COMPOSITIONS AND METHODS FOR MODULATING DELTA GAMMA CHAIN MEDIATED IMMUNITY

Abstract

Provided herein, in certain aspects, are antibodies that bind to T cell receptor (TCR) Vγ9 (TRGV9), TCR Vδ2 (TRDV2), or the TCR gamma/delta constant region (TRGDC), as well as recombinant cells containing the vectors, and compositions comprising the antibodies. Methods of making and using the antibodies are also provided.

Description

FIELD

Provided herein, in certain aspects, are antibodies that bind to T cell receptor (TCR) Vγ9 (TRGV9), TCR Vδ2 (TRDV2), or the TCR gamma/delta constant region (TRGDC), as well as recombinant cells containing the vectors, and compositions comprising the antibodies. Methods of making and using the antibodies are also provided.

REFERENCE TO SEQUENCE LISTING SUBMITTED ELECTRONICALLY

This application contains a sequence listing, which is submitted electronically as a XML formatted sequence listing with a file name of “JBI6395USDIV1_SL.xml” and a creation date of Aug. 21, 2024 and having a size of 5,799,673 bytes. The sequence listing submitted is part of the specification and is herein incorporated by reference in its entirety.

SUMMARY

In one aspect, provided herein is an antibody that binds TRGV9. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:31; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:32. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:65; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:66. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:99; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:100. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:133; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:134. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:167; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:168. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:201; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:202. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:235; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:236. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:269; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:270. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:303; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:304. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:337; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:338. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:371; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:372. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:405; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:406. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:439; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:440. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:473; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:474. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:507; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:508. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:541; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:542. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:575; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:576. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:609; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:610. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:643; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:644. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:677; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:678. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:711; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:712. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:745; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:746. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:779; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:780. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:813; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:814. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:847; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:848. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:881; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:882. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:915; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:916. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:949; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:950. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:983; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:984. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1017; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1018. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1051; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1052. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1085; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1086. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1119; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1120. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1153; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1154. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1187; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1188. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1221; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1222. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1255; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1256. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1289; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1290. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1323; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1324. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1357; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1358. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1391; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1392. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1425; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1426. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1459; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1460. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1493; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1494. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1527; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1528. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1561; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1562. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1595; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1596. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1629; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1630. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1663; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1664. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1697; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1698. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1731; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1732. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1765; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1766. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1799; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1800. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1833; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1834. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1867; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1868. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1901; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1902. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1935; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1936. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1969; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1970. In one embodiment, the TRGV9 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2003; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2004.

In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 antibody are according to the Kabat numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 antibody are according to the Chothia numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 antibody are according to the AbM numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 antibody are according to the Contact numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 antibody are according to the IMGT numbering system.

In some embodiments, the antibody binds a TRGV9 antigen. In some embodiments, antibody binds a TRGV9 epitope. In some embodiments, the antibody specifically binds to TRGV9. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an antigen of the TRGV9. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an epitope of the TRGV9. In some embodiments, the TRGV9 is present on the surface of a T cell.

In some embodiments, the TRGV9 antibody is a humanized antibody. In some embodiments, the antibody is an IgG antibody. In some embodiments, the TRGV9 antibody is an IgG1 antibody. In some embodiments, the TRGV9 antibody is an IgG2 antibody. In some embodiments, the TRGV9 antibody is an IgG3 antibody. In some embodiments, the TRGV9 antibody is an IgG4 antibody. In some embodiments, the TRGV9 antibody comprises a kappa light chain. In some embodiments, the TRGV9 the antibody comprises a lambda light chain. In some embodiments, the TRGV9 antibody is a monoclonal antibody. In some embodiments, the TRGV9 antibody is multivalent. In some embodiments, the TRGV9 antibody is capable of binding at least three antigens. In some embodiments, the TRGV9 antibody is capable of binding at least five antigens. In some embodiments, the TRGV9 antibody is a multispecific antibody. In some embodiments, the TRGV9 antibody is a bispecific antibody.

In another aspect, provided is a nucleic acid sequence encoding a TRGV9 antibody provided herein. Also provided is a vector comprising a nucleic acid sequence encoding a TRGV9 antibody provided herein. Also provided is a host cell comprising a vector comprising a nucleic acid sequence encoding a TRGV9 antibody provided herein. Also provided is a kit comprising vector comprising a nucleic acid sequence encoding a TRGV9 antibody provided herein, and packaging for the same.

In another aspect, provided is a kit comprising a TRGV9 antibody provided herein, and packaging for the same.

In another aspect, provided is a pharmaceutical composition comprising a TRGV9 antibody provided herein, and a pharmaceutically acceptable carrier.

In another aspect, provided is a method of producing a pharmaceutical composition comprising a TRGV9 antibody provided herein, comprising combining the TRGV9 antibody with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.

In another aspect, provided is a method of activating a T cell expressing TRGV9, comprising contacting the T cell with a TRGV9 antibody provided herein. In certain embodiments, the contacting results in an increase in CD69, CD25, and/or Granzyme B expression, as compared to a control T cell expressing TRGV9.

In another aspect, provided herein is an antibody that binds TRDV2. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2037; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2038. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2071; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2072. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2105; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2106. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2139; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2140. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2173; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2174. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2207; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2208. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2241; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2242. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2275; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2276. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2309; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2310. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2343; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2344. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2377; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2378. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2411; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2412. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2445; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2446. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2479; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2480. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2513; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2514. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2547; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2548. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2581; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2582. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2615; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2616. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2649; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2650. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2683; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2684. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2717; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2718. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2751; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2752. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2785; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2786. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2819; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2820. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2853; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2854. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2887; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2888. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2921; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2922. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2955; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2956. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2989; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2990. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3023; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3024. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3057; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3058. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3091; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3092. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3125; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3126. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3159; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3160. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3193; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3194. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3227; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3228. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3261; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3262. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3295; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3296. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3329; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3330. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3363; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3364. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3397; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3398. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3431; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3432. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3465; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3466. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3499; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3500. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3533; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3534. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3567; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3568. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3601; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3602. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3635; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3636. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3669; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3670. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3703; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3704. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3737; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3738. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3771; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3772. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3805; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3806. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3839; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3840. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3873; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3874. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3907; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3908. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3941; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3942. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3975; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3976. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4009; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4010. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4043; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4044. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4077; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4078. In one embodiment, the TRDV2 antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4111; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4112.

In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 antibody are according to the Kabat numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 antibody are according to the Chothia numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 antibody are according to the AbM numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 antibody are according to the Contact numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 antibody are according to the IMGT numbering system.

