Patent Application
20120071344
This invention relates to molecular and cellular biology, biochemistry, molecular genetics, and drug design and discovery. In one aspect, the invention is directed to compositions, e.g., multiplexed platforms or systems, to screen for small molecule drugs that inhibit enzymes such as proteases, e.g., viral proteases, including viruses of the Flaviviridae or Retroviridae families, such as human immunodeficiency virus (HIV), Hepatitis C Virus (HCV) and Dengue Virus (DenV). In one embodiment, the invention provides a cell-based or multiplexed platform for monitoring the activity of enzymes, e.g., proteases such as viral proteases.
Current treatments for viral disease, e.g., human immunodeficiency virus (HIV), include inhibitors of proteases, e.g., HIV proteases; but these inhibitors can have severe side effects. Also, there has been a rapid emergence of viral, e.g., HIV, strains that are drug resistant, e.g., insensitive to currently used viral protease inhibitors, including HIV protease inhibitors.
HIV-1 protease, an aspartyl protease, is required for the efficient processing of the Gag and Gag-Pol precursor polyproteins; a critical step in the viral life cycle. For this reason, targeting protease has long been the focus of anti-retroviral therapy. However, aside from its proteolytic activity, its effects on the host cell are still unclear. Cytotoxic effects, together with instability, render expression of protease in mammalian cells difficult. Elucidating the role of protease in the viral life cycle, as well as discerning its effects on the host machinery, is vital for the design of novel therapeutic approaches.
A processive HIV-1 RNA-dependent RNA polymerase prone to errors, the emergence of resistant strains, and lack of vaccines, highlight the need for novel antivirals and innovative methods to facilitate their discovery.
In alternative embodiments, the invention provides cell-based methods, cell-based platforms or systems, or multiplexed platforms or systems, for monitoring the activity of an enzyme, a protease, a viral protease, or an HIV-1 protease, or Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, comprising (or made by a method comprising):
(1) (a) providing a nucleic acid encoding a scaffold protein (or one or more scaffold proteins) operatively linked to a transcriptional regulatory unit, wherein the scaffold protein comprises:
(b) providing a nucleic acid encoding the enzyme, protease, viral protease or HIV-1 protease, or Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, operatively linked to a transcriptional regulatory unit, or a cell that expresses a heterologous or endogenous enzyme, protease, viral protease or HIV-1 protease, or Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease;
(c) inserting (transfecting) the nucleic acid of (a) and (b) into the cell if the cell does not already express a heterologous or endogenous enzyme, protease, viral protease or HIV-1 protease, or Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease;
(d) co-expressing the nucleic acid of (a) and (b) in the cell, or expressing the nucleic acid of (a) in the cell if the cell already expresses a heterologous or endogenous enzyme, protease, viral protease or HIV-1 protease, or Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease; and
(e) determining whether the scaffold protein comprising the detectable moiety is expressed on the extracellular surface of the cell,
wherein an intact scaffold protein comprising the detectable moiety is expressed on the extracellular surface of the cell when the enzyme, protease, viral protease or HIV-1 protease, or Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease is not enzymatically active, and an intact scaffold protein is not or is substantially less expressed on the extracellular surface of the cell when the enzyme, protease, viral protease or HIV-1 protease, or Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease is enzymatically active (the detectable moiety is cleaved off by the enzyme, protease, viral protease or HIV-1 protease, or Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease);
(2) the cell-based method, cell-based platform or system or multiplexed platform of (1), wherein the scaffold protein further comprises an endoplasmic reticulum (ER) retention motif or a KDEL (SEQ ID NO:1) motif,
wherein the ER retention motif or KDEL (SEQ ID NO:1) motif is positioned in the scaffold protein such that when PR is active the scaffold will be separated into two pieces, leaving the ER retention motif-comprising or KDEL (SEQ ID NO:1) motif-comprising portion of the polypeptide in the ER and freeing the detectable moiety-comprising portion to the cell's extracellular membrane, and if PR is blocked or inactive, the entire scaffold polypeptide will be retained in the ER, and as a consequence will not be detected on the cell's extracellular surface;
(3) the cell-based method, cell-based platform or system or multiplexed platform of (1) or (2), wherein the scaffold protein further comprises a p2/p7 recognition site imbedded in the cytoplasmic loop of the scaffold;
(4) the cell-based method, cell-based platform or system or multiplexed platform of any of (1) to (3), further comprising screening for an inhibitor of an enzyme, a protease, a viral protease or an HIV-1 protease, or Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease by:
(5) the cell-based method, cell-based platform or system or multiplexed platform of any of (1) to (4), further comprising running a negative control comprising dividing the plurality of the cells co-expressing the nucleic acid of (a) and (b) in the cell and not adding the compound to be screened as an inhibitor to one of the divided cell samples;
(6) the cell-based method, cell-based platform or system or multiplexed platform of any of (1) to (5), further comprising running a positive control comprising dividing the plurality of the cells co-expressing the nucleic acid of (a) and (b) in the cell and adding a known inhibitor of the enzyme, protease, viral protease or HIV-1 protease, or Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, to one of the divided cell samples;
(7) the cell-based method, cell-based platform or system or multiplexed platform of any of (1) to (6), wherein the amino acid motif or subsequence susceptible to cleavage by the HIV-1 protease under physiologic (cell culture) conditions comprises SEQ ID NO:3 or SEQ ID NO:4;
(8) the cell-based method, cell-based platform or system or multiplexed platform of any of (1) to (7), wherein the HIV-1 protease comprises SEQ ID NO:5 or SEQ ID NO:6;
(9) the cell-based method, cell-based platform or system or multiplexed platform of any of (1) to (8), wherein the transcriptional regulatory unit comprises a promoter, an inducible promoter or a constitutive promoter;
(10) the cell-based method, cell-based platform or system or multiplexed platform of any of (1) to (9), wherein the cell is a mammalian cell, a monkey cell or a human cell, or a lymphocyte or a hepatocyte, or a T cell, and optionally the cells are genetically bar-coded;
(11) the cell-based method, cell-based platform or system or multiplexed platform of any of (1) to (10), wherein the scaffold proteins comprise all or part of a mouse Lyt2 or a human CD8 polypeptide;
(12) the cell-based method, cell-based platform or system or multiplexed platform of any of (1) to (11), wherein the detectable moiety comprises an epitope for an antibody, or a FLAG tag;
(13) the cell-based method, cell-based platform or system or multiplexed platform of any of (1) to (12), wherein the detectable moiety is detected or measured on the extracellular surface of the cell by a high throughput screen, a plate-reader, a flow cytometry or microscope visualization;
(14) the cell-based method, cell-based platform or system or multiplexed platform of any of (1) to (13), wherein the compound to be screened as an inhibitor of the enzyme, protease, viral protease or HIV-1 protease, or Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, comprises a small molecule, a nucleic acid, a polypeptide or peptide, a peptidomimetic, a polysaccharide or a lipid;
(15) the cell-based method, cell-based platform or system or multiplexed platform of any of (1) to (14), wherein the compound to be screened as an inhibitor of the enzyme, protease, viral protease or HIV-1 protease, or Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, is a member of a library of compounds to be screened, or a member of a random peptide library or a chemical compound library;
(16) the cell-based method, cell-based platform or system or multiplexed platform of any of (1) to (15), wherein the protease or enzyme is an HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus; or
(17) the cell-based method, cell-based platform or system or multiplexed platform of any of (1) to (16), wherein two or more, or a plurality of, enzymes or proteases are screened in the same cell, wherein optionally they are variants of the same enzyme or protease, or different enzymes or proteases, or a combination thereof.
In alternative embodiments, the invention provides cell-based platforms, multiplexed platforms or systems, or cell-based methods, for monitoring the activity of an enzyme or a protease comprising (or made by a method comprising):
(1) (a) providing a nucleic acid encoding a scaffold protein (or one or more scaffold proteins) operatively linked to a transcriptional regulatory unit, wherein the scaffold protein comprises:
(b) providing a nucleic acid encoding the protease operatively linked to a transcriptional regulatory unit, or a cell that expresses a heterologous or endogenous enzyme or protease;
(c) inserting (transfecting) the nucleic acid of (a) and (b) into the cell if the cell does not already express a heterologous or endogenous enzyme or protease;
(d) co-expressing the nucleic acid of (a) and (b) in the cell, or expressing the nucleic acid of (a) in the cell if the cell already expresses a heterologous or endogenous enzyme or protease; and
(e) determining whether the scaffold protein comprising the detectable moiety is expressed on the extracellular surface of the cell,
wherein an intact scaffold protein comprising the detectable moiety is expressed on the extracellular surface of the cell when the protease is not enzymatically active, and an intact scaffold protein is not or is substantially less expressed on the extracellular surface of the cell when the enzyme or protease is enzymatically active (the detectable moiety is cleaved off by the enzyme or protease); or
(2) the cell-based platform, multiplexed platform or system, or cell-based method of (1), wherein the scaffold protein further comprises an endoplasmic reticulum (ER) retention motif or a KDEL (SEQ ID NO:1) motif,
wherein the ER retention motif or KDEL (SEQ ID NO:1) motif is positioned in the scaffold protein such that when enzyme or protease is active the scaffold will be separated into two pieces, leaving the ER retention motif-comprising or KDEL (SEQ ID NO:1) motif-comprising portion of the polypeptide in the ER and freeing the detectable moiety-comprising portion to the cell's extracellular membrane, and if enzyme or protease is blocked or inactive, the entire scaffold polypeptide will be retained in the ER, and as a consequence will not be detected on the cell's extracellular surface;
(3) the cell-based platform, multiplexed platform or system, or cell-based method of (1) or (2), further comprising screening for an inhibitor of an enzyme or a protease by:
(4) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (3), further comprising running a negative control comprising dividing the plurality of the cells co-expressing the nucleic acid of (a) and (b) in the cell and not adding the compound to be screened as an inhibitor to one of the divided cell samples;
(5) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (4), further comprising running a positive control comprising dividing the plurality of the cells co-expressing the nucleic acid of (a) and (b) in the cell and adding a known inhibitor of the enzyme or protease to one of the divided cell samples;
(6) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (5), wherein the transcriptional regulatory unit comprises a promoter;
(7) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (6), wherein the transcriptional regulatory unit comprises an inducible promoter or a constitutive promoter;
(8) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (7), wherein the cell is a mammalian cell, a monkey cell or a human cell, or a lymphocyte or a hepatocyte, or a T cell, and optionally the cells are genetically bar-coded;
(9) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (8), wherein the scaffold proteins comprise all or part of a mouse Lyt2 or a human CD8 polypeptide;
(10) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (9), wherein the detectable moiety comprises an epitope for an antibody, or a FLAG tag;
(11) the cell-based platform, multiplexed platform or system, or cell-based method of (10), wherein the detectable moiety is detected or measured on the extracellular surface of the cell by a high throughput screen, a plate reader, a flow cytometry or a microscope visualization;
(12) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (11), wherein the compound to be screened as an inhibitor of protease comprises a small molecule, a nucleic acid, a polypeptide or peptide, a peptidomimetic, a polysaccharide or a lipid, or, wherein the compound to be screened as an inhibitor of protease is a member of a library of compounds to be screened, or a member of a random peptide library or a chemical compound library;
(13) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (12), wherein the protease or enzyme is an HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus; or
(14) the cell-based method, cell-based platform or multiplexed platform or system of any of (1) to (13), wherein two or more, or a plurality of, enzymes or proteases are screened in the same cell, wherein optionally they are variants of the same enzyme or protease, or different enzymes or proteases, or a combination thereof.
In alternative embodiments, the invention provides cell-based platforms, multiplexed platforms or systems, or cell-based methods, for monitoring the activity of a cell's ER and/or trans-Golgi network comprising (or made by a method comprising):
(1) (a) providing a nucleic acid encoding a scaffold protein (or one or more scaffold proteins) operatively linked to a transcriptional regulatory unit, wherein the scaffold protein comprises:
(b) inserting (transfecting) the scaffold protein-encoding nucleic acid of (a) into the cell;
(d) expressing the nucleic acid of (a); and
(e) determining whether the scaffold protein comprising the detectable moiety is expressed on the extracellular surface of the cell,
wherein the scaffold protein is expressed on the extracellular surface of the cell when the activity of the cell's ER and trans-Golgi network is functioning;
(2) the cell-based platform, multiplexed platform or system, or cell-based method of (1), wherein the scaffold protein further comprises an endoplasmic reticulum (ER) retention motif or a KDEL (SEQ ID NO:1) motif,
wherein the ER retention motif or KDEL (SEQ ID NO:1) motif is positioned in the scaffold protein such that when PR is active the scaffold will be separated into two pieces, leaving the ER retention motif-comprising or KDEL (SEQ ID NO:1) motif-comprising portion of the polypeptide in the ER and freeing the detectable moiety-comprising portion to the cell's extracellular membrane, and if PR is blocked or inactive, the entire scaffold polypeptide will be retained in the ER, and as a consequence will not be detected on the cell's extracellular surface;
(3) the cell-based platform, multiplexed platform or system, or cell-based method of (1) or (2), further comprising screening for an inhibitor of the cell's ER and trans-Golgi network by:
(4) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (3), further comprising running a negative control comprising dividing the plurality of the cells co-expressing the nucleic acid in the cell and not adding the compound to be screened as an inhibitor to one of the divided cell samples;
(5) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (4), further comprising running a positive control comprising dividing the plurality of the cells co-expressing the nucleic acid in the cell and adding a known inhibitor of the cell's ER and/or trans-Golgi network to one of the divided cell samples;
(6) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (5), wherein the transcriptional regulatory unit comprises a promoter, an inducible promoter or a constitutive promoter;
(7) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (6), wherein the cell is a mammalian cell, a monkey cell or a human cell, or a lymphocyte or a hepatocyte, or a T cell, and optionally the cells are genetically bar-coded;
(8) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (7), wherein the scaffold proteins comprise all or part of a mouse Lyt2 or a human CD8 polypeptide;
(9) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (8), wherein the detectable moiety comprises an epitope for an antibody, or a FLAG tag;
(10) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (9), wherein the detectable moiety is detected or measured on the extracellular surface of the cell by a high throughput screen, a plate reader, a flow cytometry or a microscope visualization;
(11) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (10), wherein the compound to be screened as an inhibitor of protease comprises a small molecule, a nucleic acid, a polypeptide or peptide, a peptidomimetic, a polysaccharide or a lipid, or wherein the compound to be screened as an inhibitor of protease is a member of a library of compounds to be screened, or a member of a random peptide library or a chemical compound library;
(12) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (11), wherein the protease or enzyme is an HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus; or
(13) the cell-based method, cell-based platform or multiplexed platform or system of any of (1) to (12), wherein two or more, or a plurality of, enzymes or proteases are screened in the same cell, wherein optionally they are variants of the same enzyme or protease, or different enzymes or proteases, or a combination thereof.
