gln Ser Val Thr Glu



Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu



Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr



His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu



Cys





428
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Ser Ser Pro Ser Pro Ser



Gly Gly Gly Gly Ile Gly Gln Leu Thr Ala Ser Gly Gly Glu Ile Val



Leu Thr Gln Ser Pro Asp Phe Gln Ser Val Thr Pro Lys Glu Lys Val



Thr Ile Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr



Gln Gln Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His Gly Thr Ser



Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly



Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala



Thr Tyr Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr Phe Gly Gly



Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe



Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val



Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Glu Trp



Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr



Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr



Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val



Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly



Glu Cys





429
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Gly Ser Ser Pro Pro



Arg Ala Ala Ala Val Lys Ser Pro Ser Gly Gly Glu Ile Val Leu Thr



Gln Swr Pro Asp Phe Gln Ser Val Thr Pro Lys Glu Lys Val Thr Ile



Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Glu Gln



Lys Pro Asp Glu Ser Pro Lys Leu Trp Val His Gly Thr Ser Asn Leu



Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp



Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr Tyr



Tyr Cys His His Trp Ser Asn Thr Gln Trp Ile Phe Gly Gly Gly Thr



Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe



Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys



Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val



Asp Asn Ala Leu Glu Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln



Asp Ser Lys Asp Ser Thr Tyr Ser Lea Ser Ser Thr Leu Thr Leu Ser



Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His



Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





430
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Gly Ser Ser Pro Pro



Thr Ser Val Leu Met Ala Ala Pro Ser Gly Gly Glu Ile Val Leu Thr



Gln Ser Pro Asp Phe Glu Ser Val Thr Pro Lys Glu Lys Val Thr Ile



Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Gln Gln



Lys Pro Asp Gln Ser Pro Lys Leu Trp Val His Gly Thr Ser Asn Leu



Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp



Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr Tyr



Tyr Cys His His Trp Ser Asn Thr Gln Trp Thr Phe Gly Gly Gly Thr



Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe



Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys



Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val



Asp Asn Ala Leu Gln Ser Gly Asn Ser Glu Gln Ser Val Thr Glu Gln



Asp Ser Lys Asp Ser Thr Tyr see Leu Ser Ser Thr Leu Thr Leu Ser



Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His



Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





431
Ala Cys Pr Phe Pro Ala Leu Glu Leu Cys Gly Ser Po Gly Ser Pro



Lys Pro Ile Leu Phe Phe Arg Leu Ser Gly Gly Glu Ile Val Leu Thr



Gln Ser Pro Asn Phe Glu Ser Val Thr Pro Lys Glu Lys Val Thr Ile



Thr Cys Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr Trp Tyr Gln Gln



Lys Pro Asn Glu Ser Pro Lys Leu Trp Val His Gly Thr Ser Asn Leu



Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp



Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala Glu Asp Ala Ala Thr Tyr



Tyr Cys His His Trp Ser Asn Thr Glu Trp Thr Phe Gly Gly Gly Thr



Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe



Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys



Leu Leu Asp Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val



Asp Asn Ala Leu Glu Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln



Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser



Lys Ala Asn Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His



Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys





432
Arg Ser Ser Gln Ser Leu Leu Asn Ser Asp Gly Asn Thr Tyr Leu Tyr





433
Leu Val Ser Lys Leu Gly Ser





434
Val Gln Gly Thr His Asp Pro Trp Thr





435
Ser Gly Tyr Asp Trp Thr





436
Tyr Ile Ser Tyr Ser Gly Asn Thr Asn Tyr Asn Pro Ser Leu Lys Ser





437
Met Met Val Pro His Tyr Tyr Val Met Asp Ala





438
Ser Ala Asn Ser Ala Leu Ser Tyr Met Tyr





439
Gly Thr Ser Asn Leu Ala Ser





440
His His Trp Ser Asn Thr Gln Trp Thr





441
Asn Tyr Phe Met Asn





442
Arg Val Asp Pro Glu Gln Gly Arg Ala Asp Tyr Ala Glu Lys Phe Lys



Lys





443
Arg Ala Met Asp Asn Tyr Gly Phe Ala Tyr





444
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Ser Ser Gly Gly Ser Gly



Pro Asp Ser Gly Gly Phe Met Leu Thr Ser Gly Gly





445
Ala Cys Pro Gly Lys Gly Leu Pro Ser Cys Gly Gly Gly Ser Ser Gly



Gly Ser Gly Gly Ser Gly Gly Ser Gly Ser Gly Gly





446
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Gly Ser Gly Gly Ser



Val Pro Leu Ser Leu Tyr Ser Gly Gly





447
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Gly Pro Gly Ser Ser



Pro Met Pro Tyr Asp Leu Tyr His Pro Ser Gly Gly





448
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Gly Ser Ser Pro Pro



His Glu Gln Leu Thr Val Ser Gly Gly





449
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Gly Gly Ser Ser Gly



Gly Ser Gly Gly Ser Gly Gly Ser Gly Ser Gly Gly





450
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Ser Ser Pro Ser Pro Ser



Gly Gly Gly Gly Ile Gly Gln Leu Thr Ala Ser Gly Gly





451
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Gly Ser Ser Pro Pro



Arg Ala Ala Ala Val Lys Ser Pro Ser Gly Gly





452
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Gly Ser Ser Pro Pro



Thr Ser Val Leu Met Ala Ala Pro Ser Gly Gly





453
Ala Cys Pro Phe Pro Ala Leu Glu Leu Cys Gly Ser Pro Gly Ser Pro



Lys Pro Ile Leu Phe Phe Arg Leu Ser Gly Gly





454
Gly Gly Gly Ser Ser Gly Gly Ser Gly Val Pro Leu Ser Leu Tyr Ser



Gly Gly





455
Ser Ser Gly Gly Ser Gly Pro Asp Ser Gly Gly Phe Met Leu Thr Ser



Gly Gly





456
Gly Gly Ser Gly Gly Ser Val Pro Leu Ser Leu Tyr Ser Gly Gly





457
Gly Gly Pro Gly Ser Ser Pro Met Pro Tyr Asp Leu Tyr His Pro Ser



Gly Gly





458
Gly Gly Ser Ser Pro Pro His Glu Gln Leu Thr Val Ser Gly Gly





459
Ser Ser Pro Ser Pro Ser Gly Gly Gly Gly Ile Gly Gln Leu Thr Ala



Ser Gly Gly





460
Gly Gly Ser Ser Pro Pro Arg Ala Ala Ala Val Lys Ser Pro Ser Gly



Gly





461
Gly Gly Ser Ser Pro Pro Thr Ser Val Leu Met Ala Ala Pro Ser Gly



Gly





462
Gly Ser Pro Gly Ser Pro Lys Pro Ile Leu Phe Phe Arg Leu Ser Gly



Gly





463
Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser



Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe



Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly



Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu



Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr



Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys



Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro



Ala Pro Glu Leu Leu Gly Gly Pro Asp Val Phe Leu Phe Pro Pro Lys



Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val



Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr



Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu



Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His



Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys



Ala Leu Pro Ala Pro Glu Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln



Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu



Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro



Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn



Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu



Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val



Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln



Lys Ser Leu Ser Leu Ser Pro Gly Lys





464
Ile Ser Ser Gly Leu Leu Ser Gly Arg Ser Asp Asn His





465
Ala Val Gly Leu Leu Ala Pro Pro Gly Gly Leu Ser Gly Arg Ser Asp



Asn His





466
Val Pro Leu Ser Leu Tyr Ser Gly





467
Arg Gln Ala Arg Val Val Gly