In some embodiments, the antibody binds a TRDV2 antigen. In some embodiments, antibody binds a TRDV2 epitope. In some embodiments, the antibody specifically binds to TRDV2. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an antigen of the TRDV2. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an epitope of the TRDV2. In some embodiments, the TRDV2 is present on the surface of a T cell.

In some embodiments, the TRDV2 antibody is a humanized antibody. In some embodiments, the antibody is an IgG antibody. In some embodiments, the TRDV2 antibody is an IgG1 antibody. In some embodiments, the TRDV2 antibody is an IgG2 antibody. In some embodiments, the TRDV2 antibody is an IgG3 antibody. In some embodiments, the TRDV2 antibody is an IgG4 antibody. In some embodiments, the TRDV2 antibody comprises a kappa light chain. In some embodiments, the TRDV2 the antibody comprises a lambda light chain. In some embodiments, the TRDV2 antibody is a monoclonal antibody. In some embodiments, the TRDV2 antibody is multivalent. In some embodiments, the TRDV2 antibody is capable of binding at least three antigens. In some embodiments, the TRDV2 antibody is capable of binding at least five antigens. In some embodiments, the TRDV2 antibody is a multispecific antibody. In some embodiments, the TRDV2 antibody is a bispecific antibody.

In another aspect, provided is a nucleic acid sequence encoding a TRDV2 antibody provided herein. Also provided is a vector comprising a nucleic acid sequence encoding a TRDV2 antibody provided herein. Also provided is a host cell comprising a vector comprising a nucleic acid sequence encoding a TRDV2 antibody provided herein. Also provided is a kit comprising vector comprising a nucleic acid sequence encoding a TRDV2 antibody provided herein, and packaging for the same.

In another aspect, provided is a kit comprising a TRDV2 antibody provided herein, and packaging for the same.

In another aspect, provided is a pharmaceutical composition comprising a TRDV2 antibody provided herein, and a pharmaceutically acceptable carrier.

In another aspect, provided is a method of producing a pharmaceutical composition comprising a TRDV2 antibody provided herein, comprising combining the TRDV2 antibody with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.

In another aspect, provided is a method of activating a T cell expressing TRDV2, comprising contacting the T cell with a TRDV2 antibody provided herein. In certain embodiments, the contacting results in an increase in CD69, CD25, and/or Granzyme B expression, as compared to a control T cell expressing TRDV2.

In another aspect, provided herein is an antibody that binds TRGDC. In one embodiment, the TRGDC antibody comprises: In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4145; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4146. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4179; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4180. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4213; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4214. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4247; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4248. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4281; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4282. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4315; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4316. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4349; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4350. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4383; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4384. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4417; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4418. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4451; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4452. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4485; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4486. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4519; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4520. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4553; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4554. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4587; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4588. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4621; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4622. In one embodiment, the TRGDC antibody comprises: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4655; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4656.

In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC antibody are according to the Kabat numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC antibody are according to the Chothia numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC antibody are according to the AbM numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC antibody are according to the Contact numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC antibody are according to the IMGT numbering system.

In some embodiments, the antibody binds a TRGDC antigen. In some embodiments, antibody binds a TRGDC epitope. In some embodiments, the antibody specifically binds to TRGDC. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an antigen of the TRGDC. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an epitope of the TRGDC. In some embodiments, the TRGDC is present on the surface of a T cell.

In some embodiments, the TRGDC antibody is a humanized antibody. In some embodiments, the antibody is an IgG antibody. In some embodiments, the TRGDC antibody is an IgG1 antibody. In some embodiments, the TRGDC antibody is an IgG2 antibody. In some embodiments, the TRGDC antibody is an IgG3 antibody. In some embodiments, the TRGDC antibody is an IgG4 antibody. In some embodiments, the TRGDC antibody comprises a kappa light chain. In some embodiments, the TRGDC the antibody comprises a lambda light chain. In some embodiments, the TRGDC antibody is a monoclonal antibody. In some embodiments, the TRGDC antibody is multivalent. In some embodiments, the TRGDC antibody is capable of binding at least three antigens. In some embodiments, the TRGDC antibody is capable of binding at least five antigens. In some embodiments, the TRGDC antibody is a multispecific antibody. In some embodiments, the TRGDC antibody is a bispecific antibody.

In another aspect, provided is a nucleic acid sequence encoding a TRGDC antibody provided herein. Also provided is a vector comprising a nucleic acid sequence encoding a TRGDC antibody provided herein. Also provided is a host cell comprising a vector comprising a nucleic acid sequence encoding a TRGDC antibody provided herein. Also provided is a kit comprising vector comprising a nucleic acid sequence encoding a TRGDC antibody provided herein, and packaging for the same.

In another aspect, provided is a kit comprising a TRGDC antibody provided herein, and packaging for the same.

In another aspect, provided is a pharmaceutical composition comprising a TRGDC antibody provided herein, and a pharmaceutically acceptable carrier.

In another aspect, provided is a method of producing a pharmaceutical composition comprising a TRGDC antibody provided herein, comprising combining the TRGDC antibody with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.

In another aspect, provided is a method of activating a T cell expressing TRGDC, comprising contacting the T cell with a TRGDC antibody provided herein. In certain embodiments, the contacting results in an increase in CD69, CD25, and/or Granzyme B expression, as compared to a control T cell expressing TRGDC.

DETAILED DESCRIPTION

Various publications, articles and patents are cited or described in the background and throughout the specification; each of these references is herein incorporated by reference in its entirety. Discussion of documents, acts, materials, devices, articles or the like which has been included in the present specification is for the purpose of providing context for the invention. Such discussion is not an admission that any or all of these matters form part of the prior art with respect to any inventions disclosed or claimed.

Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this invention pertains. Otherwise, certain terms used herein have the meanings as set forth in the specification.

It must be noted that as used herein and in the appended claims, the singular forms “a,” “an,” and “the” include plural reference unless the context clearly dictates otherwise.

Unless otherwise stated, any numerical values, such as a concentration or a concentration range described herein, are to be understood as being modified in all instances by the term “about.” Thus, a numerical value typically includes ±10% of the recited value. For example, a concentration of 1 mg/mL includes 0.9 mg/mL to 1.1 mg/mL. Likewise, a concentration range of 1% to 10% (w/v) includes 0.9% (w/v) to 11% (w/v). As used herein, the use of a numerical range expressly includes all possible subranges, all individual numerical values within that range, including integers within such ranges and fractions of the values unless the context clearly indicates otherwise.