In alternative embodiments, the invention provides isolated, recombinant or synthetic nucleic acids encoding a scaffold protein (or one or more scaffold proteins) operatively linked to a transcriptional regulatory unit, wherein the scaffold protein comprises:
(1) (a) (i) an amino acid motif or subsequence susceptible to cleavage by a protease under physiologic (cell culture) conditions;
(b) the nucleic acid of (a), wherein the scaffold protein further comprises an endoplasmic reticulum (ER) retention motif or a KDEL (SEQ ID NO:1) motif,
wherein the ER retention motif or KDEL (SEQ ID NO:1) motif is positioned in the scaffold protein such that when a protease or enzyme is active the scaffold will be separated into two pieces, leaving the ER retention motif-comprising or KDEL (SEQ ID NO:1) motif-comprising portion of the polypeptide in the ER and freeing the detectable moiety-comprising portion to the cell's extracellular membrane, and if the protease or enzyme is blocked or inactive, the entire scaffold polypeptide will be retained in the ER, and as a consequence will not be detected on the cell's extracellular surface;
(2) the isolated, recombinant or synthetic nucleic acid of (1), wherein the protease or enzyme is an HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus;
(3) the isolated, recombinant or synthetic nucleic acid of (1) or (2), wherein the scaffold protein comprise all or part of a mouse Lyt2 or a human CD8 polypeptide; or
(4) the isolated, recombinant or synthetic nucleic acid of (1), (2) or (3), wherein the detectable moiety comprises an epitope for an antibody, or a FLAG tag.
In alternative embodiments, the invention provides vectors, expression cassettes, cosmids or plasmids comprising (or having contained therein) the isolated, recombinant or synthetic nucleic acid of the invention.
In alternative embodiments, the invention provides isolated, recombinant or synthetic polypeptides encoded by the nucleic acid of the invention.
In alternative embodiments, the invention provides cells comprising (or having contained therein) an isolated, recombinant or synthetic nucleic acid of the invention, or a vector, expression cassette, cosmid or plasmid of the invention, or a polypeptide of the invention.
In alternative embodiments, the invention provides chimeric polypeptides comprising:
wherein the amino acid motif or subsequence susceptible to cleavage by the protease or enzyme, or HIV-1 protease, is positioned within the scaffold protein such that when the detectable moiety is cleavage away from (off from) the scaffold protein by the protease or enzyme, or HIV-1 protease, the remaining subsequence of scaffold protein on the extracellular surface of the cell lacks the detectable moiety;
(2) the chimeric polypeptide of (1), wherein the scaffold protein further comprises an endoplasmic reticulum (ER) retention motif or a KDEL (SEQ ID NO:1) motif,
wherein the ER retention motif or KDEL (SEQ ID NO:1) motif is positioned in the scaffold protein such that when the protease or enzyme is active the scaffold will be separated into two pieces, leaving the ER retention motif-comprising or KDEL (SEQ ID NO:1) motif-comprising portion of the polypeptide in the ER and freeing the detectable moiety-comprising portion to the cell's extracellular membrane, and if the protease or enzyme is blocked or inactive, the entire scaffold polypeptide will be retained in the ER, and as a consequence will not be detected on the cell's extracellular surface;
(3) the chimeric polypeptide of (1) or (2), wherein the scaffold protein further comprises a p2/p7 recognition site imbedded in the cytoplasmic loop of the scaffold,
where optionally the p2/p7 recognition sequence comprises or consists of ATIMMQRGN (SEQ ID NO:2), or optionally an exemplary amino-acid sequence of p2/p7 comprises AEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEGHTA RNCRAPRKKGCWKCGKEGHQMKDCTERQANATIMMQRGN (SEQ ID NO:5); or
(4) the chimeric polypeptide of (1), (2) or (3), wherein the protease or enzyme is an HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus.
In alternative embodiments, the invention provides chimeric polypeptides comprising:
wherein the amino acid motif or subsequence susceptible to cleavage by the protease or enzyme is positioned within the scaffold protein such that when the detectable moiety is cleavage away from (off from) the scaffold protein by the protease or enzyme the remaining subsequence of scaffold protein on the extracellular surface of the cell lacks the detectable moiety;
wherein the ER retention motif or KDEL (SEQ ID NO:1) motif is positioned in the scaffold protein such that when protease or enzyme is active the scaffold will be separated into two pieces, leaving the ER retention motif-comprising or KDEL (SEQ ID NO:1) motif-comprising portion of the polypeptide in the ER and freeing the detectable moiety-comprising portion to the cell's extracellular membrane, and if the protease or enzyme is blocked or inactive, the entire scaffold polypeptide will be retained in the ER, and as a consequence will not be detected on the cell's extracellular surface or
In alternative embodiments, the invention provides cell-based platforms, multiplexed platforms or systems, or cell-based methods, for monitoring the activity of a protease or enzyme, an HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, comprising:
(1) (a) providing a nucleic acid encoding a scaffold protein (or one or more scaffold proteins) operatively linked to a transcriptional regulatory unit, wherein the scaffold protein comprises:
(b) providing a nucleic acid encoding protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, operatively linked to a transcriptional regulatory unit, or a cell that expresses a heterologous or endogenous protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus;
(c) inserting (transfecting) the nucleic acid of (a) and (b) into the cell if the cell does not already express a heterologous or protease or enzyme, or a HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus;
(d) co-expressing the nucleic acid of (a) and (b) in the cell, or expressing the nucleic acid of (a) in the cell if the cell already expresses a heterologous or endogenous protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus; and
(e) determining whether the scaffold protein comprising the detectable moiety is expressed on the extracellular surface of the cell, optionally determined by a plate reader, flow cytometry or any high-throughput assay),
wherein an intact scaffold protein comprising the detectable moiety is expressed on the extracellular surface of the cell when the protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is not enzymatically active, and an intact scaffold protein is not or is substantially less expressed on the extracellular surface of the cell when the protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is enzymatically active (the detectable moiety is cleaved off by protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus;
(2) the cell-based platform, multiplexed platform or system, or cell-based method of (1), wherein the scaffold protein further comprises an endoplasmic reticulum (ER) retention motif or a KDEL motif,
wherein the ER retention motif or KDEL motif is positioned in the scaffold protein such that when the protease or enzyme, or HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is active the scaffold will be separated into two pieces, leaving the ER retention motif-comprising or KDEL motif-comprising portion of the polypeptide in the ER and freeing the detectable moiety-comprising portion to the cell's extracellular membrane, and if the protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is blocked or inactive, the entire scaffold polypeptide will be retained in the ER, and as a consequence will not be detected on the cell's extracellular surface;
(3) the cell-based platform, multiplexed platform or system, or cell-based method of (1) or (2), wherein the scaffold protein further comprises a p2/p7 recognition site imbedded in the cytoplasmic loop of the scaffold;
(4) the cell-based platform, multiplexed platform or system, or cell-based method of (1), (2) or (3), further comprising screening for an inhibitor of the protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, by:
(5) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (4), further comprising:
(6) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (5), wherein:
(7) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (6), wherein two or more, or a plurality of, enzymes or proteases are screened in the same cell, wherein optionally they are variants of the same enzyme or protease, or different enzymes or proteases, or a combination thereof.
In alternative embodiments, the invention provides cell-based platforms, multiplexed platforms or systems, or cell-based methods, for monitoring the activity of an protease or enzyme, or a HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, comprising:
(1) (a) providing a nucleic acid encoding a scaffold protein (or one or more scaffold proteins) operatively linked to a transcriptional regulatory unit, wherein the scaffold protein comprises:
(b) providing a nucleic acid encoding the protease or enzyme, or a HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, operatively linked to a transcriptional regulatory unit, or a cell that expresses a heterologous or endogenous protease;
(c) inserting (transfecting) the nucleic acid of (a) and (b) into the cell if the cell does not already express a heterologous or endogenous protease;
(d) co-expressing the nucleic acid of (a) and (b) in the cell, or expressing the nucleic acid of (a) in the cell if the cell already expresses a heterologous or endogenous protease or enzyme, or a HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus; and
(e) determining whether the scaffold protein comprising the detectable moiety is expressed on the extracellular surface of the cell, optionally determined by a plate reader, a flow cytometry or any high-throughput assay,
wherein an intact scaffold protein comprising the detectable moiety is expressed on the extracellular surface of the cell when the protease or enzyme, or a HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is not enzymatically active, and an intact scaffold protein is not or is substantially less expressed on the extracellular surface of the cell when the protease or enzyme, or a HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is enzymatically active (the detectable moiety is cleaved off by the protease); or
(2) the cell-based platform, multiplexed platform or system, or cell-based method of (1), wherein the scaffold protein further comprises an endoplasmic reticulum (ER) retention motif or a KDEL motif,
wherein the ER retention motif or KDEL motif is positioned in the scaffold protein such that when the protease or enzyme, or a HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is active the scaffold will be separated into two pieces, leaving the ER retention motif-comprising or KDEL motif-comprising portion of the polypeptide in the ER and freeing the detectable moiety-comprising portion to the cell's extracellular membrane, and if the protease or enzyme, or a HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is blocked or inactive, the entire scaffold polypeptide will be retained in the ER, and as a consequence will not be detected on the cell's extracellular surface;
(3) the cell-based platform, multiplexed platform or system, or cell-based method of (1) or (2), wherein two or more, or a plurality of, enzymes or proteases are screened in the same cell, wherein optionally they are variants of the same enzyme or protease, or different enzymes or proteases, or a combination thereof;
(4) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (3), further comprising screening for an inhibitor of a protease by:
(5) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (4), further comprising:
(6) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (5), wherein
In alternative embodiments, the invention provides cell-based platforms, multiplexed platforms or systems, or cell-based methods, for monitoring the activity of a cell's ER and/or trans-Golgi network comprising:
(1) (a) providing a nucleic acid encoding a scaffold protein operatively linked to a transcriptional regulatory unit, wherein the scaffold protein comprises:
(b) inserting (transfecting) the scaffold protein-encoding nucleic acid of (a) into the cell;
(d) expressing the nucleic acid of (a); and
(e) determining whether the scaffold protein comprising the detectable moiety is expressed on the extracellular surface of the cell, optionally determined by a plate reader, a flow cytometry or any high-throughput assay,
wherein the scaffold protein is expressed on the extracellular surface of the cell when the activity of the cell's ER and trans-Golgi network is functioning;
(2) the cell-based platform, multiplexed platform or system, or cell-based method of (1), wherein the scaffold protein further comprises an endoplasmic reticulum (ER) retention motif or a KDEL motif,
wherein in alternative embodiments the ER retention motif or KDEL motif is positioned in the scaffold protein such that when the enzyme is active the scaffold will be separated into two pieces, leaving the ER retention motif-comprising or KDEL motif-comprising portion of the polypeptide in the ER and freeing the detectable moiety-comprising portion to the cell's extracellular membrane, and if the enzyme is blocked or inactive, the entire scaffold polypeptide will be retained in the ER, and as a consequence will not be detected on the cell's extracellular surface;
(3) the cell-based platform, multiplexed platform or system, or cell-based method of (1) or (2), further comprising screening for an inhibitor of the cell's ER and trans-Golgi network by:
(4) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (3), further comprising:
(5) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (4), wherein
(6) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (5), wherein two or more, or a plurality of, enzymes or proteases are screened in the same cell, wherein optionally they are variants of the same enzyme or protease, or different enzymes or proteases, or a combination thereof.