468
Leu Ser Gly Arg Ser Asn Ala Met Pro Tyr Asp Leu Tyr His Pro





469
Met Pro Tyr Asp Leu Tyr His Pro Arg Gln Ala Arg Val Val Gly





470
Lys Ile Ser Ser Gly Leu Leu Ser Gly Arg Ser Asp Asn His





471
Arg Ala Val Gly Leu Leu Ala Pro Pro Gly Gly Leu Ser Gly Arg Ser



Asp Asn His





472
Arg Gly Gly Val Pro Leu Ser Leu Tyr Ser Gly Gly Gly Lys





473
Arg Gly Gly Met Pro Tyr Asp Leu Tyr His Pro Gly Gly Lys





474
Arg Gly Gly Asp Ser Gly Gly Phe Met Leu Thr Gly Gly Lys





475
Arg Gly Ser Gly His Glu Gln Leu Thr Val Gly Gly Ser Lys





476
Gly Ser Gly Arg Ala Ala Ala Val Lys Ser Pro Gly Ser Lys





477
Gly Ser Gly Arg Gln Ala Arg Val Val Gly Gly Gly Ser Lys





478
Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Glu



Thr Leu Ser Leu Thr Cys Ser Val Thr Tyr His Thr Ile Thr Ser Gly



Tyr Asp Trp Thr Trp Ile Arg Lys Pro Pro Gly Lys Gly Met Glu Trp



Ile Gly Tyr Ile Ser Tyr Ser Giv Asn Thr Asn Tyr Asn Pro Ser Leu



Lys Ser Arg Val Thr Lie Ser Arg Asp Thr Ser Lys Asn Glu Phe Phe



Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys



Ala Ser Met Met Val Pro His Tyr Tyr Val Met Asp Ala Trp Gly Glu



Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val



Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala



Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser



Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val



Leu Glu Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro



Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys



Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp



Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly



Pro Asp Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile



Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu



Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His



Asn Ala Lys Thr Lys Pro Arg Glu Gln Glu TYr Asn Ser Thr Tyr Arg



Val Val Ser Val Leu Thr Val Leu His Glu Asp Trp Leu Asn Gly Lys



Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Gln Glu



Lys Thr Ile Ser Lys Ala Lys Gly Glu Pro Arg Glu Pro Glu Val Tyr



Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu



Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp



Glu Ser Asn Gly Glu Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val



Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp



Lys Ser Arg Trp Glu Gln Gly Asn Val Phe Ser Cys Ser Val Met His



Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro



Gly Lys





479
Ile Pro Glu Ser Leu Arg Ala Gly





480
Ile Pro Val Ser Leu Arg Ser Gly





481
Ile Tyr Asp Gln Lys Thr





482
Ala His Asn Tyr Lys Thr





483
Met Met Asp Gln Ala Asn





484
Met Leu Gly Glu Phe Val Ser Glu





485
Gly Leu Val Ala Leu Arg Gly Ala





486
Lys Glu His Lys Tyr Lys Ala Glu





487
Leu Ala Gln Ala Val Arg Ser Ser





488
Leu Gly Gly Ser Gly Arg Ser Asn Ala Gln Val Acg Leu Glu





489
Leu Gly Gly Ser Gly Arg Lys Ala Ser Leu Ser Leu Glu





490
Ser Gly Arg Ile Gly Phe Leu Arg Thr Ala





491
Ser Gly Ala Ile Gly Phe Leu Arg Thr Ala





492
Arg Pro Ala Arg Ser Gly Arg Ser Ala Gly Gly Ser Val Ala





493
Val Thr Gly Arg Gly Asp Ser Pro Ala Ser Ser





494
Pro Arg Phe Lys Ile Ile Gly Gly





495
Leu Ser Gly Arg Ile Gly Phe Leu Arg Thr Ala





496
Leu Ser Gly Arg Ser Asn Ala Gly Gly Ile Gly Gln Leu Thr Ala





497
Leu Ser Gly Arg Ser Asn Ala Val Pro Leu Ser Leu Tyr





498
Leu Ser Gly Arg Ser Asn Ala Asp Ser Gly Gly Phe Met Leu Thr





499
Leu Ser Gly Arg Ser Asn Ala His Glu Gln Leu Thr Ala





500
Leu Ser Gly Arg Ser Asn Ala Arg Ala Ala Ala Val Lys Ser Pro





501
Leu Ser Gly Arg Ser Asn Ala Thr Ser Val Leu Met Ala Ala Pro





502
Val Pro Leu Ser Leu Tyr Leu Ser Gly Arg Ser Asn Ala





503
Asp Ser Gly Gly Phe Met Leu Thr Leu Ser Gly Arg Ser Asn Ala





504
Gly Gly Ile Gly Gln Leu Thr Ala Leu Ser Gly Arg Ser Asn Ala





505
Met Pro Tyr Asp Leu Tyr His Pro Leu Ser Gly Arg Ser Asn Ala





506
His Glu Gln Leu Thr Val Leu Ser Gly Arg Ser Asn Ala





507
Arg Ala Ala Ala Val Lys Ser Pro Leu Ser Gly Arg Ser Asn Ala





508
Thr Ser Val Leu Met Ala Ala Pro Leu Ser Gly Arg Ser Asn Ala