Unless otherwise indicated, the term “at least” preceding a series of elements is to be understood to refer to every element in the series.

Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments described herein. Such equivalents are intended to been compassed by the invention.

As used herein, the terms “comprises,” “comprising,” “includes,” “including,” “has,” “having,” “contains” or “containing,” or any other variation thereof, will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers and are intended to be non-exclusive or open-ended. For example, a composition, a mixture, a process, a method, an article, or an apparatus that comprises a list of elements is not necessarily limited to only those elements but can include other elements not expressly listed or inherent to such composition, mixture, process, method, article, or apparatus. Further, unless expressly stated to the contrary, “or” refers to an inclusive or and not to an exclusive or. For example, a condition A or B is satisfied by any one of the following: A is true (or present) and B is false (or not present), A is false (or not present) and B is true (or present), and both A and B are true (or present).

As used herein, the conjunctive term “and/or” between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by “and/or,” a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or” as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or.”

As used herein, the term “consists of,” or variations such as “consist of” or “consisting of,” as used throughout the specification and claims, indicate the inclusion of any recited integer or group of integers, but that no additional integer or group of integers can be added to the specified method, structure, or composition.

As used herein, the term “consists essentially of,” or variations such as “consist essentially of” or “consisting essentially of,” as used throughout the specification and claims, indicate the inclusion of any recited integer or group of integers, and the optional inclusion of any recited integer or group of integers that do not materially change the basic or novel properties of the specified method, structure or composition. See M.P.E.P. § 2111.03.

As used herein, “subject” means any animal, preferably a mammal, most preferably a human. The term “mammal” as used herein, encompasses any mammal. Examples of mammals include, but are not limited to, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, monkeys, humans, etc. In a specific embodiments, the subject is a human.

It should also be understood that the terms “about,” “approximately,” “generally,” “substantially,” and like terms, used herein when referring to a dimension or characteristic of a component of embodiments provided herein, indicate that the described dimension/characteristic is not a strict boundary or parameter and does not exclude minor variations therefrom that are functionally the same or similar, as would be understood by one having ordinary skill in the art. At a minimum, such references that include a numerical parameter would include variations that, using mathematical and industrial principles accepted in the art (e.g., rounding, measurement or other systematic errors, manufacturing tolerances, etc.), would not vary the least significant digit.

The terms “identical” or percent “identity,” in the context of two or more nucleic acids or polypeptide sequences (e.g., TRGV9 antibody and polynucleotides that encode them, TRDV2 antibody and polynucleotides that encode them, or TRGDC antibody and polynucleotides that encode them), refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.

For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.

Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by visual inspection (see generally, Current Protocols in Molecular Biology, F. M. Ausubel et al., eds., Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (1995 Supplement) (Ausubel)).

Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1997) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased.

Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a word length (W) of 11, an expectation (E) of 10, M=5, N=−4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a word length (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)).

In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.

A further indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions.

As used herein, the term “polynucleotide,” synonymously referred to as “nucleic acid molecule,” “nucleotides” or “nucleic acids,” refers to any polyribonucleotide or polydeoxyribonucleotide, which can be unmodified RNA or DNA or modified RNA or DNA. “Polynucleotides” include, without limitation single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that can be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions. In addition, “polynucleotide” refers to triple-stranded regions comprising RNA or DNA or both RNA and DNA. The term polynucleotide also includes DNAs or RNAs containing one or more modified bases and DNAs or RNAs with backbones modified for stability or for other reasons. “Modified” bases include, for example, tritylated bases and unusual bases such as inosine. A variety of modifications can be made to DNA and RNA; thus, “polynucleotide” embraces chemically, enzymatically or metabolically modified forms of polynucleotides as typically found in nature, as well as the chemical forms of DNA and RNA characteristic of viruses and cells. “Polynucleotide” also embraces relatively short nucleic acid chains, often referred to as oligonucleotides.

As used herein, the term “vector” is a replicon in which another nucleic acid segment can be operably inserted so as to bring about the replication or expression of the segment.

As used herein, the term “host cell” refers to a cell comprising a nucleic acid molecule provided herein. The “host cell” can be any type of cell, e.g., a primary cell, a cell in culture, or a cell from a cell line. In one embodiment, a “host cell” is a cell transfected with a nucleic acid molecule provided herein. In another embodiment, a “host cell” is a progeny or potential progeny of such a transfected cell. A progeny of a cell may or may not be identical to the parent cell, e.g., due to mutations or environmental influences that can occur in succeeding generations or integration of the nucleic acid molecule into the host cell genome.

The term “expression” as used herein, refers to the biosynthesis of a gene product. The term encompasses the transcription of a gene into RNA. The term also encompasses translation of RNA into one or more polypeptides, and further encompasses all naturally occurring post-transcriptional and post-translational modifications. The expressed antibody can be within the cytoplasm of a host cell, into the extracellular milieu such as the growth medium of a cell culture or anchored to the cell membrane.

As used herein, the terms “peptide,” “polypeptide,” or “protein” can refer to a molecule comprised of amino acids and can be recognized as a protein by those of skill in the art. The conventional one-letter or three-letter code for amino acid residues is used herein. The terms “peptide,” “polypeptide,” and “protein” can be used interchangeably herein to refer to polymers of amino acids of any length. The polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art.

The peptide sequences described herein are written according to the usual convention whereby the N-terminal region of the peptide is on the left and the C-terminal region is on the right. Although isomeric forms of the amino acids are known, it is the L-form of the amino acid that is represented unless otherwise expressly indicated.

Antibodies

Provided herein are TRGV9 antibodies or antigen-binding fragments thereof, nucleic acids and expression vectors encoding the antibodies, recombinant cells containing the vectors, and compositions comprising the antibodies. The antibodies disclosed herein possess one or more desirable functional properties, including but not limited to high-affinity binding to TRGV9 or high specificity to TRGV9. Also provided herein are TRDV2 antibodies or antigen-binding fragments thereof, nucleic acids and expression vectors encoding the antibodies, recombinant cells containing the vectors, and compositions comprising the antibodies. The antibodies disclosed herein possess one or more desirable functional properties, including but not limited to high-affinity binding to TRDV2 or high specificity to TRDV2. Also provided herein are antibodies or antigen-binding fragments thereof that bind TRGDC, nucleic acids and expression vectors encoding the antibodies, recombinant cells containing the vectors, and compositions comprising the antibodies. The antibodies disclosed herein possess one or more desirable functional properties, including but not limited to high-affinity binding to TRGDC or high specificity to TRGDC. Methods of making the antibodies, and methods of using the antibodies to treat diseases are also provided. In certain embodiments, the antibodies disclosed herein possess the ability to treat or prevent a disease or disorder when administered to a subject alone or in combination with other therapies.