In alternative embodiments, the invention provides isolated, recombinant or synthetic nucleic acids encoding a scaffold protein (or one or more scaffold proteins) operatively linked to a transcriptional regulatory unit, wherein the scaffold protein comprises:
(1) (a) (i) an amino acid motif or subsequence susceptible to cleavage by a protease or enzyme, or a HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, under physiologic (cell culture) conditions;
(ii) a transmembrane domain;
(iii) a signal sequence or any amino acid motif that places the scaffold protein on the extracellular surface of the cell; and
(iv) a detectable moiety, a luminescent moiety, a Green Fluorescent Protein (GFP) or a luciferase, or any compound that can be directly or indirectly detected; or
(b) the nucleic acid of (a), wherein the scaffold protein further comprises an endoplasmic reticulum (ER) retention motif or a KDEL motif,
wherein in alternative embodiments the ER retention motif or KDEL motif is positioned in the scaffold protein such that when the protease or enzyme, or a HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is active the scaffold will be separated into two pieces, leaving the ER retention motif-comprising or KDEL motif-comprising portion of the polypeptide in the ER and freeing the detectable moiety-comprising portion to the cell's extracellular membrane, and if the protease or enzyme, or a HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is blocked or inactive, the entire scaffold polypeptide will be retained in the ER, and as a consequence will not be detected on the cell's extracellular surface; or
(2) the isolated, recombinant or synthetic nucleic acid of (1), wherein
In alternative embodiments, the invention provides vectors, expression cassettes, cosmids or plasmids comprising the isolated, recombinant or synthetic nucleic acid of the invention.
In alternative embodiments, the invention provides isolated, recombinant or synthetic polypeptides encoded by the nucleic acid of the invention.
In alternative embodiments, the invention provides cells comprising the isolated, recombinant or synthetic nucleic acid of the invention, or polypeptides of the invention, or vectors, expression cassettes, cosmids or plasmids of the invention.
In alternative embodiments, the invention provides chimeric polypeptides comprising:
wherein the amino acid motif or subsequence susceptible to cleavage by the protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is positioned within the scaffold protein such that when the detectable moiety is cleaved away from (off from) the scaffold protein by the protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, the remaining subsequence of scaffold protein on the extracellular surface of the cell lacks the detectable moiety;
(2) the chimeric polypeptide of (1), wherein the scaffold protein further comprises an endoplasmic reticulum (ER) retention motif or a KDEL motif,
wherein in alternative embodiments the ER retention motif or KDEL motif is positioned in the scaffold protein such that when the protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is active the scaffold will be separated into two pieces, leaving the ER retention motif-comprising or KDEL motif-comprising portion of the polypeptide in the ER and freeing the detectable moiety-comprising portion to the cell's extracellular membrane, and if the protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is blocked or inactive, the entire scaffold polypeptide will be retained in the ER, and as a consequence will not be detected on the cell's extracellular surface; or
(3) the chimeric polypeptide of (1), wherein the scaffold protein further comprises a p2/p7 recognition site imbedded in the cytoplasmic loop of the scaffold,
where optionally the p2/p7 recognition sequence comprises or consists of ATIMMQRGN (SEQ ID NO:2), or optionally an exemplary amino-acid sequence of p2/p7 comprises AEAMSQVTNS/ATIMMQRGN/FRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWK CGKEGHQMKDCTERQAN ATIMMQRGN (SEQ ID NO:5).
In alternative embodiments, the invention provides chimeric polypeptides comprising:
wherein the amino acid motif or subsequence susceptible to cleavage by the protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is positioned within the scaffold protein such that when the detectable moiety is cleaved away from (off from) the scaffold protein by the protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, the remaining subsequence of scaffold protein on the extracellular surface of the cell lacks the detectable moiety; or
(2) the chimeric polypeptide of (1), wherein the scaffold protein further comprises an endoplasmic reticulum (ER) retention motif or a KDEL motif,
wherein in alternative embodiments the ER retention motif or KDEL motif is positioned in the scaffold protein such that when the protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is active the scaffold will be separated into two pieces, leaving the ER retention motif-comprising or KDEL motif-comprising portion of the polypeptide in the ER and freeing the detectable moiety-comprising portion to the cell's extracellular membrane, and if the protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, is blocked or inactive, the entire scaffold polypeptide will be retained in the ER, and as a consequence will not be detected on the cell's extracellular surface.
In alternative embodiments, the invention provides cell-based platforms, multiplexed platforms or systems, or cell-based methods, for monitoring the activity of the protease or enzyme, or a HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus, comprising:
(1) (a) providing: a nucleic acid encoding a chimeric (hybrid) protein (or one or more chimeric (hybrid) proteins) operatively linked to a transcriptional regulatory unit, a promoter and/or enhancer, a doxycycline inducible promoter); and, a cell comprising an environment capable of supporting the expression of the chimeric (hybrid) protein by the nucleic acid,
wherein the chimeric (hybrid) protein comprises a chimeric Gal4 expression system comprising (i) an N-terminal Gal4 DNA-binding domain, optionally a DBD: aa 1-147); (ii) an enzyme whose activity is to be monitored, or an enzymatically active fragment thereof; and (iii) a Gal4 C-terminal Transactivation domain, optionally a TAD: aa 768-881),
and the enzyme whose activity is to be monitored or the enzymatically active fragment thereof is positioned in or within the chimeric protein such that an enzymatically active enzyme or enzymatically active fragment thereof is capable of cleaving or physically separating or otherwise functionally separating the N-terminal Gal4 DNA-binding domain from the Gal4 C-terminal Transactivation domain such that the Gal4 can no longer act as a functional transcription factor, and if the enzyme whose activity is to be monitored is inhibited such that it is no longer enzymatically active (or substantially no longer enzymatically active) the Gal4 C-terminal Transactivation domain in conjunction with the N-terminal Gal4 DNA-binding domain can function as a functional transcription factor;
(b) inserting (transfecting) the nucleic acid of (a) into the cell,
wherein optionally the cell does not already express a heterologous or endogenous protease or enzyme, or the HIV-1 protease, or a viral, a microbial or a mammalian protease or enzyme, or a NS2/NS3 or NS3/NS4A protease of HCV, or any Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease, or a West Nile Virus, a Yellow Fever Virus, or any Flaviviridae virus; and
(c) contacting the cell with a putative (test) enzyme inhibitor,
wherein optionally the enzyme inhibitor comprises a small molecule, a protein, a nucleic acid, a polysaccharide and/or a lipid,
and optionally the enzyme inhibitor is added to the cell before, during and/or after inserting (transfecting) the nucleic acid of (a) into the cell and/or expressing the chimeric protein encoded by the nucleic acid of (a) in the cell,
and optionally cell-based method further comprises a negative control set of cells into which the nucleic acid of (a) also has been inserted and transfected and expresses the chimeric protein encoded by the nucleic acid of (a), but the negative control set of cells is not exposed to the putative (test) enzyme inhibitor or is exposed to a different putative (test) enzyme inhibitor;
(d) determining whether the putative (test) enzyme inhibitor is an effective or sufficient inhibitor of the enzyme or enzymatically active fragment thereof by measuring the ability of the Gal4 C-terminal Transactivation domain in conjunction with the N-terminal Gal4 DNA-binding domain to function as a functional transcription factor,
wherein optionally the ability of the Gal4 C-terminal Transactivation domain in conjunction with the N-terminal Gal4 DNA-binding domain to function as a functional transcription factor is measured by expression of a Fluorescent Protein (FP), an e-green fluorescent protein, or eGFP (excited with the 488 nm blue laser, an e-cyan fluorescent protein (or eCFP, using a 405 nm violet laser), and/or an mOrange or an mCherry (561 nm yellow laser), where the FP or GFP coding sequence is operably linked to or dependent (for its transcription) on the transcription factor;
(2) the cell-based platform, multiplexed platform or system, or cell-based method of (1), wherein the enzyme is a protease or an HIV-1 protease, or a NS2/NS3 or NS3/NS4A protease of HCV;
(3) the cell-based platform, multiplexed platform or system, or cell-based method of (1) or (2), wherein the cell is a hepatocyte, or a lymphocyte or a T cell, or a CD4+ T cell, or a mammalian cell or a human cell;
(4) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (3), further comprising:
(5) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (4), wherein:
(6) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (5), wherein two or more, or a plurality of, enzymes or proteases are screened in the same cell, wherein optionally they are variants of the same enzyme or protease, or different enzymes or proteases, or a combination thereof.
In alternative embodiments, the invention provides isolated, recombinant or synthetic nucleic acids encoding a chimeric (hybrid) protein operatively linked to a transcriptional regulatory unit, a promoter and/or enhancer, or a doxycycline inducible promoter),
wherein the chimeric (hybrid) protein comprises a chimeric Gal4 expression system comprising (i) an N-terminal Gal4 DNA-binding domain, optionally a DBD: aa 1-147); (ii) an enzyme whose activity is to be monitored, or an enzymatically active fragment thereof; and (iii) a Gal4 C-terminal Transactivation domain, optionally a TAD: aa 768-881),
and the enzyme whose activity is to be monitored or the enzymatically active fragment thereof is positioned in or within the chimeric protein such that an enzymatically active enzyme or enzymatically active fragment thereof is capable of cleaving or physically separating or otherwise functionally separating the N-terminal Gal4 DNA-binding domain from the Gal4 C-terminal Transactivation domain such that the Gal4 can no longer act as a functional transcription factor, and if the enzyme whose activity is to be monitored is inhibited such that it is no longer enzymatically active (or substantially no longer enzymatically active) the Gal4 C-terminal Transactivation domain in conjunction with the N-terminal Gal4 DNA-binding domain can function as a functional transcription factor,
wherein optionally the ability of the Gal4 C-terminal Transactivation domain in conjunction with the N-terminal Gal4 DNA-binding domain to function as a functional transcription factor is measured by expression of a Fluorescent Protein (FP), an e-green fluorescent protein, or eGFP (excited with the 488 nm blue laser, an e-cyan fluorescent protein (or eCFP, using a 405 nm violet laser), and/or an mOrange or an mCherry (561 nm yellow laser), where the FP or GFP coding sequence is operably linked to or dependent (for its transcription) on the transcription factor.
In alternative embodiments, the invention provides cell comprising an isolated, recombinant or synthetic nucleic acid of the invention, wherein optionally the cell is a hepatocyte, or a lymphocyte or a T cell, or a CD4+ T cell, or a mammalian cell or a human cell.
In alternative embodiments of the chimeric Gal4 expression systems, the invention provides vectors, expression cassettes, cosmids or plasmids comprising or having contained therein the isolated, recombinant or synthetic nucleic acid of the invention. In alternative embodiments, the invention provides cells comprising a vector, expression cassette, cosmid or plasmid of the invention.
In alternative embodiments the invention provides chimeric Gal4 expression systems comprising:
(a) (i) an N-terminal Gal4 DNA-binding domain, optionally a DBD: aa 1-147); (ii) an enzyme whose activity is to be monitored, or an enzymatically active fragment thereof; and (iii) a Gal4 C-terminal Transactivation domain, optionally a TAD: aa 768-881), and the enzyme whose activity is to be monitored or the enzymatically active fragment thereof is positioned in or within the chimeric protein such that an enzymatically active enzyme or enzymatically active fragment thereof is capable of cleaving or physically separating or otherwise functionally separating the N-terminal Gal4 DNA-binding domain from the Gal4 C-terminal Transactivation domain such that the Gal4 can no longer act as a functional transcription factor, and if the enzyme whose activity is to be monitored is inhibited such that it is no longer enzymatically active (or substantially no longer enzymatically active) the Gal4 C-terminal Transactivation domain in conjunction with the N-terminal Gal4 DNA-binding domain can function as a functional transcription factor,
wherein optionally transcription/expression of the chimeric Gal4 expression system is operably linked to a promoter and/or an enhancer, or a doxycycline inducible promoter,
wherein optionally the ability of the Gal4 C-terminal Trans activation domain in conjunction with the N-terminal Gal4 DNA-binding domain to function as a functional transcription factor is measured by expression of a Fluorescent Protein (FP), an e-green fluorescent protein, or eGFP (excited with the 488 nm blue laser, an e-cyan fluorescent protein (or eCFP, using a 405 nm violet laser), and/or an mOrange or an mCherry (561 nm yellow laser), where the FP or GFP coding sequence is operably linked to or dependent (for its transcription) on the transcription factor; or
(b) the chimeric Gal4 expression system of (a), wherein: the enzyme is a protease, or a viral protease, a microbial protease or a mammalian protease; or the enzyme is an HIV-1 protease, or a NS2/NS3 or a NS3/NS4A protease of HCV, or a Hepatitis C Virus (HCV) or Dengue Virus (DenV) protease.
In alternative embodiments of the chimeric Gal4 expression systems, the invention provides cells comprising the chimeric Gal4 expression system of the invention, wherein optionally the cell is a hepatocyte, or a lymphocyte or a T cell, or a CD4+ T cell, or a mammalian cell or a human cell.
In alternative embodiments the invention provides multiplexed systems adapted for multiplexed analysis of a plurality of enzymes (more than one enzyme) inhibitors or modulators, comprising:
(a) a chimeric Gal4 expression system, wherein inhibition of different enzymes is monitored by the expression of a different detectable moiety, a different luminescent moiety, a different Fluorescent Protein (FP), an e-green fluorescent protein, or eGFP (excited with the 488 nm blue laser, an e-cyan fluorescent protein (or eCFP, using a 405 nm violet laser), and/or an mOrange or an mCherry (561 nm yellow laser);
(b) the multiplexed system of (a), wherein the different enzymes or proteases, are expressed in bar-coded cells engineered to have a characteristic genetic background resulting in the expression of specific fluorescent proteins.