Claims
  • 1. A method of treating cancer in a subject, comprising administering to the subject: (a) a masked anti-CTLA4 antibody comprising a masking peptide selected from the group consisting of SEQ ID NOs: 1-46 and a cleavable peptide linker; and(b) a PD-1 or PD-L1 inhibitor.
  • 2. The method of claim 1, wherein the cleavable peptide linker comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 47-88, 464-469, and 479-508.
  • 3. The method of claim 1, wherein the cleavable peptide linker comprises a spacer selected from the group consisting of SEQ ID NOs: 89-112 and 415-420 linked to the amino-terminus of the cleavable peptide linker, and a spacer selected from the group consisting of SEQ ID NOs: 89-112 and 415-420 linked to the carboxy-terminus of the cleavable peptide linker.
  • 4. The method of claim 1, wherein the cleavable peptide linker comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 454-462.
  • 5. The method of claim 1, wherein the masked antibody comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 113-231 and 444-453.
  • 6. The method of claim 1, wherein the masked anti-CTLA4 antibody is a humanized antibody, a chimeric antibody, a human antibody or antigen-binding fragment thereof.
  • 7. The method of claim 1, wherein the masked anti-CTLA4 antibody comprises a heavy chain variable region (vH) CDR1 comprising NYFMN, a vH CDR2 comprising RVDPEQGRADYAEKFKK, a vH CDR3 comprising RAMDNYGFAY; anda light chain variable region (vL) CDR1 comprising SANSALSYMY, a vL CDR2 comprising GTSNLAS, a vL CDR3 comprising HHWSNTQWT.
  • 8. The method of claim 6, wherein the masked anti-CTLA4 antibody is administered at an effective dose between about 0.1-20 mg/kg.
  • 9.-10. (canceled)
  • 11. The method of claim 1, wherein the masked anti-CTLA4 antibody comprises a heavy chain constant domain comprising amino acid substitutions S239D or 1332E or both, wherein the amino acid residues are numbered according to the EU index as in Kabat.
  • 12. The method of claim 1, wherein the masked anti-CTLA4 antibody comprises a vH that is at least 90% identical to SEQ ID NO: 324.
  • 13. The method of claim 1, wherein the masked anti-CTLA4 antibody comprises a vL that is at least 90% identical to SEQ ID NO: 322.
  • 14.-15. (canceled)
  • 16. The method of claim 13, wherein the anti-CTLA4 antibody or antigen-binding fragment thereof is conjugated to an agent selected from an inhibitor of tubulin polymerization, a DNA damaging agent, or a DNA synthesis inhibitor.
  • 17. (canceled)
  • 18. The method of claim 1, wherein the PD-1 or PD-L1 inhibitor is an antibody.
  • 19. The method of claim 18, wherein the PD-1/PD-L1 inhibitor is a PD-1 antibody.
  • 20.-26. (canceled)
  • 27. The method of claim 18, wherein the PD-1/PD-L1 inhibitor is a PD-L1 antibody.
  • 28. (canceled)
  • 29. The method of claim 27, wherein the anti-PD-L1 antibody is administered at an effective dose of between 200-2000 mg.
  • 30. (canceled)
  • 31. The method of claim 1, wherein the PD1 or PD-L1 inhibitor and the masked anti-CTLA4 antibody are formulated for intravenous administration.
  • 32. The method of claim 1, wherein the PD1 or PD-L1 inhibitor and the masked anti-CTLA4 antibody are formulated together in the same composition.
  • 33. The method of claim 1, wherein the PD1 or PD-L1 inhibitor and the masked anti-CTLA4 antibody are formulated separately.
  • 34. (canceled)
  • 35. The method of claim 1, wherein the cancer is leukemia, lymphoma, head and neck cancer, colorectal cancer, prostate cancer, pancreatic cancer, melanoma, myeloma, breast cancer, neuroblastoma, lung cancer, ovarian cancer, osteosarcoma, bladder cancer, cervical cancer, liver cancer, kidney cancer, skin cancer, testicular cancer, or cutaneous squamous cell carcinoma (CSCC).
  • 36.-38. (canceled)
CROSS REFERENCED APPLICATIONS

This application claims priority to, and the benefit of, U.S. provisional application No. 63/155,168, filed on Mar. 1, 2021, the contents of which is hereby incorporated by reference in its entirety.

Provisional Applications (1)
Number Date Country
63155168 Mar 2021 US