As used herein, the term “antibody” is used in a broad sense and includes immunoglobulin or antibody molecules including human, humanized, composite and chimeric antibodies and antibody fragments that are monoclonal or polyclonal. In general, antibodies are proteins or peptide chains that exhibit binding specificity to a specific antigen. Antibody structures are well known. Immunoglobulins can be assigned to five major classes (i.e., IgA, IgD, IgE, IgG and IgM), depending on the heavy chain constant domain amino acid sequence. IgA and IgG are further sub-classified as the isotypes IgA1, IgA2, IgG1, IgG2, IgG3 and IgG4. Accordingly, the antibodies provided herein can be of any of the five major classes or corresponding sub-classes. In specific embodiments, the antibodies provided herein are IgG1, IgG2, IgG3 or IgG4. Antibody light chains of vertebrate species can be assigned to one of two clearly distinct types, namely kappa and lambda, based on the amino acid sequences of their constant domains. Accordingly, the antibodies provided herein can, in certain embodiments, contain a kappa light chain constant domain. The antibodies provided herein can, in certain embodiments, also contain a lambda light chain constant domain. According to particular embodiments, the antibodies provided herein include heavy and/or light chain constant regions from rat or human antibodies. In specific embodiments, the contant region is a human constant region.

In addition to the heavy and light constant domains, antibodies contain an antigen-binding region that is made up of a light chain variable region (VL) and a heavy chain variable region (VH), each of which contains three domains (i.e., complementarity determining regions 1 (CDR1), CDR2 and CDR3. A “CDR” refers to one of three hypervariable regions (HCDR1, HCDR2 or HCDR3) within the non-framework region of the immunoglobulin (Ig or antibody) VH β-sheet framework, or one of three hypervariable regions (LCDR1, LCDR2 or LCDR3) within the non-framework region of the antibody VL β-sheet framework. Accordingly, CDRs are variable region sequences interspersed within the framework region sequences. CDR regions are well known to those skilled in the art and have been defined by, for example, Kabat as the regions of most hypervariability within the antibody variable (V) domains (Kabat et al., J. Biol. Chem. 252:6609-6616 (1977); Kabat, Adv. Prot. Chem. 32:1-75 (1978)). CDR region sequences also have been defined structurally by Chothia as those residues that are not part of the conserved β-sheet framework, and thus are able to adapt different conformations (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)). Both terminologies are well recognized in the art. CDR region sequences have also been defined by AbM, Contact and IMGT. Exemplary CDR region sequences are illustrated herein, for example, in the tables provided in the Examples below. The positions of CDRs within a canonical antibody variable region have been determined by comparison of numerous structures (Al-Lazikani et al., J. Mol. Biol. 273:927-948 (1997); Morea et al., Methods 20:267-279 (2000)). Because the number of residues within a hypervariable region varies in different antibodies, additional residues relative to the canonical positions are conventionally numbered with a, b, c and so forth next to the residue number in the canonical variable region numbering scheme (Al-Lazikani et al., supra (1997)). Such nomenclature is similarly well known to those skilled in the art.

The light chain variable region CDR1 domain is interchangeably referred to herein as LCDR1 or VL CDR1. The light chain variable region CDR2 domain is interchangeably referred to herein as LCDR2 or VL CDR2. The light chain variable region CDR3 domain is interchangeably referred to herein as LCDR3 or VL CDR3. The heavy chain variable region CDR1 domain is interchangeably referred to herein as HCDR1 or VH CDR1. The heavy chain variable region CDR2 domain is interchangeably referred to herein as HCDR2 or VH CDR2. The heavy chain variable region CDR1 domain is interchangeably referred to herein as HCDR3 or VH CDR3.

The term “hypervariable region”, such as a VH or VL, when used herein refers to the regions of an antibody variable region that are hypervariable in sequence and/or form structurally defined loops. Generally, antibodies comprise six hypervariable regions; three in the VH (HCDR1, HCDR2, HCDR3), and three in the VL (LCDR1, LCDR2, LCDR3). A number of hypervariable region delineations are in use and are encompassed herein. The “Kabat” CDRs are based on sequence variability and are the most commonly used (see, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). “Chothia” refers instead to the location of the structural loops (see, e.g., Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)). The end of the Chothia CDR-HCDR1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34). The “AbM” hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software (see, e.g., Martin, in Antibody Engineering, Vol. 2, Chapter 3, Springer Verlag). “Contact” hypervariable regions are based on an analysis of the available complex crystal structures.

Recently, a universal numbering system has been developed and widely adopted, ImMunoGeneTics (IMGT) Information System® (Lafranc et al., Dev. Comp. Immunol. 27(1):55-77 (2003)). IMGT is an integrated information system specializing in immunoglobulins (IG), T cell receptors (TR) and major histocompatibility complex (MHC) of human and other vertebrates. Herein, the CDRs are referred to in terms of both the amino acid sequence and the location within the light or heavy chain. As the “location” of the CDRs within the structure of the immunoglobulin variable domain is conserved between species and present in structures called loops, by using numbering systems that align variable domain sequences according to structural features, CDR and framework residues and are readily identified. This information can be used in grafting and replacement of CDR residues from immunoglobulins of one species into an acceptor framework from, typically, a human antibody. An additional numbering system (AHon) has been developed by Honegger and Plückthun, J. Mol. Biol. 309: 657-670 (2001). Correspondence between the numbering system, including, for example, the Kabat numbering and the IMGT unique numbering system, is well known to one skilled in the art (see, e.g., Kabat, supra; Chothia and Lesk, supra; Martin, supra; Lefranc et al., supra). An Exemplary system, shown herein, combines Kabat and Chothia.

	Exemplary	IMGT	Kabat	AbM	Chothia	Contact
VH CDR1	26-35	27-38	31-35	26-35	26-32	30-35
VH CDR2	50-65	56-65	50-65	50-58	53-55	47-58
VH CDR3	95-102	105-117	95-102	95-102	96-101	93-101
VL CDR1	24-34	27-38	24-34	24-34	26-32	30-36
VL CDR2	50-56	56-65	50-56	50-56	50-52	46-55
VL CDR3	89-97	105-117	89-97	89-97	91-96	89-96

Hypervariable regions may comprise “extended hypervariable regions” as follows: 24-36 or 24-34 (LCDR1), 46-56 or 50-56 (LCDR2) and 89-97 or 89-96 (LCDR3) in the VL and 26-35 or 26-35A (HCDR1), 50-65 or 49-65 (HCDR2) and 93-102, 94-102, or 95-102 (HCDR3) in the VH. CDR sequences, reflecting each of the above numbering schemes, are provided herein, including in Tables 2-7.