In alternative embodiments the invention provides chimeric Gal4 expression systems isolated, recombinant or synthetic nucleic acids encoding a chimeric (hybrid) protein, wherein the chimeric (hybrid) protein comprises (or consists of) from N- to C-terminus:
(a) (i) a signal sequence (motif) for Endoplasmic Reticulum (ER) targeting,
(ii) a tag or detection moiety, or “scaffold”, capable of being recognized on a cell surface,
(iii) at least two transmembrane domains that span the ER membrane, with an extra loop at the ER luminal face,
(iv) an enzyme recognition/cleavage site spanning a segment of a gp120/41 boundary, facing the ER lumen, and
(v) an ER retention sequence or motif;
(b) the chimeric (hybrid) protein of (a), wherein the tag or detection moiety, or “scaffold”, comprises a tag for an antibody or an antigen binding fragment thereof (the antibody binding specifically to the tag or detection moiety, or “scaffold”), or the tag or detection moiety, or “scaffold”, comprises a ligand, or the tag or detection moiety, or “scaffold”, comprises a FLAG molecule or equivalent thereof;
(c) the chimeric (hybrid) protein of (a), wherein enzyme recognition/cleavage site comprises a furin enzyme recognition/cleavage site, a calcium-dependent protein convertase enzyme recognition/cleavage site, prohormone convertase-1 (PC1) enzyme recognition/cleavage site, or an enzyme recognition/cleavage site derived from a member of the subtilisin/kexin family of proprotein convertases;
(d) the chimeric (hybrid) protein of (a), wherein enzyme recognition/cleavage site comprises an enzyme recognition/cleavage site within the V3 loop of gp120;
(e) the chimeric (hybrid) protein of (a), wherein the ER retention sequence or motif comprises a KDEL (SEQ ID NO:1) sequence or equivalent thereof;
(f) the chimeric (hybrid) protein of (a), wherein the gp120/41 is an HIV-1 gp120/41;
(g) the chimeric (hybrid) protein of (a), wherein the at least two transmembrane domains that span the ER membrane consist of two transmembrane domains;
(h) the chimeric (hybrid) protein of (a), wherein the at least two transmembrane (TM) domains that span the ER membrane comprise at least one TM of a CRRS;
(i) the chimeric (hybrid) protein of (h), wherein the at least two transmembrane (TM) domains that span the ER membrane comprise TM1 and TM2 from the CRRS;
(j) the chimeric (hybrid) protein of (a), wherein the gp120/gp41 boundary comprises the recognition/cleavage site REKRA (SEQ ID NO:6);
(k) the chimeric (hybrid) protein of (a), wherein the gp120/gp41 boundary further comprises a restriction enzyme recognition site acids at both sides, or comprises additional amino-acids at both sides comprising AKRRVVQREKR (SEQ ID NO:3) and AVGIGALF (SEQ ID NO:4); or
(l) the isolated, recombinant or synthetic nucleic acid encoding the chimeric (hybrid) protein is operatively linked to a transcriptional regulatory unit, or a promoter such as an inducible or constitutive promoter.
In alternative embodiments the invention provides vectors, recombinant viruses, cloning vehicles, expression cassettes, cosmids or plasmids comprising (or consisting of) or having contained therein an isolated, recombinant or synthetic nucleic acid of the invention, e.g., comprising or used in a chimeric Gal4 expression system.
In alternative embodiments the invention provides chimeric or hybrid polypeptides comprising (or consisting of): (a) the polypeptide encoded by a nucleic acid of the invention, e.g., comprising or used in a chimeric Gal4 expression system; or (b) the chimeric (hybrid) protein of (a), wherein the protein comprises a synthetic protein or peptide, recombinant protein or peptide, a peptidomimetic or a combination thereof.
In alternative embodiments the invention provides chimeric or hybrid proteins comprising (or consisting of) from N- to C-terminus:
(a)) (i) a signal sequence (motif) for Endoplasmic Reticulum (ER) targeting,
(ii) a tag or detection moiety, or “scaffold”, capable of being recognized on a cell surface,
(iii) at least two transmembrane domains that span the ER membrane, with an extra loop at the ER luminal face,
(iv) an enzyme recognition/cleavage site spanning a segment of a gp120/41 boundary, facing the ER lumen, and
(v) an ER retention sequence or motif;
(b) the chimeric (hybrid) protein of (a), wherein the tag or detection moiety, or “scaffold”, comprises a tag for an antibody or an antigen binding fragment thereof (the antibody binding specifically to the tag or detection moiety, or “scaffold”), or the tag or detection moiety, or “scaffold”, comprises a ligand, or the tag or detection moiety comprises a FLAG molecule or equivalent thereof;
(c) the chimeric (hybrid) protein of (a), wherein enzyme recognition/cleavage site comprises a furin enzyme recognition/cleavage site, a calcium-dependent protein convertase enzyme recognition/cleavage site, prohormone convertase-1 (PC1) enzyme recognition/cleavage site, or an enzyme recognition/cleavage site derived from a member of the subtilisin/kexin family of proprotein convertases;
(d) the chimeric (hybrid) protein of (a), wherein enzyme recognition/cleavage site comprises an enzyme recognition/cleavage site within the V3 loop of gp120;
(e) the chimeric (hybrid) protein of (a), wherein the ER retention sequence or motif comprises a KDEL (SEQ ID NO:1) sequence or equivalent thereof;
(f) the chimeric (hybrid) protein of (a), wherein the gp120/41 is an HIV-1 gp120/41;
(g) the chimeric (hybrid) protein of (a), wherein the at least two transmembrane domains that span the ER membrane consist of two transmembrane domains;
(h) the chimeric (hybrid) protein of (a), wherein the at least two transmembrane (TM) domains that span the ER membrane comprise at least one TM of a CRRS;
(i) the chimeric (hybrid) protein of (h), wherein the at least two transmembrane (TM) domains that span the ER membrane comprise TM1 and TM2 from the CRRS;
(j) the chimeric (hybrid) protein of (a), wherein the gp120/gp41 boundary comprises the recognition/cleavage site REKRA (SEQ ID NO:6);
(k) the chimeric (hybrid) protein of (a), wherein the gp120/gp41 boundary further comprises a restriction enzyme recognition site acids at both sides, or comprises additional amino-acids at both sides comprising AKRRVVQREKR (SEQ ID NO:3) and AVGIGALF (SEQ ID NO:4); or
(l) the chimeric (hybrid) protein of (a), wherein the protein comprises (or consists of) a synthetic protein or peptide, recombinant protein or peptide, a peptidomimetic or a combination thereof.
In alternative embodiments the invention provides cells comprising (a) the isolated, recombinant or synthetic nucleic acid of the invention, e.g., comprising a signal sequence (motif) for Endoplasmic Reticulum (ER) targeting, wherein optionally the cell is a mammalian or a human cell, wherein optionally the cell is a hepatocyte, or a lymphocyte or a T cell, or a CD4+ T cell.
In alternative embodiments the invention provides cell-based platforms, multiplexed systems or platforms, or a cell-based methods, for monitoring the activity of an enzyme, or for screening for an inhibitor of the enzyme, comprising:
(1) (a) providing: (i) a nucleic acid encoding the chimeric (hybrid) protein of the invention, e.g., comprising a signal sequence (motif) for Endoplasmic Reticulum (ER) targeting; and, a cell comprising an environment capable of supporting the expression of the chimeric (hybrid) protein by the nucleic acid;
(b) inserting or transfecting or infecting the nucleic acid, vector, recombinant virus, cloning vehicle, expression cassette, cosmid or plasmid of (a) into the cell; and
(c) contacting the cell with a putative (test) enzyme inhibitor,
wherein optionally the enzyme inhibitor is added to the cell before, during and/or after inserting (transfecting) the nucleic acid, vector, recombinant virus, cloning vehicle, expression cassette, cosmid or plasmid of (a) into the cell and/or expressing the chimeric protein encoded by a nucleic acid of (a) in the cell,
and optionally the cell-based method further comprises a negative, positive and/or alternative control set of cells into which the nucleic acid, vector, recombinant virus, cloning vehicle, expression cassette, cosmid or plasmid of (a) also has been inserted (or transfected) and expresses the chimeric protein encoded by a nucleic acid of (a), but the negative control set of cells is not exposed to the putative (test) enzyme inhibitor or is exposed to a different putative (test) enzyme inhibitor, or a different amount of putative (test) enzyme inhibitor, or a positive control wherein the cells are exposed to a known inhibitor of the enzyme; and
(d) determining whether the putative (test) enzyme inhibitor is an effective or sufficient inhibitor or modulator of the enzyme or an enzymatically active fragment thereof by measuring the ability of the putative (test) enzyme inhibitor to partially or completely inhibit cleavage of the enzyme recognition/cleavage site;
(2) the cell-based platform, multiplexed system or platform, or cell-based method of (1), further comprising measuring the ability of the putative (test) enzyme inhibitor to partially or completely inhibit cleavage of the enzyme recognition/cleavage site comprises detecting and/or measuring the amount of tag or detection moiety, or “scaffold”, on the cell surface;
(3) the cell-based platform, multiplexed system or platform, or cell-based method of (1) or (2), wherein the cell is a hepatocyte, a lymphocyte or a T cell, or a CD4+ T cell, or a human cell;
(4) the cell-based platform, multiplexed system or platform, or cell-based method of any of (1) to (3), further comprising running a negative control comprising dividing the plurality of the cells co-expressing a nucleic acid of (a) in the cell and not adding the compound to be screened (the putative (test) enzyme inhibitor) as an inhibitor to one of the divided cell samples;
(5) the cell-based platform, multiplexed system or platform, or cell-based method of any of (1) to (4), further comprising running a positive control comprising dividing the plurality of the cells co-expressing the nucleic acid of (a) in the cell and adding a known inhibitor of the enzyme, or a known inhibitor of a furin enzyme, a calcium-dependent protein convertase enzyme, prohormone convertase-1 (PC1) enzyme, or an enzyme from a member of the subtilisin/kexin family of proprotein convertases, to one of the divided cell samples; or
(6) the cell-based platform, multiplexed system or platform, or cell-based method of any of (1) to (5), wherein:
(6) the cell-based platform, multiplexed platform or system, or cell-based method of any of (1) to (6), wherein two or more, or a plurality of, enzymes or proteases are screened in the same cell, wherein optionally they are variants of the same enzyme or protease, or different enzymes or proteases, or a combination thereof;
The details of one or more embodiments of the invention are set forth in the accompanying drawings and the description below. Other features, objects, and advantages of the invention will be apparent from the description and drawings, and from the claims.
All publications, patents, patent applications, GenBank sequences and ATCC deposits, cited herein are hereby expressly incorporated by reference for all purposes.
Like reference symbols in the various drawings indicate like elements.
The invention provides methods and compositions, including chimeric recombinant proteins, nucleic acids that encode them, and cells and kits comprising them, to screen for compositions, e.g., small molecule drugs, that can modulate, e.g., inhibit or enhance, viral proteases, including retroviral (e.g., HIV) proteases.
In one embodiment, the invention provides cells and cell-based platforms and assays for monitoring the activity of any enzyme, e.g., a viral protease, e.g., HIV-1 protease, which is an aspartyl protease. In alternative embodiments, any viral enzyme, e.g., any enzyme (e.g., protease) of the Flaviviridae or Retroviridae family (e.g. yellow fever virus), or any genotype or serotype of Hepatitis C Virus (HCV) or genotype or serotype of Dengue Virus (DenV) are used to practice this invention.
In one embodiment, these cells and cell-based assays are used to screen for and identify novel enzyme, e.g., viral protease, e.g., inhibitors. In one embodiment, cell-based platforms and assays of the invention effectively couple the surface (extracellular) expression of a protein used as a scaffold (a scaffold protein), with the activity of the protease (e.g. viral protease). In alternative embodiments, polypeptides of the invention comprise HIV p2, p7 or both p2 and p7; p2/p7 of the HIV-1 strain HXB2 (taken as the prototype genome) is part of that virus's viral proteome, and contains one of the natural targets for the recognition and cleavage site of the protease.
In one embodiment, the scaffold is engineered for its conditional expression on the surface of a cell, e.g., a eukaryotic, a yeast or a mammalian cell. In alternative embodiments, the cell or cells are or comprise lymphocytes, e.g., T cells, or hepatocytes or equivalent cells. For that purpose, in one embodiment, the scaffold is fused to a signal sequence to enable efficient and/or directed transport, and a transmembrane domain (e.g., an Lyt2, the murine CD8 molecule, and the like) is used to enable subsequent insertion in the cell membrane. In one embodiment, a tag such as a FLAG tag is added to the scaffold downstream of the signal sequence for detection, e.g., for antibody detection, e.g., through flow cytometry or equivalent visualization.
In one embodiment, the assay co-expresses both the scaffold protein and the enzyme (e.g., protease, e.g., viral protease, e.g., the HIV-1 protease), which if active will bind to and cleave the scaffold at the protease recognition sequence.