The term “constant region” or “constant domain” refers to a carboxy terminal portion of the light and heavy chain which is not directly involved in binding of the antibody to antigen but exhibits various effector function, such as interaction with the Fc receptor. The terms refer to the portion of an immunoglobulin molecule having a more conserved amino acid sequence relative to the other portion of the immunoglobulin, the variable region, which contains the antigen binding site. The constant region may contain the CH1, CH2 and CH3 regions of the heavy chain and the CL region of the light chain.

The term “framework” or “FR” residues are those variable region residues flanking the CDRs. FR residues are present, for example, in chimeric, humanized, human, domain antibodies, diabodies, linear antibodies, and bispecific antibodies. FR residues are those variable domain residues other than the hypervariable region residues or CDR residues.

As used herein, the term an “isolated antibody” refers to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to TRGV9 is substantially free of antibodies that do not bind to TRGV9, or an isolated antibody that specifically binds to TRDV2 is substantially free of antibodies that do not bind to TRDV2, or an isolated antibody that specifically binds to TRGDC is substantially free of antibodies that do not bind to TRGDC). In addition, an isolated antibody is substantially free of other cellular material and/or chemicals.

As used herein, the term “monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that can be present in minor amounts. Monoclonal antibodies provided herein can be made by the hybridoma method, phage display technology, single lymphocyte gene cloning technology, or by recombinant DNA methods. For example, the monoclonal antibodies can be produced by a hybridoma which includes a B cell obtained from a transgenic nonhuman animal, such as a transgenic mouse or rat, having a genome comprising a human heavy chain transgene and a light chain transgene.

As used herein, the term “antigen-binding fragment” refers to an antibody fragment such as, for example, a diabody, a Fab, a Fab′, a F(ab′)2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv)₂, a bispecific dsFv (dsFv-dsFv′), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), a single domain antibody (sdAb) an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure. An antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment binds. According to particular embodiments, the antigen-binding fragment comprises a light chain variable region, a light chain constant region, and an Fd segment of the heavy chain. According to other particular embodiments, the antigen-binding fragment comprises Fab and F(ab′).

As used herein, the term “single-chain antibody” refers to a conventional single-chain antibody in the field, which comprises a heavy chain variable region and a light chain variable region connected by a short peptide of about 15 to about 20 amino acids. As used herein, the term “single domain antibody” refers to a conventional single domain antibody in the field, which comprises a heavy chain variable region and a heavy chain constant region or which comprises only a heavy chain variable region.

As used herein, the term “human antibody” refers to an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art. This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide.

As used herein, the term “humanized antibody” refers to a non-human antibody that is modified to increase the sequence homology to that of a human antibody, such that the antigen-binding properties of the antibody are retained, but its antigenicity in the human body is reduced.

As used herein, the term “chimeric antibody” refers to an antibody wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species. The variable region of both the light and heavy chains often corresponds to the variable region of an antibody derived from one species of mammal (e.g., mouse, rat, rabbit, etc.) having the desired specificity, affinity, and capability, while the constant regions correspond to the sequences of an antibody derived from another species of mammal (e.g., human) to avoid eliciting an immune response in that species.

As used herein, the term “multispecific antibody” refers to an antibody that comprises a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope. In an embodiment, the first and second epitopes do not overlap or do not substantially overlap. In an embodiment, the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein). In an embodiment, a multispecific antibody comprises a third, fourth, or fifth immunoglobulin variable domain. In an embodiment, a multispecific antibody is a bispecific antibody molecule, a trispecific antibody molecule, or a tetraspecific antibody molecule.

As used herein, the term “bispecific antibody” refers to a multispecific antibody that binds no more than two epitopes or two antigens. A bispecific antibody is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope (e.g., an epitope on a TRGV9 antigen, an epitope on a TRDV2 antigen, or an epitope on TRGDC) and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope. In an embodiment, the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein). In an embodiment, a bispecific antibody comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope. In an embodiment, a bispecific antibody comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope. In an embodiment, a bispecific antibody comprises a scFv, or fragment thereof, having binding specificity for a first epitope, and a scFv, or fragment thereof, having binding specificity for a second epitope. A “trispecific antibody” is a multispecific antibody that binds three distinct antigens, or three distinct epitopes within the same antigen. A “quadraspecific antibody” is a multispecific antibody that binds four distinct antigens, or four distinct epitopes within the same antigen.

As used herein, the term “TRGV9” refers to a polypeptide capable of forming a T cell receptor when expressed on the surface of γδ T cells. TRGV9-expressing γδ T cells are among the first T cells to develop in the human fetus and are the predominant γδ T cell subset in healthy adult peripheral blood cells. The terms “TRGV9,” “Vγ9,” and “VG9” are used interchangeably herein. The term “TRGV9” includes any TRGV9 variant, isoform, and species homolog, which is naturally expressed by cells (including T cells) or can be expressed on cells transfected with genes or cDNA encoding the polypeptide. In specific embodiments, the TRGV9 is a human TRGV9. An exemplary human TRGV9 amino acid sequence is provided by GenBank Accession Number NG_001336.2.

As used herein, an antibody that “specifically binds to TRGV9” refers to an antibody that binds to a TRGV9, preferably a human TRGV9, with a KD of 1×10⁻⁷ M or less, such as 1×10⁻⁸ M or less, 5×10⁻⁹ M or less, 1×10⁻⁹ M or less, 5×10⁻¹⁰ M or less, or 1×10⁻¹⁰ M or less.

As used herein, the term “TRDV2” refers to a polypeptide capable of forming a T cell receptor when expressed on the surface of γδ T cells. TRDV2-expressing γδ T cells are among the first T cells to develop in the human fetus and are the predominant γδ T cell subset in healthy adult peripheral blood cells. The terms “TRDV2,” “Vδ2,” and “VD2” are used interchangeably herein. The term “TRDV2” includes any TRDV2 variant, isoform, and species homolog, which is naturally expressed by cells (including T cells) or can be expressed on cells transfected with genes or cDNA encoding the polypeptide. In specific embodiments, the TRDV2 is a human TRDV2. An exemplary human TRDV2 amino acid sequence is provided by GenBank Accession Number NG_001332.3.