In alternative embodiments, both scaffold and protease are co-expressed in a cell, e.g., a lymphocyte such as a T cells, e.g., SupT1 T-cells, or a hepatocyte, in an inducible off/on-based vector system (e.g., activated upon addition of tetracycline or doxycycline). Inducible expression of protease, e.g., a viral protease, can help avoid its possible cytopathic effects. Inducible expression of the scaffold may be necessary as a protease, e.g., a viral protease, will only be able to prevent surface expression of newly synthesized intact scaffold, as a pre-inserted scaffold would not be removed from the cell surface by the protease.
In one embodiment, the logic behind the engineering of the scaffold as a membrane-expressed protein is as follows: in the presence of the active protease, e.g. viral protease, the proteolytic enzyme will cleave the scaffold, resulting in the loss of transmembrane domain, thus preventing tag cell surface expression. In the absence of protease, or when protease is blocked or inhibited, the scaffold will be intact and incorporated into the membrane. As a result, the surface expression of the scaffold can be determined by flow cytometry allowing the discrimination between active and inactive or blocked protease. In one embodiment, the platform or assay is cell-based, and can be easily implemented for a high throughput screen, e.g., FACS. As such, this platform or assay is invaluable for drug discovery, and can be utilized in biological screens aimed at finding novel enzyme or protease inhibitors through random peptide libraries or chemical compounds libraries.
In one embodiment, the invention engineers a protein scaffold bearing the protease cleavage site on the cell surface of a mammalian cell (e.g., a lymphocyte such as a T cell, or a hepatocyte). In one embodiment, the invention expresses, or co-expresses, a protease, e.g., a HIV-1 protease, and a scaffold used as a target, in an inducible manner (the protease, the scaffold, or both can be expressed via an inducible mechanism, e.g., an inducible transcriptional regulator).
In one embodiment, the invention provides assays that can be adapted for a high throughput manner using e.g. flow cytometry such as FACS, and can discriminate between active and non-active or blocked protease. In one embodiment, the invention provides assays that can be easily adapted for high throughput screening. In one embodiment, the invention provides assays of this invention can be used to screen for novel protease inhibitors.
In one embodiment, the invention provides assays of this invention adapted for the screen of random peptide libraries or chemical compounds for drug discovery.
In one embodiment, the methods of the invention use a random peptide library or any peptide of choice, which can be introduced ‘in cis’, replacing the p2/p7 recognition/cleavage site, enabling the discovery of higher affinity sites for PR, which can be the basis for the development of competitor peptidomimetic drugs. In one embodiment, the random peptide library is expressed ‘in trans’, enabling the discovery of competitors/inhibitors for PR, which can be the basis for peptidomimetic drugs.
In one embodiment, the non-biased approach of the invention permits the rescue of peptides or chemicals targeted not necessarily to the catalytic site of PR. Thus, the assays of the invention provide for extensive characterization of PR, facilitating the elucidation of interactions of PR with cellular targets, its mode of action and modulation, in the context of the host cell. Assays of this invention will permit the replacement of PR with PR from different viral strains or clades, or truncated versions of PR, enabling further dissection of PR activity, and study its modulation through co-expression of cellular factors or addition of drugs.
The assays of this invention can be further adapted to proteases of different viruses such as Hepatitis C by just exchanging the recognition/cleavage site segment of the scaffold. The assays of this invention can thus be exploited for the search for protease inhibitors against any of the known viral pathogens that utilize their own protease/s as part of their lifecycles.
The assays of this invention can be adapted for the search of HIV envelope processing inhibitors. One of the HIV proteins, envelope, is processed by furin and other cellular convertases. By just exchanging the recognition/cleavage segment of the scaffold with the envelope recognition site, the assay can be further utilized for the finding of envelope processing inhibitors. This same scaffold is useful for the search of transport inhibitors, as envelope is transported through the ER, trans-Golgi network in order to be inserted within the cell membrane.
In alternative embodiments, the assays of this invention comprise expression of a scaffold naturally expressed in the cytoplasm that is able to be exported into the cell membrane.
In alternative embodiments, assays of this invention comprise expression of both PR and scaffold in an off/on system for inducible expression.
In alternative embodiments, assays of this invention comprise expression of a protein that is expressed on the surface of the mammalian cell (e.g., a lymphocyte such as a T cell, or a hepatocyte) only when not cleaved by a protease, e.g., an HIV protease.
In alternative embodiments, assays of this invention can be adapted for the screen of random peptide libraries or chemical compounds.
In alternative embodiments, assays of this invention can be implemented in mammalian cells (e.g., a lymphocyte such as a T cell, or a hepatocyte) and other cells, e.g., yeast or bacterial cells.
In alternative embodiments, methods provide for the construction of the scaffold and its expression on the cell surface. In alternative embodiments, the p2/p7 scaffold has been engineered as described and effectively expressed on the cell surface. In alternative embodiments, the scaffold has been introduced in a retroviral vector.
In one study, for proof of principle, the expression of an exemplary scaffold correlates with the Green Fluorescent Protein (GFP) expression, as the vector (illustrated in
This construct allows stable expression of the insert and correlation of green fluorescence with expression of the gene of interest (p2/p7 in our case). This vector was used to corroborate the expression of a scaffold of this invention on the cell surface by flow cytometry, as graphically illustrated in
The Expression of Protease in a Non-Toxic Inducible Manner.
In one embodiment, to achieve low levels of protease, e.g., a viral protease, expression in mammalian cells (e.g., a lymphocyte such as a T cell, or a hepatocyte), a tetracycline (Tet) inducible system is used.
As expected, the N-terminal GFP fusion is highly expressed in this case, as illustrated in
In summary,
In order to prove that those cells are actually expressing active PR, cells transfected with the pcDNA control or the N-terminal GFP fusion; GFP-PR were collected for Western blot analysis with anti-PR antibody (NIH Reagents Program). The presence of degradation products of autolysis when no inhibitors are added demonstrates that PR retains its activity, see
This exemplary scaffold of the invention, an adapted scaffold, is based on the same idea, but with an important difference. In one embodiment, when protease (e.g., PR) is active the FLAG or other detectable tag will be present on the surface and detectable e.g., by flow cytometry, whereas when protease (e.g., PR) is blocked or inactive, the FLAG will be lost and not expressed on the cell surface. This scaffold is based on the idea that generally, proteins to be expressed on the surface of the cell have a signal sequence (SS) on their N terminus that targets them to the endoplasmic reticulum (ER) and a transmembrane domain (TM) that retains them in the membrane.
On the other hand, proteins that are retained in the ER, will have, in addition to the SS and the TM, an ER-retention signal such as the prototypic KDEL sequence. This sequence is known to have strong affinity to the KDEL receptor (SEQ ID NO:1), acing the luminal side of the ER. In one embodiment, the ER retention motif or KDEL (SEQ ID NO:1) motif is positioned in the scaffold protein such that when PR is active the scaffold will be separated into two pieces, leaving the ER retention motif-comprising or KDEL (SEQ ID NO:1) motif-comprising portion of the polypeptide in the ER and freeing the detectable moiety-comprising portion to the cell's extracellular membrane, and if PR is blocked or inactive, the entire scaffold polypeptide will be retained in the ER, and as a consequence will not be detected on the cell's extracellular surface
For example, the exemplary CCR5 engineered protein (or partial CCR5 as described here and in the figure) can be replaced by any other protein of choice or hybrid protein. For example, one exemplary embodiment comprises a hybrid protein comprising the N-terminus of the CD8 molecule or the CD8 molecule equivalent in mice (referred to as Lyt2), comprising its natural SS, and the C-terminus of the chemokine receptor CCR5 including only the last TM domain. In this embodiment, only requirement is that the resulting protein will, when cleaved, retain the KDEL-containing side in the ER and the N-terminus on the cell surface.
In alternative embodiments, any protein is used as scaffold (instead of the one exemplary protein described herein), provided that by adding a KDEL sequence at the C terminus the polypeptide will be retained it in the ER, unless separated from the N-terminus.
In this embodiment, a p2/p7 recognition site is imbedded in the cytoplasmic loop of the scaffold, as PR is known to be active in this environment.
In alternative embodiments, the scaffold is engineered for the search of viral PR inhibitors (active in the cytoplasm) and/or for proteases/peptidases active in the lumen of the ER. In one embodiment, the loop facing the luminal face of ER is substituted by a recognition site cleaved by cellular peptidases. This can include the gp120/gp41 boundary, known to be cleaved by peptidases such as furin. These enzymes are known to be active in the inner side of the ER, that is its luminal face, making this exemplary scaffold adaptable for the search of HIV envelope processing and for transport inhibitors.
In alternative embodiments, the invention provides methods and compositions, including chimeric recombinant proteins, nucleic acids that encode them, and cells and kits comprising them, to screen for compositions, e.g., small molecule drugs, that can modulate, e.g., inhibit or enhance, any enzyme, e.g., protease or HIV-1 protease, or NS2/NS3 or NS3/NS4A protease of HCV, or any viral protease, including retroviral (e.g., HIV) proteases, and/or any transport and/or structural protein.
In one embodiment, the invention provides cells and cell-based assays for monitoring the activity of activity an HIV-1 protease, which is an aspartyl protease. In one embodiment, these cells and cell-based assays are used to screen for and identify novel PR inhibitors. In one embodiment, assays of the invention effectively couple the surface (extracellular) expression of a protein used as a scaffold (a scaffold protein), with the activity of the viral PR. p2/p7 of the HIV-1 strain HXB2 (taken as the prototype genome) is part of that virus's viral proteome, and contains one of the natural targets for the recognition and cleavage site of PR.
In one embodiment, the scaffold is engineered for its conditional expression on the surface of a cell, e.g., a yeast or a mammalian cell (e.g., a lymphocyte such as a T cell, or a hepatocyte). For that purpose, in one embodiment, the scaffold is fused to a signal sequence to enable efficient transport, and a transmembrane domain (e.g., an Lyt2, the murine CD8 molecule, and the like) is used to enable subsequent insertion in the cell membrane. A tag such as a FLAG tag is added to the scaffold downstream of the signal sequence for detection, e.g., for antibody detection, e.g., through plate-reader, flow cytometry or equivalent visualization, or any similar or equivalent detection system.
In one embodiment, the assay co-expresses both the scaffold protein and the HIV-1 PR, which, if active, will bind to and cleave the scaffold.
In one aspect, both scaffold and protease are co-expressed in a lymphocyte, e.g., a T cell or T cells, e.g., a SupT1 T-cell, in an inducible off/on-based vector system (e.g., activated upon addition of tetracycline or doxycycline). Inducible expression of PR helps avoid its possible cytopathic effects. Inducible expression of the scaffold is necessary as PR will only be able to prevent surface expression of newly synthesized intact scaffold, as the pre-inserted scaffold would not be removed from the cell surface by PR.
The invention provides kits comprising compositions and instructions for use of the invention. The kits can include: cells comprising nucleic acids encoding the chimeric polypeptides of the invention (the “scaffold proteins”) and/or vectors comprising these nucleic acids, or chimeric polypeptides of the invention, transfecting agents, transducing agents, instructions (regarding the methods of the invention), or any combination thereof. As such, kits, cells, and libraries of compounds are provided herein.
In alternative embodiments, the invention provides cells and cell-based assays and multiplexed systems for monitoring the activity of activity of proteases, e.g., an HIV-1 protease, which is an aspartyl protease. In one embodiment, these cells and cell-based assays are used to screen for and identify novel PR inhibitors (“PIs”). In one embodiment, the invention provides methods and compositions, including chimeric recombinant proteins, nucleic acids that encode them, and cells and kits comprising them, to screen for compositions, e.g., small molecule drugs, that can modulate, e.g., inhibit or enhance, any enzyme, e.g., protease or HIV-1 protease, or NS2/NS3 or NS3/NS4A protease of HCV, or any viral protease, including retroviral (e.g., HIV) proteases.
In one embodiment, the invention provides assays and multiplexed systems in T cells to monitor the proteolytic activity of a protease, e.g., the HIV-1 protease. The assay is based on an inducible Gal4 HIV-1 PR fusion which binds to upstream activation sequences and activates a reporter gene only in the presence of a PR inhibitor (“PI”). The assay was developed through retroviral technology in T-cells to mimic the natural environment of HIV infection.
In one embodiment, the invention provides clones which, when activated, express eGFP as a biosensor of PR activity. This assay of the invention has a robust and reliable readout that relies on green fluorescence, making it ideal for high-throughput screening utilizing flow cytometry. Thus, the assay of the invention will greatly facilitate the search for novel peptide- and chemical-compound-based PIs in T-cells.
In one embodiment, the invention provides a simple, rapid and straightforward method and multiplexed systems for monitoring a protease, e.g., PR, activity to facilitate the search for novel inhibitors/competitors of the protease that could lead to new therapeutics, e.g., to treat HIV (e.g., AIDS).
In one embodiment, assays of the invention are based on the classical Gal4-UAS system, a broadly utilized system for the analysis of gene expression. The yeast Gal4 protein represents a prototypic transcription factor consisting of two separate domains: An N-terminal DNA-binding domain (DBD: aa 1-147) and a C-terminal Transactivation domain (TAD: aa 768-881). The Gal4 protein binds to consensus Upstream Activation Sequences (UAS's) via its DBD and activates transcription of downstream genes through its TAD. However, when the two Gal4 domains are separated, neither half of the protein can independently serve as a functional transcription factor.
Murray (1993) Gene 134(1):123-128, demonstrated the ability for HIV-1 PR fused within Gal4 to auto-catalytically remove itself, leaving behind the two non-functional domains of Gal4. When the PR/Gal4 fusion protein is mutated at the catalytic site, however, or is in the presence of an inhibitor, the fusion protein remains intact, retaining its ability to bind to UAS through the DBD and activate transcription through TAD. In alternative embodiments, this property is incorporated into this invention to express a reporter gene in an inversely proportional manner to PR activity and serve as template for this assay.
In alternative embodiments, assays and multiplexed systems of this invention are based on the expression of the PR/Gal4 fusion as an inducible fusion through a Tet-On system (e.g., in one embodiment, adapted from Clontech, Takara Bio Inc., Shiga, Japan), thus drastically reducing its possible toxic side effects. In this embodiment, the reverse tetracycline transactivator (rtTA) is utilized, allowing for the induction of PR/Gal4 expression only upon addition of tetracycline (Tet) or doxycycline (Dox). The readout; eGFP expression, will appear only when PR/Gal4 expression is induced in the presence of inhibitor. Moreover, all the elements of the assay have been constructed in retroviral vectors for their stable expression in mammalian cells. In alternative embodiments, the assays of the invention are designed for use in lymphocytes such as T cells, or hepatocytes, to facilitate the high-throughput screening for novel inhibitors in a more natural milieu.
In alternative embodiments, assays of the invention are adapted such that the cells carry several enzyme, e.g., protease or HIV-1 protease, or NS2/NS3 or NS3/NS4A protease of HCV, mutant variants, including for example the most prevalent PR mutant shown to be resistant to FDA-approved inhibitors. In alternative embodiments, clones comprising different enzymes (e.g., PRs), when inhibited, activate the transcription of a different fluorescent marker. Accordingly, in alternative embodiments, the assays of the invention are adapted as multiplexed systems.
We have proved the clones of this invention to be very valuable for the screening of inhibitors against the specific PR used in the assay; from the HXB2 consensus T-tropic strain. Due to the high mutational rate it is crucial to adapt the assay to as many protease variants as possible—and the assays and multiplexed systems of the invention are adaptable to multiple protease variants. In alternative embodiments, assays of the invention are adapted to an array of proteases that include the most prevalent protease variants resistant to the existing FDA-approved PIs, In alternative embodiments, these assays are configured as multiplexed systems of the invention.
In alternative embodiments, assays of the invention are adapted to mutations in at least 18 different positions within the 90 amino-acids of PR which have been described to confer drug resistance. In order to adapt the assay for multiplex analysis, we chose the three most prominent variants: L90M, 154V and V82A. For this purpose, in alternative embodiments, L90M, 154V and V82A are introduced between the Gal4 DBD and TA domains. In alternative embodiments, each PR variant when inhibited will activate a different fluorescent protein. While the wild-type variant described in
In alternative embodiments, assays of the invention are adapted to multiplexed formats with various enzyme (e.g., PR) mutants/variants and reporter combinations to simultaneously detect enzyme (e.g., PR) resistance to individual hits. In alternative embodiments, assays of the invention are adapted to Luminescence/plate reader-based formats. In alternative embodiments, assays of the invention are adapted to screening peptide and chemical-compound libraries.
Cell-Based Assays for the Identification of Compositions that Inhibit Envelope Processing
In alternative embodiments, the invention provides cells and cell-based assays to screen for compositions, e.g., small molecules or drugs, that inhibit or modify the activity of enzymes such as calcium-dependent protein convertases such as furin involved in HIV envelope protein processing, including cleavage of the HIV gp160 envelope precursor, resulting in gp120 and gp41 envelope products.
In one embodiment, the invention provides assays to monitor the HIV-1 envelope processing process. This process is based on the cleavage of the gp160 envelope precursor, resulting in gp120 and gp41 envelope products. In one embodiment, the assay of the invention is based on the engineering of a receptor protein scaffold (or detection moiety) construct that will be targeted to the ER and transported to the cell surface only when the protein scaffold was efficiently cleaved by a gp160 envelope precursor processing enzyme such as a calcium-dependent protein convertase, e.g., prohormone convertase-1 (“PC1”), furin and/or similar enzymes (e.g., any member of the subtilisin/kexin family of proprotein convertases), some of which reside in the ER-trans Golgi network.
In one embodiment, this is attained by fusing a KDEL (SEQ ID NO:1) retention signal, known to be recognized and bound by KDEL-receptors in the ER lumen, at the carboxy-terminus (C-terminus) of the scaffold (or detection moiety). An enzyme (e.g., furin, PC1, a member of the subtilisin/kexin family of proprotein convertases, and the like) recognition/cleavage site is introduced between the scaffold and the KDEL (SEQ ID NO:1) sequence. When enzyme (e.g., furin, PC1, etc.) processing is blocked or inhibited, the receptor will move from the ER to the trans-Golgi and recycled back to the ER, due to the presence of the KDEL (SEQ ID NO:1) sequence. In contrast, when the enzyme (e.g., furin, PC1, etc.) is active, it will cleave its recognition site and separate the KDEL (SEQ ID NO:1) sequence from the scaffold protein, which will then be allowed to travel to the surface.
In one embodiment, assays of the invention facilitate the monitoring of enzyme (e.g., furin, PC1, etc.) activity based on the presence or absence of the scaffold (including any detection moiety) on the surface of the cell. In alternative embodiments, fluorescent-coupled antibodies against a tag (e.g., FLAG in our example) can be used to analyze cells by plate-reader, flow cytometry or similar or equivalent detection system.
Assays of the invention can greatly facilitate the discovery of novel gp160 processing inhibitors, including screening for any composition, including a small molecule, protein, carbohydrate and the like that can act as a partial or complete gp160 processing inhibitor.
In one embodiment, assays of the invention are T-cell-based; in this embodiment the assay represents the natural milieu for HIV, e.g., HIV-1, infection.
In one embodiment, flow cytometry allows utilization of assays of this invention in a high-throughput manner. Thus, in alternative embodiments, assays of the invention can be used for the screening of chemical compound (e.g., small molecule) libraries aimed at finding novel inhibitors of gp160 processing. In one embodiment, the nature of the assay as cell-based will discriminate between drugs that target Furin (which would be detrimental to the cell), and those that target the specific cleavage of the 120/41 boundary by Furin (or similar enzymes).
In one embodiment, the CCR5 receptor, a naturally present receptor in macrophages and other cell types, is engineered as a scaffold (e.g., detection moiety) to satisfy the needs of this assay. In this exemplary embodiment, the scaffold will be comprised of two transmembrane domains (TMs) of the CCR5 receptor fused to a FLAG molecule on the N-terminal region. We have chosen TM1 and TM2 from the original seven TMs of CRRS, but any TM could be used instead. The KDEL (SEQ ID NO:1) ER retention signal will be fused to the C-terminus in order to keep the scaffold bound to the ER membrane, at the luminal face.
In one embodiment, the gp120/gp41 boundary, including the recognition/cleavage site REKRA (SEQ ID NO:6) (amino-acids 515-519) and seven additional amino-acids at both sides (AKRRVVQREKR (SEQ ID NO:3) AVGIGALF (SEQ ID NO:4), which represents amino-acids 502-519 of the HXB2 HIV-1 strain), are introduced into this exemplary chimeric protein of the invention.
While the invention is not limited by any particular mechanism of action, if cellular proteases/peptidases, such as Furin or PC1, resident in the ER lumen, cleave the scaffold, the receptor will travel to the cell surface and be recognized with a detection system, e.g., a flow cytometry. If, in contrast, the protein is not cleaved, the scaffold level on the cell surface will be extremely diminished or completely abolished. As a control, a similar scaffold that lacks the cleavage site can be used to ensure expression in the ER but not on the surface. The introduction of the gp120/41 boundary can be performed with the addition of restriction enzyme cleavage sites on both sides of the sequence, allowing for easy replacement of other sequences in alternative embodiments. This will also facilitate the exploration of other consensus sequences found to be recognized by Furin, or similar enzymes, such as the sequence within the V3 loop of gp120.
Though HIV envelope is known to be cleaved in the trans Golgi network, in one embodiment the scaffold is localized to the ER through the KDEL (SEQ ID NO:1) signal because the mechanism KDEL receptor-bound proteins are known to travel to the Golgi and subsequently recycled into to the ER.
While one exemplary embodiment comprises a protein scaffold based on CCR5, CCR5 was chosen only as a proof of concept—in alternative embodiments any protein, mimetic, peptidomimetic or equivalent scaffold can be used.
In alternative embodiments the assays of the invention are adapted to virtually any construct that behaves as described herein, and thus comprises, from N- to C-terminus:
While one exemplary embodiment comprises introduction of only a short sequence of the gp120/gp41 boundary that contains the consensus Furin recognition/cleavage site (ten amino-acids in length), in alternative embodiments additional recognition sites of different lengths could be introduced instead. In alternative embodiments assays of the invention use two known consensus sequences of the HXB2 HIV strains gp120.gp41 boundary sites: AKRRVVQREKRAVGIGALF (SEQ ID NO:14) (recognition/cleavage site in bold). Other strains are used as well.
The different scaffolds used in various embodiments of this invention can further our understanding of protein transport through the ER to the cell surface.
In alternative embodiments the cell-based assays are used in T-cells through retroviral technology. T-cells are a cell type readily infected by HIV, thus providing an art-accepted model that mimics natural infection. In alternative embodiments, the assay is used in lymphocytes, e.g., T-cells—a cell type readily infected by HIV through retroviral technology.
In alternative embodiments these cell-based assays facilitate the discovery of novel drugs aimed at HIV-1-envelope processing rather than the host protease, thus avoiding toxic side-effects, e.g., avoiding cytotoxic side-effects.
In alternative embodiments, assays of the invention monitor HIV-1 envelope processing based on the cleavage of the gp160 envelope protein precursor, resulting in gp120 and gp41 products using a scaffold protein that will not be retained on the cell-surface when processing is blocked or inhibited. In alternative embodiments, the processing, or inhibition of processing, is detected by flow cytometry allowing the observer to discriminate between active and inactive envelope processing.
The invention will be further described with reference to the following examples; however, it is to be understood that the invention is not limited to such examples.
The invention provides compositions and assays for screening for protease inhibitors, e.g., viral protease inhibitors such as HIV-1 protease (an aspartyl protease) inhibitors. PR is required for the efficient processing of the Gag and Gag-Pol precursor polyproteins; a critical step in the viral life cycle. In alternative embodiments, the invention provides compositions and assays for: (1) Discerning the effects of protease, e.g., PR, on signaling cascades of the host cell, and (2) Developing novel cell-based assays to enable screening of peptide libraries for the search of novel protease, e.g., PR, inhibitors. In alternative embodiments, a protease, e.g., PR, is expressed as a fusion protein in the presence of limiting levels of inhibitors, in different cellular compartments and in an inducible manner.
Conclusions
In alternative embodiments, the invention provides compositions and assays to measure the activity of proteases, e.g., viral proteases, such as HIV-1 PR, a difficult protein to study due to its instability and possible cytotoxic effects. In alternative embodiments the invention expresses PR in a stable manner for a cell based assay aimed at finding peptides that inhibit PR, as well as discerning its effect on signaling cascades. In alternative embodiments, GFP fusion proteins were constructed. These products allow determination of the sub-cellular localization of HIV-1 PR. Moreover; we have also shown that PR can be targeted to different organelles. This is important as it will enable decreasing its toxicity, without affecting the catalytic activity of PR.
In alternative embodiments, the invention elucidates the effects of PR on target cells. In alternative embodiments the invention PR is expressed in a Tet-inducible manner to help in elucidating the signaling cascades influenced by PR, as turning on/off the expression of PR can avoid cytotoxic effects and thus become the perfect model for studying signaling.
In alternative embodiments the invention provides assays for determining PR activity because PR is one of the main targets for antiviral therapy. In alternative embodiments PR is expressed to find novel PR inhibitors.
We have shown that a scaffold bearing a PR recognition site can be efficiently expressed on the surface of mammalian cells (e.g., a lymphocyte such as a T cell, or a hepatocyte), enabling its detection by flow cytometry. We have also expressed a GFP scaffold with an internal PR cleavage site. In alternative embodiments, the scaffolds of the invention are used in high throughput screening for finding novel peptide inhibitors against any enzyme, e.g., a protease (PR) such as a viral protease.
In alternative embodiments the invention provides compositions, cell-based platforms, assays and multiplexed systems for screening for any enzyme, e.g., a protease, e.g., HIV-1 protease (an aspartyl protease), inhibitors. For example, HIV protease is required for the efficient processing of the Gag and Gag-Pol precursor polyproteins; a critical step in the viral life cycle.
Exemplary Assay overview: In order to establish a reliable and reproducible cell-based platform or assay for monitoring the activity of any enzyme, e.g., a protease, e.g., a viral such as HIV-1 PR, specifically designed to maximize throughput capabilities, it was important to address several issues.