As used herein, an antibody that “specifically binds to TRDV2” refers to an antibody that binds to a TRDV2, such as a human TRDV2, with a KD of 1×10⁻⁷ M or less, such as 1×10⁻⁸ M or less, 5×10⁻⁹ M or less, 1×10⁻⁹ M or less, 5×10⁻¹⁰ M or less, or 1×10⁻¹¹ M or less.

As used herein, the term the “TRGDC” refers to a polypeptide capable of forming a T cell receptor when expressed on the surface of γδ T cells. The terms “TRGDC” and “gamma delta constant” are used interchangeably herein. The term “TRGDC” includes any TRGDC variant, isoform, and species homolog, which is naturally expressed by cells (including T cells) or can be expressed on cells transfected with genes or cDNA encoding the polypeptide. In specific embodiments, the TRGDC is a human TRGDC. An exemplary human T cell receptor delta constant (TRDC) amino acid sequence is provided by GenBank Accession Number NG_001332.3, and an exemplary human T cell receptor gamma constant (TRGC) amino acid sequence is provided by GenBank Accession Number NC_000007.14 (TRGC1) or NC_000007.14 (TRGC2).

As used herein, an antibody that “specifically binds to TRGDC” refers to an antibody that binds to a TRGDC, such as a human TRGDC, with a KD of 1×10⁻⁷ M or less, such as 1×10⁻⁸ M or less, 5×10⁻⁹ M or less, 1×10⁻⁹ M or less, 5×10⁻¹⁰ M or less, or 1×10⁻¹⁰ M or less.

The term “KD” refers to the dissociation constant, which is obtained from the ratio of Kd to Ka (i.e., Kd/Ka) and is expressed as a molar concentration (M). KD values for antibodies can be determined using methods in the art in view of the present disclosure. For example, the KD of an antibody can be determined by using surface plasmon resonance, such as by using a biosensor system, e.g., a Biacore® system, or by using bio-layer interferometry technology, such as an Octet RED96 system. The smaller the value of the KD of an antibody, the higher affinity that the antibody binds to a target antigen.

In one aspect, provided herein is an antibody that binds to TRGV9. In some embodiments, provided herein is an antibody that binds to a TRGV9 antigen. In some embodiments, provided herein is an antibody that binds to a TRGV9 epitope.

In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region. In a some embodiments, the TRGV9 antibody is not a single domain antibody or nanobody. In some embodiments, the TRGV9 antibody is a humanized antibody. In some embodiments, the TRGV9 antibody is a fully human antibody.

In certain embodiments, provided herein is a TRGV9 antibody comprising a VH region, VL region, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 of any one of the antibodies described herein. In some embodiments, provided herein is a TRGV9 antibody comprising a VH region of any one of the antibodies described herein. In some embodiments, provided herein is a TRGV9 antibody comprising a VL region of any one of the antibodies described herein. In some embodiments, provided herein is a TRGV9 antibody comprising a VH region of any one of the antibodies described herein, and a VL region of any one of the antibodies described herein. In some embodiments, provided herein is a TRGV9 antibody comprising a VH CDR1, VH CDR2, and VH CDR3 of any one of the antibodies described herein. In some embodiments, provided herein is a TRGV9 antibody comprising a VL CDR1, VL CDR2, and VL CDR3 of any one of the antibodies described herein. In some embodiments, provided herein is a TRGV9 antibody comprising a VH CDR1, VH CDR2, and VH CDR3 of any one of the antibodies described herein; and a VL CDR1, VL CDR2, and VL CDR3 of any one of the antibodies described herein. Representative VH and VL amino acid sequences, including VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 amino acid sequences, of TRGV9 antibodies provided herein are provided in the Tables 2-7.

In one aspect, provided herein is an antibody that binds to TRDV2. In some embodiments, provided herein is an antibody that binds to a TRDV2 antigen. In some embodiments, provided herein is an antibody that binds to a TRDV2 epitope.

In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region. In a some embodiments, the TRDV2 antibody is not a single domain antibody or nanobody. In some embodiments, the TRDV2 antibody is a humanized antibody. In some embodiments, the TRDV2 antibody is a fully human antibody.

In certain embodiments, provided herein is a TRDV2 antibody comprising a VH region, VL region, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 of any one of the antibodies described herein. In some embodiments, provided herein is a TRDV2 antibody comprising a VH region of any one of the antibodies described herein. In some embodiments, provided herein is a TRDV2 antibody comprising a VL region of any one of the antibodies described herein. In some embodiments, provided herein is a TRDV2 antibody comprising a VH region of any one of the antibodies described herein, and a VL region of any one of the antibodies described herein. In some embodiments, provided herein is a TRDV2 antibody comprising a VH CDR1, VH CDR2, and VH CDR3 of any one of the antibodies described herein. In some embodiments, provided herein is a TRDV2 antibody comprising a VL CDR1, VL CDR2, and VL CDR3 of any one of the antibodies described herein. In some embodiments, provided herein is a TRDV2 antibody comprising a VH CDR1, VH CDR2, and VH CDR3 of any one of the antibodies described herein; and a VL CDR1, VL CDR2, and VL CDR3 of any one of the antibodies described herein. Representative VH and VL amino acid sequences, including VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 amino acid sequences, of TRDV2 antibodies provided herein are provided in Tables 2-7.

In one aspect, provided herein is an antibody that binds to TRGDC. In some embodiments, provided herein is an antibody that binds to a TRGDC antigen. In some embodiments, provided herein is an antibody that binds to a TRGDC epitope.

In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region. In a some embodiments, the TRGDC antibody is not a single domain antibody or nanobody. In some embodiments, the TRGDC antibody is a humanized antibody. In some embodiments, the TRGDC antibody is a fully human antibody.

In certain embodiments, provided herein is a TRGDC antibody comprising a VH region, VL region, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 of any one of the antibodies described herein. In some embodiments, provided herein is a TRGDC antibody comprising a VH region of any one of the antibodies described herein. In some embodiments, provided herein is a TRGDC antibody comprising a VL region of any one of the antibodies described herein. In some embodiments, provided herein is a TRGDC antibody comprising a VH region of any one of the antibodies described herein, and a VL region of any one of the antibodies described herein. In some embodiments, provided herein is a TRGDC antibody comprising a VH CDR1, VH CDR2, and VH CDR3 of any one of the antibodies described herein. In some embodiments, provided herein is a TRGDC antibody comprising a VL CDR1, VL CDR2, and VL CDR3 of any one of the antibodies described herein. In some embodiments, provided herein is a TRGDC antibody comprising a VH CDR1, VH CDR2, and VH CDR3 of any one of the antibodies described herein; and a VL CDR1, VL CDR2, and VL CDR3 of any one of the antibodies described herein. Representative VH and VL amino acid sequences, including VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 amino acid sequences, of TRGDC antibodies provided herein are provided in Tables 2-7.