First, we aimed at establishing the assay or platform of the invention as a cell-based assay, and in a cell type that would mimic the natural environment of a protease, e.g., a viral protease; for example, in HIV-1 infection using T-cells; or for Hepatitis C Virus (HCV) and Dengue Virus (DenV) infection using hepatocytes. Secondly, because of the possible toxic side effects of protease the assay needed to be designed in an off/on system for the inducible expression of protease. Finally, in order for the assay or cell-based platform to provide significant benefits, it needed to include a straight-forward readout such as eGFP (Green Fluorescent protein) expression. This would allow for the analysis by flow cytometry, with no necessary staining and make the assay easily adaptable to high-throughput screening. An overview of this exemplary assay of the invention is described in
In one embodiment the exemplary assay or cell-based platform relies on the presence or lack of eGFP expression that serves as biosensor for protease activity. The assay is designed so that cells expressing blocked or inactive protease can be easily discriminated from those expressing active protease based on eGFP expression. In one embodiment a plate-reader is used, e.g., through general luminescence such as luciferase-based drug screening, in the assay or cell-based platform of the invention.
Confirmation of a reporter/activator (Gal4/UAS) system in mammalian cells: Before the establishment of a stable cell line expressing all of the elements of the assay, it was crucial to first verify that the elements of the assay respond transiently as expected. Preliminary experiments were performed in adherent HEK 293T cells. First, we tested a reporter vector containing a 5XUAS Gal4 responsive element upstream of a minimal CMV promoter followed by the eGFP reporter gene. When 293T cells were transfected with this vector alone, there was little to no background. This lack of background expression from the reporter gene was vital to the success of developing a reliable assay. To investigate the level of Gal4-dependent eGFP expression, we first co-transfected the reporter vector with pcDNA3.1-Gal4, a construct based on the pcDNA3.1 vector for mammalian expression (see Figures). The Gal4 gene utilized here encodes only for the DBD and TAD segment of Gal4. While other variants of Gal4 (such as Gal4VP16) are capable of significantly higher induction of genes under UAS control, minimal Gal4 allows for simple insertion of a proteolytic enzyme within the two distinct domains whose behavior has been well characterized. As expected, co-transfection of the reporter vector with pcDNA-Gal4 led to a dramatic induction of eGFP expression in 293T cells (see Figures).
Insertion of the HIV-1 PR sequence between the Gal4 domains does not substantially disrupt Gal4 activity in mammalian cells: Next, we corroborated that the insertion of a PR sequence within the Gal4 DBD and TAD domains maintains Gal4's ability to serve as a functional transcription factor. To test this, we first introduced a mutated version of PR reported to be inactive. This fusion was designed to ensure that the insertion ‘per se’ of the specific PR sequence does not jeopardize the ability of Gal4 to act as a transcription factor. For this purpose, the HXB2 HIV-1 sequence of the PR mutant version D25A including the 22 upstream amino-acids and the 32 downstream amino-acids of PR (to include the PR cleavage sites) was introduced in between the Gal4 DBD and TAD within a pcDNA3.1 vector (Figure). PR D25A has previously been shown to lack catalytic activity, and, as such, should not be able to separate the domains, nor disrupt the ability of DBD and TAD to work in conjunction and activate the reporter eGFP expression. As expected, reporter and pcDNA-PRm/Gal4 co-transfection resulted in significant eGFP expression (see Figures). Although the induction of eGFP expression by the PRm/Gal4 fusion was less than that of Gal4 alone, the level of activation was sufficient for a clear and reliable readout.
Wildtype PR fused between the Gal4 DBD and TAD results in a transcription factor with abolished activity: We next substituted the PRm sequence with the wild-type sequence. This sequence contained the exact same additional 22-upstream and 32-downstream amino-acids from PR, but retained the wild-type aspartic acid residue at position 25. Co-transfection of the reporter vector with wild-type PR between the Gal4 domains led to a significant reduction in reporter eGFP expression compared to the mutant fusion or Gal4 alone.
Wildtype PR fused within the Gal4 DBD and TAD has restored transcriptional activation in the presence of a PR inhibitor. It was of critical importance to verify the ability for the PR/Gal4 fusion to activate the reporter eGFP by the addition of PR inhibitors. For that purpose, 293T cells were pre-treated with 10 μM Indinavir and then co-transfected with reporter and pcDNA-PR/Gal4 vectors. While control cells or cells incubated with 10 μM DMSO lacked eGFP expression, cells incubated with 10 uM Indinavir showed a drastic induction in HEK293T cells. As expected, the activity of PR/Gal4 was restored in the presence of inhibitor, as seen by the UAS-dependent transcription of the inhibited fusion protein (see Figures).
Design of lentiviral constructs and infection of T-cells with the assay elements. We next addressed the question whether these results could be reproduced in T-cells, a cell-type that represents a more natural milieu for HIV-1 infection. For that purpose, we have utilized retroviral technology to stably express the elements of the assay in mammalian cells. Reporter element and Gal4 or PR/Gal4 fusions were transferred into lentiviral vectors. First, the reporter sequence was inserted into an HIV-based self-inactivating lentiviral vector with a modified U3 sequence was utilized to ensure that no reporter background activity was observed in the absence of an inhibitor. Secondly, we wished to create inducible expression of PR/Gal4 fusions. This would alleviate our concern for the difficulty in creating a stable cell line expressing PR due to the reported possible cytotoxicity of active PR in mammalian cells.
To obtain an inducible cell line, we utilized the tetracycline inducible system (Tet-On). For this purpose we constructed two lentiviral vectors; one harboring a 7× Tetracycline Response Element (TRE) upstream the gene of interest and another expressing the reverse tet-transactivator (rtTA) coupled to an IRES-mCherry cassette to corroborate rtTA expression. In this system, the TRE element is bound and activated by rtTA only in the presence of an inducer (Tet or Dox). Gal4, PR/Gal4 and PRm/Gal4 were all transferred into the TRE inducible vector (see Figures).
The UAS Reporter and PR(m)/Gal4 fusions behave similarly in SupT1 cells as HEK293T cells. We first confirmed whether the results obtained in the transient experiments in 293T cells with reporter and PR/Gal4 vectors could be reproduced with the lentiviral reporter and inducible Gal4 fusion proteins in T-cells. We have chosen SupT1 cells, a T-cell line easily infected by HIV-1 and broadly utilized in HIV-1 studies. Viral particles were produced as described in Methods. When SupT1 cells were infected with lentiviral particles containing the reporter vector alone, no detectable eGFP expression was observed, and similar results were obtained with virus encoding inducible Gal4 alone (see Figures). Importantly however, when cells were co-infected with virus produced from the reporter (pH-5xUAS-eGFP), rtTA (pBMN-rtTA-i-mCherry) and inducible Gal4 (pH-TRE-PRm/Gal4) encoding vectors, eGFP expression was still undetectable. However, when these cells were treated with 1 μg/mL Dox, eGFP expression was clearly induced. This confirmed the feasibility of engineering a Tet-off/on inducible system in T-cells to control PR expression.
SupT1 cells were transduced with viral particles generated from the reporter, rtTA and inducible PRm/Gal4 (pH-TRE-PRm/Gal4) which resulted in similar induction of eGFP as Gal4 alone, and again only in the presence of Dox (1 ug/ml). Finally, cells were infected with virus encoding the reporter, rtTA and inducible wild-type PR/Gal4 (pH-TRE-PR/Gal4) to test the ability for this system in T-cells to indicate the levels of PR activity. In the presence of 1 μg/mL Dox, eGFP levels were nearly undetectable. However, in the presence of both 1 μg/mL Dox and 10 μM Indinavir, a large induction of eGFP expression was observed. This validated the ability to utilize eGFP expression as a biosensor of an active PI in SupT1 cells.
Generation and selection of monoclonal stable cell lines with the highest responsiveness in the assay. The experiments performed with lentiviral particles were analyzed from non-clonal cell populations and corroborated that the assay functions as expected. Nevertheless, our goal was to design an assay in T-cells that also had a definitive and robust readout. Therefore, it was important to purify and amplify specific clones from this population that possessed the lowest degree of background and highest degree of eGFP expression in response to the appropriate treatment.
Cells harboring rtTA, 5xUAS-eGFP and either Gal4 or PRm/Gal4 were activated with 1 μg/mL of Dox. Cells harboring rtTA, 5xUASeGFP and PR/Gal4 were activated with the same concentration of Dox, however were pre-incubated with 10 μM Indinavir. All cells were then sorted 24 hours later based on eGFP expression to enrich cells with an activatable reporter and an inducible transcription factor. One more round of sorting was performed under identical conditions. Finally, another round of sorting was performed seven days later to isolate cells with no eGFP expression (i.e. cells with little to no background). This resulted in a cell population that was up to 80% positive for eGFP after activation and with nearly zero background.
Finally, individual cells from these sorted populations were sorted into a 96 well plate based on the lack of eGFP expression. Clonal cell lines obtained from this experiment were later activated under the same conditions described above, and screened for the individual clones which responded as desired (minimal background and maximal eGFP activation). A clone for each of the inducible elements (Gal4, PRm/Gal4 and PR/Gal4) was obtained. The selected clones exhibited nearly 100% activation ability with nearly zero background. These clones were then expanded and further tested in the following experiments.
Doxycycline activation titration of the clones: In order to optimize the assay for maximal Gal4, PR/Gal4 or PRm/Gal4 induction, we analyzed the effect of increasing levels of Dox. Cells with 0, 50, 100, 250, 500, 750, 1,000, and 2,000 ng/mL Dox were either treated with 10 uM DMSO or 10 uM Indinavir and analyzed 32 hours later. TRE-Gal4 cells reached saturation with Doxycycline at about 1,000 ng/mL whether Indinavir was present or not. TRE-PRm/Gal4 was surprisingly induced at lower levels, reaching saturation at around 250 ng/mL in both uninhibited and Indinavir-treated cells. Again, as with transiently transfected 293 cells, TRE-PR/Gal4 cells had little to non-detectable eGFP expression at any given Dox concentration in the absence of 10 μM Indinavir. However, pre-incubation with 10 μM Indinavir showed maximal eGFP induction at around 500 ng/mL Dox (see Figures).
Determination of optimal time point for the analysis of inhibitor effect: To determine the optimal time point for the analysis of eGFP expression in the presence of inhibitor, cells were activated with Dox and analyzed by flow cytometry 4, 8, 12, 16, 20, 25, 50, or 75 hours later. Six-well plates containing 250K cells per well in 3 mL media were treated either with DMSO alone as control, or 1 μg/mL Dox and 10 μM Indinavir. DMSO-treated cells maintained lack of fluorescence throughout the experiment (Figure). However, Dox-activated cells incubated with Indinavir showed an initial induction of eGFP expression at 8 hours reaching nearly 100% by 50 hours (h).
Assay response to various PR inhibitors: Finally, in order to address the sensitivity of the assay to other PR inhibitors, we have analyzed the effect of known FDA-approved inhibitors. For that purpose, cells were incubated with DMSO alone, as described above, or with increasing concentrations of Atazanavir, Amprenavir, Darunavir, Indinavir, Nelfinavir, Lopinavir, Ritonavir, Saquinavir and Tipranavir, all PR inhibitors, at a range including the most commonly used concentrations in cell culture, but also including low ranges not typically active in less sensitive assays. The range chosen extended from 1 nM to 20 μM.
Darunavir and Atazanavir had the strongest effect on PR inhibition, resulting in eGFP activation at only 1 nM. Indinavir and Tipranavir showed the lowest levels of reporter activation at low concentrations, although were also observed to induce nearly full activation at 5 μM. Interestingly, most of the tested PR inhibitors led to increasing eGFP expression levels at increasing concentration of inhibitor throughout the curve, up to 20 μM, the maximal level tested, however, Lopinavir and Nelfinavir resulted in significant cell death around 1 uM concentration, with significant decline in the number of eGFP positive cells as was the case for Saquinavir at 20 μM. Overall, every inhibitor tested showed significant inhibitory effect that resulted in the complete activation of eGFP expression in the reporter T-cell clones.
This exemplary assay of the invention is designed to allow for the simple screening of novel inhibitory compound or peptide candidates in a simple flow cytometry-based platform. As such, it will allow investigators to perform screening of millions of candidates (through rational or non-rational-based approaches) in a single experiment, enhancing high throughput capacity. The assay described here is intended to greatly facilitate screening for the search of novel PR inhibitors in T-cells, one of the main natural targets of HIV infection. Importantly, we have established an assay whose elements can be easily transferred to other relevant cell types for the establishment of HIV infection and the search for novel PR inhibitors. These include cells such as macrophages or dendritic cells.
The mean fluorescence intensity of eGFP in activated cells steadily increased as inhibited cells continued to accumulate higher levels of eGFP, making those cells with an inhibited PR even more identifiable than those negative for PR inhibition.
In some aspects, analysis of a time point for the effect of an inhibitor may be critical. Thus, choosing a time-point that is average for all is only an estimation for the search of unknown inhibitors.