In some embodiments, the antibody specifically binds TRGV9. In other embodiments, the TRGV9 is present on the surface of a T cell. In some embodiments, the antibody specifically binds TRDV2. In other embodiments, the TRDV2 is present on the surface of a T cell. In some embodiments, the antibody specifically binds TRGDC. In other embodiments, the TRGDC is present on the surface of a T cell.

In some embodiments, the antibody is a humanized antibody. In certain embodiments, the antibody is an IgG antibody. In other embodiments, the IgG antibody is an IgG1, IgG2, IgG3, or IgG4 antibody. In some embodiments, the antibody is a bispecific antibody. In some embodiments, the antibody is a trispecific antibody. In some embodiments, the antibody is a quadraspecific antibody. In certain embodiments, the antibody is multivalent. In other embodiments, the antibody is capable of binding at least three antigens. In some embodiments, the antibody is capable of binding at least four antigens. In some embodiments, the antibody is capable of binding at least five antigens.

In certain embodiments, provided is a TRGV9 antibody that is an intact antibody. In other embodiments, provided is a TRGV9 antibody is an antigen binding fragment of the TRGV9 antibody. In some embodiments, the antigen binding fragment of the TRGV9 antibody is a functional fragment. In certain embodiments, provided is a TRDV2 antibody that is an intact antibody. In other embodiments, provided is a TRDV2 antibody is an antigen binding fragment of the TRDV2 antibody. In some embodiments, the antigen binding fragment of the TRDV2 antibody is a functional fragment. In certain embodiments, provided is a TRGDC antibody that is an intact antibody. In other embodiments, provided is a TRGDC antibody is an antigen binding fragment of the TRGDC antibody. In some embodiments, the antigen binding fragment of the TRGDC antibody is a functional fragment.

In some embodiments, the antigen binding fragment is a diabody. In some embodiments, the antigen binding fragment is a Fab. In some embodiments, the antigen binding fragment is a Fab′. In some embodiments, the antigen binding fragment is a F(ab′)2. In some embodiments, the antigen binding fragment is a Fv fragment. In some embodiments, the antigen binding fragment is a disulfide stabilized Fv fragment (dsFv). In some embodiments, the antigen binding fragment is a (dsFv)₂. In some embodiments, the antigen binding fragment is a bispecific dsFv (dsFv-dsFv′). In some embodiments, the antigen binding fragment is a disulfide stabilized diabody (ds diabody). In some embodiments, the antigen binding fragment is a single-chain antibody molecule (scFv). In some embodiments, the antigen binding fragment is a single domain antibody (sdAb). In some embodiments, the antigen binding fragment is an scFv dimer (bivalent diabody). In some embodiments, the antigen binding fragment is a multispecific antibody formed from a portion of an antibody comprising one or more CDRs. In some embodiments, the antigen binding fragment is a camelized single domain antibody. In some embodiments, the antigen binding fragment is a nanobody. In some embodiments, the antigen binding fragment is a domain antibody. In some embodiments, the antigen binding fragment is a bivalent domain antibody. In some embodiments, the antigen binding fragment is an antibody fragment that binds to an antigen but does not comprise a complete antibody structure.

In specific embodiments, the TRGV9 antibody comprises a VH region and a VL region. In some embodiments, the TRGV9 antibody is a single chain antibody. In some embodiments, the TRGV9 antibody is a single domain antibody. In some embodiments, the TRGV9 antibody is a nanobody. In certain embodiments, the TRGV9 antibody is a VHH antibody. In certain embodiments, the TRGV9 antibody is a llama antibody. In some embodiments, the TRGV9 antibody is not a single chain antibody. In some embodiments, the TRGV9 antibody is not a single domain antibody. In some embodiments, the TRGV9 antibody is not a nanobody. In certain embodiments, the TRGV9 antibody is not a VHH antibody. In certain embodiments, the TRGV9 antibody is not a llama antibody. In some embodiments, the TRGV9 antibody is a multispecific antibody In other embodiments, the TRGV9 antibody is a bispecific antibody. In other embodiments, the TRGV9 antibody is a trispecific antibody. In other embodiments, the TRGV9 antibody is a quadraspecific antibody. In certain embodiments, the multispecific antibody comprises an antigen binding fragment of a TRGV9 antibody provided herein. In other embodiments, the bispecific antibody comprises an antigen binding fragment of a TRGV9 antibody provided herein. In other embodiments, the trispecific antibody comprises an antigen binding fragment of a TRGV9 antibody provided herein. In other embodiments, the quadraspecific antibody comprises an antigen binding fragment of a TRGV9 antibody provided herein. In In certain embodiments, the TRGV9 antibody activates T cells. In other embodiments, the TRGV9 antibody is an antagonistic antibody. In certain embodiments, the TRGV9 antibody inactivates T cells. In some embodiments, the TRGV9 antibody blocks activation of T cells. In some embodiments, the TRGV9 antibody modulates the activity of T cells. In some embodiments, the TRGV9 antibody neither activates or inactivates the activity of T cells. In specific embodiments, the T cells are human T cells.

In specific embodiments, the TRDV2 antibody comprises a VH region and a VL region. In some embodiments, the TRDV2 antibody is a single chain antibody. In some embodiments, the TRDV2 antibody is a single domain antibody. In some embodiments, the TRDV2 antibody is a nanobody. In certain embodiments, the TRDV2 antibody is a VHH antibody. In certain embodiments, the TRDV2 antibody is a llama antibody. In some embodiments, the TRDV2 antibody is not a single chain antibody. In some embodiments, the TRDV2 antibody is not a single domain antibody. In some embodiments, the TRDV2 antibody is not a nanobody. In certain embodiments, the TRDV2 antibody is not a VHH antibody. In certain embodiments, the TRDV2 antibody is not a llama antibody. In some embodiments, the TRDV2 antibody is a multispecific antibody In other embodiments, the TRDV2 antibody is a bispecific antibody. In other embodiments, the TRDV2 antibody is a trispecific antibody. In other embodiments, the TRDV2 antibody is a quadraspecific antibody. In certain embodiments, the multispecific antibody comprises an antigen binding fragment of a TRDV2 antibody provided herein. In other embodiments, the bispecific antibody comprises an antigen binding fragment of a TRDV2 antibody provided herein. In other embodiments, the trispecific antibody comprises an antigen binding fragment of a TRDV2 antibody provided herein. In other embodiments, the quadraspecific antibody comprises an antigen binding fragment of a TRDV2 antibody provided herein. In In certain embodiments, the TRDV2 antibody activates T cells. In other embodiments, the TRDV2 antibody is an antagonistic antibody. In certain embodiments, the TRDV2 antibody inactivates T cells. In some embodiments, the TRDV2 antibody blocks activation of T cells. In some embodiments, the TRDV2 antibody modulates the activity of T cells. In some embodiments, the TRDV2 antibody neither activates or inactivates the activity of T cells. In specific embodiments, the T cells are human T cells.