Cloning and Vector Construction: Gal4, PR/Gal4 and PRm/Gal4 sequences were amplified by PCR for the production of the transient expression vectors pcDNA-Gal4, pcDNA-PR/Gal4 and pcDNA-PRm/Gal4 respectively. For that purpose the constructs pMA236, pHP236 and pHP236m (Murray et al., 1993) were used as template together with the Gal4 forward primer with extending HindI11 and NotI sites ACGCACGCAAGCTTGCGGCCGCCCACCATGAAGCTACTGTCTTCTATC (SEQ ID NO:6) and the Gal4 reverse primer with extending Sall site ATAGCTGCGTGCGTGCGTGTCGACTTACTCTTTTTTTGGGTTTGG (SEQ ID NO:7).
PCR products were then digested with HindIII and SalI and ligated into pcDNA™3.1/Zeo (Invitrogen, Carlsbad Calif.). pFR-eGFP was kindly provided by Rainer de Martin (University of Vienna). In short, pFR-eGFP was created by adapting the pFR-Luc vector (Stratagene, San Diego, Calif.). The firefly luciferase gene was removed and replaced with eGFP.
For the construction of the inducible pH-TRE, pH-TRE-eGFP pH-TRE-Gal4, pH-TRE-PR/Gal4, pH-TRE-PRm/Gal4 vectors, a 7× tet-responsive element (TRE) was amplified from the pTRE-tight (Clontech) with the forward primer with extending NruI site AGCTAGCTAGCTTCGCGACACGAGGCCCTTTCGTCTTCA (SEQ ID NO:8) and a reverse primer to complementary to the PolyA signal with an extending BsrGI site CATTTTTTTCACTGCCTCGAGTGTACAAGCTAGCTAGCT (SEQ ID NO:9).
The PCR product was digested with NruI/BsrGI and cloned into the pH-CMV-eGFP vector, (generously provided by Gary Nolan, Stanford University, CA) to replace the original CMV-eGFP cassette. eGFP was then amplified with a forward primer containing an extending BamHI site, and a reverse primer with an extending NheI site. The eGFP insert was then cut and ligated within the multiple cloning site of pH-TRE. The forward Gal4 primer with an extending BamHI site ATGCATGCGGATCCACCATGAAGCTACTGTCTTCTATC (SEQ ID NO:10). and the reverse primer with an extending NheI site GCATGCATGCTAGCTTACTCTTTTTTTGGGTTTGG (SEQ ID NO:11). were used to amplify the Gal4-based cassettes from pcDNA3.1-Gal4, pcDNA3.1-PR/Gal4, and pcDNA3.1-PRm/Gal4 and insert them into pH-TRE digested with BamHI/NheI.
pBMN-i-mCherry was constructed by amplifying mCherry from pmCherry-C1 (Clontech) with the forward primer with extending NcoI site ATCGATGGATCCCCACCATGGTGAGCAAGGGCGAGGAG (SEQ ID NO:12). and reverse primer with extending XhoI site: ATGGACGAGCTGTACAAGTAACTCGAGGATCGATC (SEQ ID NO:13), and inserting it into partially digested pBMN-i-eGFP (Gary Nolan, Stanford University) with NcoI/SalI. pBMN-i-mCherry-rtTA was then constructed by removing rtTA from the vector Tet-On® (Clontech) with EcoRI/BamHI and cloning it into pBluescript-SK (Invitrogen, Carlsbad Calif.). It was then removed with EcoRI/XhoI and ligated into pBMN-i-mCherry.
pH-5XUAS-eGFP was constructed by digesting pFR-eGFP with MfeI/BsrGI and ligating the 5XUAS-eGFP insert into pH-CMV-eGFP digested with MfeI/BsrGI to replace the CMV-eGFP cassette.
Transfections: 293T cells were transfected as follows. 15 μl of 2 mg/mL Polyethylenimine linear 25 kD (Polysciences, Inc.) were added to 125 μl of DMEM in a 1.8 ml Eppendorf tube. 3 μg of each DNA was added drop-wise to each tube. Tubes were mixed and incubated for 20 min at RT. This mixture was then added drop-wise to 293T cells in a 10 cm plate at approximately 60-75% confluence. Cells were then analyzed by fluorescence microscopy and/or flow cytometry 24 hrs post transfection.
Production of Viral Particles for Retroviral Transduction: For the production of MLV based virus (pBMN-i-mCherry-rtTA virus), Phoenix GP cells (Nolan Lab, Stanford University, CA) at 50-60% confluence were transfected with 3 ug of the packaging vector (pBMN-i-mCherry-rtTA) and 3 μg of pCI-VSVg envelope vector. Media was changed after 24 hours leaving 6 mL of media (DMEM with 10% FCS, Pen-Strep, L-Glutamine) in a 10 cm plate. At 48 hours, viral supernatant was collected, filtered with 0.45 micron PTFE filters (Pall Corporation) and frozen at −80° C. in 1 mL aliquots and frozen at −80° C.
For the production of HIV based virus (pH vectors), 293T cells at 50-60% confluency were transfected with 3 μg packaging vector (pH vectors), 2 ug pCI-VSVg, 1 μg VPR encoding vector, and 3 μg pCMVΔ8.2 (Didier Trono, EPFL, Switzerland). Media was changed at 24 hours leaving 6 mL fresh media (DMEM with 10% FCS, Pen-Strep, L-glutamine). Supernatant was collected at 48 hrs, filtered and collected as described above.
Infections: A 2 ml reaction containing 4 μl of 5 μg/mL Polybrene (Hexadimethrene Bromide, Sigma), 500K SupT1 cells in RPMI (10% FCS, L-glutamine, Pen-strep) and 250 μl frozen viral stocks was mixed, added to wells in 6-well plates, and spun in a hanging bucket rotors Becton Dickinson centrifuge at 1500 RPM, for 120′ at 32° C. Cells were re-suspended and placed in a 37° C. incubator for the analysis of expression at least 72 hours post-infection.
Fluorescence Microscopy for Analysis of Expression: Cells were analyzed by fluorescence microscopy on a Zeiss Observer D1 microscope with a 50× lens and 40HMC filter connected to an AXIOCAM MRm™ camera, and analyzed on AXIO-VISION™ software. The length of exposure for fluorescent channels was based on the exposure for the Gal4 only controls. This length was then kept constant for the exposures of all of the other samples.
Flow Cytometry and Sorting: Flow Cytometry was performed on a BD FACSAria™ with 488 nm and 633 nm lasers. Data was collected on FACSDiva 6.1.1™ software and then exported to FlowJo™. eGFP expression was detected in the FITC channel and mCherry expression was detected on the PE-Texas-Red channel. Cells were first gated for size and granularity (FSC-A vs SSC-A) followed by doublet gating (FSC-A vs FSC-W and SSC-A vs. SSC-W). Sorted populations were gated on PE-TexasRed vs FITC plot. 250K cells were collected for each sample into 0.5 mL fetal calf serum (FCS) and 1 mL RPMI. Cells were then spun down at 1500 RPM and resuspended in fresh media in 6-well plates. Cells were allowed to grow for at least seven days to allow for expansion and loss of previously activated eGFP expression.
In alternative embodiments, the invention provides compositions and assays to screen for enzyme and protease inhibitors, including viral protease inhibitors such as an HIV protease, e.g., HIV-1 protease (PR), that can be used e.g., as anti-viral or anti-retroviral therapy against e.g., HIV-1, or AIDS, which remains a devastating disease. The invention provides assays for identifying novel drugs and targets in the fight against HIV and other diseases. The invention provides assays for identifying novel drugs not having the side-effects of existing drugs. The invention provides assays for identifying novel drugs effective against strains resistant to known drugs, e.g., because of the high rate of HIV mutation.
In alternative embodiments, the invention provides protease assays, e.g., HIV Protease assays, for the detection of novel protease inhibitors (PI's), e.g., HIV protease inhibitors, in vivo, or in a cell such as a mammalian cell, a T cell, a bacteria or a yeast, or in vitro. In alternative embodiments, the invention's assays screen for PI's within T-cells, thus allowing a search for inhibitory compounds within a realistic cellular environment and producing more reliable hits. Additionally, in this embodiment the screening can concurrently reveal the toxicity level of drug candidates on T-cells, ruling out lethal hits.
We have engineered a clonal T-cell line with a Doxycycline inducible PR-Gal4 fusion and a Green Fluorescent Protein (GFP), or eGFP, reporter of its activity. Thus, in this exemplary assay of the invention, eGFP acts as a biosensor of PR activity, making it ideal for flow cytometry-based screening. Clones with the highest sensitivity, and robust, reliable and reproducible reporter activity were tested for their ability to detect the presence of a potent PI. The selected clones exhibit eGFP expression in nearly 100% of the population with the addition of every FDA-approved inhibitor tested, with sensitivities ranging down to nanomolar concentrations. This exemplary assay/platform of the invention is a High Throughput Screening assay for PIs that can be performed in T-cells and other mammalian cells, and can facilitate the search for novel peptide- and chemical-compound-based PIs.
Transient Assay in Mammalian Cells:
Stable T Cell Clones:
Optimization of PI Screening Conditions:
Assay Response to FDA-Approved PIs:
In alternative embodiments, the assay screens ER/Golgi-localized random peptide libraries for anti-virals and/or inhibitors of furins or similar assays.
Exemplary assays of the invention are constructed in T-cells to facilitate the identification of novel drugs targeting viral envelope processing. Assays of the invention represent a novel way to monitor processing by ER-trans-Golgi resident peptidases. As such, assays of the invention enable both the search for novel inhibitors, and further help elucidate mechanisms of protein cellular membrane transport. In alternative embodiments, assays of the invention are used to screen random peptide libraries and/or small molecule libraries for the discovery of possible novel inhibitors that will target gp160 processing rather than Furin activity.
In alternative embodiments, the invention provides multiplexed systems and platforms to screen for enzyme, e.g., protease, inhibitors, including viral protease inhibitors such as an HIV protease, e.g., HIV-1 protease (PR), that can be used e.g., as anti-viral or anti-retroviral therapy against e.g., HIV-1, or AIDS. The invention provides multiplexed systems and platforms identifying novel drugs and targets in the fight against HIV and other diseases. The invention provides multiplexed systems and platforms for identifying novel drugs not having the side-effects of existing drugs. The invention provides multiplexed systems and platforms for identifying novel drugs effective against strains resistant to known drugs, e.g., because of the high rate of HIV mutation.
This example describes an exemplary cell-based multiplex assay of the invention for the discovery of Flaviviridae protease inhibitors. We established a cell-based assay to monitor the catalytic activity of HIV-1 protease in T-cells. Here, we are adapting an exemplary cell-based assay of the invention as an assay for proteases of the Flaviviridae family of viruses, e.g., including Hepatitis C Virus (HCV), Dengue Virus (DenV), West Nile Virus (WNV), and Yellow Fever Virus (YFV), which cause liver cancer, Dengue fever and other syndromes, meningitis/encephalitis, and hemorrhagic fever, respectively.
Flaviviridae rely on the processing of their proteome. Our assay is based on the inducible expression of the viral Protease/s as a Gal4-DNA-binding-Domain/-Transactivation-Domain fusion, and the activation of the reporter Green Fluorescence Protein (GFP). As active Protease cleaves itself from the Gal4 fusion, GFP induction occurs only when Protease is inhibited, thus acting as a biosensor for Protease activity. The assay has been adapted to hepatocytes, mimicking the natural milieu of HCV infection. Human hepatocytes or monkey Vero cells are used as tissue-culture models for DenV, WNV and YFV infection.
In one embodiment, we engineered a set of genetically bar-coded cell lines inducible by the reverse tetracycline transactivator system, and carrying GFP under the Gal4 promoter. We engineered Gal4/NS3/NS4A for HCV and Gal4/NS2B/NS3 for DenV, WNV, and YFV; each expressed in a distinct bar-coded cell-line. A mixed population thus includes different fluorescent background, but results in GFP expression only when induced and inhibited. An exemplary multiplexed cell-based platform of the invention enables us to monitor the inhibition of each distinct protease independently in the same sample, drastically enhancing high-throughput capabilities for drug discovery.
In one embodiment, we adapted a cell-based assay previously developed for HIV-1 protease to the Flaviviridae family of viruses, including HCV, DenV, WNV and YFV, to an exemplary cell-based multiplex assay. This exemplary cell-based multiplex assay is thus adapted to hepatocytes, a model that serves many of the Flaviviridae (although the cell-based multiplex assays of the invention are not limited to any particular cell type). We engineered a set of genetically bar-coded cells, each expressing a different fluorescent protein. The analysis of GFP expression serves as biosensor for protease of multiple viral proteases in the same sample. Multiplexing genetically bar-coded cells streamlines the high throughput capabilities of the assay, rendering it a powerful platform for drug discovery which will facilitate the screening and identification of novel drugs targeting these viral proteases. Moreover, this cell-based multiplex assay of the invention facilitates the study of the proteases and their dependence on co-factors.
Assays for HIV-1 were done as described e.g., in Hilton B J, Wolkowicz R (2010), PLoS ONE 5(6):e10940; Jun. 3, 2010; see also
This exemplary multiplexed assay was adapted for Flaviviridae proteases:
A number of embodiments of the invention have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, other embodiments are within the scope of the following claims.
This application claims the benefit of priority under 35 U.S.C. §119(e) of U.S. Provisional Application No. 61/385,091, filed Sep. 21, 2010. The aforementioned application is expressly incorporated herein by reference in its entirety and for all purposes.
| Number | Date | Country | |
|---|---|---|---|
| 61385091 | Sep 2010 | US |