In specific embodiments, the TRGDC antibody comprises a VH region and a VL region. In some embodiments, the TRGDC antibody is a single chain antibody. In some embodiments, the TRGDC antibody is a single domain antibody. In some embodiments, the TRGDC antibody is a nanobody. In certain embodiments, the TRGDC antibody is a VHH antibody. In certain embodiments, the TRGDC antibody is a llama antibody. In some embodiments, the TRGDC antibody is not a single chain antibody. In some embodiments, the TRGDC antibody is not a single domain antibody. In some embodiments, the TRGDC antibody is not a nanobody. In certain embodiments, the TRGDC antibody is not a VHH antibody. In certain embodiments, the TRGDC antibody is not a llama antibody. In some embodiments, the TRGDC antibody is a multispecific antibody In other embodiments, the TRGDC antibody is a bispecific antibody. In other embodiments, the TRGDC antibody is a trispecific antibody. In other embodiments, the TRGDC antibody is a quadraspecific antibody. In certain embodiments, the multispecific antibody comprises an antigen binding fragment of a TRGDC antibody provided herein. In other embodiments, the bispecific antibody comprises an antigen binding fragment of a TRGDC antibody provided herein. In other embodiments, the trispecific antibody comprises an antigen binding fragment of a TRGDC antibody provided herein. In other embodiments, the quadraspecific antibody comprises an antigen binding fragment of a TRGDC antibody provided herein. In In certain embodiments, the TRGDC antibody activates T cells. In other embodiments, the TRGDC antibody is an antagonistic antibody. In certain embodiments, the TRGDC antibody inactivates T cells. In some embodiments, the TRGDC antibody blocks activation of T cells. In some embodiments, the TRGDC antibody modulates the activity of T cells. In some embodiments, the TRGDC antibody neither activates or inactivates the activity of T cells. In specific embodiments, the T cells are human T cells.

In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 sequences are according to the Kabat numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 sequences are according to the Chothia numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 sequences are according to the Exemplary numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 sequences are according to the Contact numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 sequences are according to the IMGT numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 sequences are according to the AbM numbering system. Exemplary sets of 6 CDRs (VH CDR1-3 and VL CDR1-3) of certain antibody embodiments are provided herein. Other sets of CDRs are contemplated and within the scope of the antibody embodiments provided herein.

In one aspect, provided herein is an antibody that binds to TRGV9. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region. In some embodiments, the TRGV9 antibody is a humanized antibody.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1, 2, and 3, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4, 5, and 6, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:7, 8, and 9, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:10, 11, and 12, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:13, 14, and 15, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:16, 17, and 18, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:19, 20, and 21, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:22, 23, and 24, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:25, 26, and 27, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:28, 29, and 30, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:31; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:32. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:31. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:32. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:31, and a VL having an amino acid sequence of SEQ ID NO:32. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:33. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:34. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:33, and a light chain having an amino acid sequence of SEQ ID NO:34. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:31. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:32. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:31, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:32. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:33. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:34. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:33, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:34.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:35, 36, and 37, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:38, 39, and 40, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:41, 42, and 43, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:44, 45, and 46, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:47, 48, and 49, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:50, 51, and 52, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:53, 54, and 55, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:56, 57, and 58, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:59, 60, and 61, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:62, 63, and 64, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:65; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:66. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:65. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:66. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:65, and a VL having an amino acid sequence of SEQ ID NO:66. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:67. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:68. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:67, and a light chain having an amino acid sequence of SEQ ID NO:68. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:65. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:66. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:65, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:66. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:67. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:68. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:67, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:68.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:69, 70, and 71, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:72, 73, and 74, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:75, 76, and 77, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:78, 79, and 80, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:81, 82, and 83, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:84, 85, and 86, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:87, 88, and 89, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:90, 91, and 92, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:93, 94, and 95, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:96, 97, and 98, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:99; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:100. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:99. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:100. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:99, and a VL having an amino acid sequence of SEQ ID NO:100. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:101. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:102. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:101, and a light chain having an amino acid sequence of SEQ ID NO:102. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:99. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:100. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:99, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:100. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:101. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:102. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:101, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:102.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:103, 104, and 105, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:106, 107, and 108, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:109, 110, and 111, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:112, 113, and 114, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:115, 116, and 117, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:118, 119, and 120, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:121, 122, and 123, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:124, 125, and 126, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:127, 128, and 129, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:130, 131, and 132, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:133; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:134. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:133. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:134. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:133, and a VL having an amino acid sequence of SEQ ID NO:134. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:135. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:136. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:135, and a light chain having an amino acid sequence of SEQ ID NO:136. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:133. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:134. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:133, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:134. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:135. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:136. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:135, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:136.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:137, 138, and 139, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:140, 141, and 142, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:143, 144, and 145, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:146, 147, and 148, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:149, 150, and 151, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:152, 153, and 154, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:155, 156, and 157, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:158, 159, and 160, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:161, 162, and 163, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:164, 165, and 166, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:167; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:168. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:167. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:168. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:167, and a VL having an amino acid sequence of SEQ ID NO:168. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:169. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:170. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:169, and a light chain having an amino acid sequence of SEQ ID NO:170. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:167. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:168. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:167, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:168. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:169. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:170. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:169, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:170.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:171, 172, and 173, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:174, 175, and 176, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:177, 178, and 179, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:180, 181, and 182, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:183, 184, and 185, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:186, 187, and 188, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:189, 190, and 191, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:192, 193, and 194, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:195, 196, and 197, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:198, 199, and 200, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:201; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:202. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:201. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:202. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:201, and a VL having an amino acid sequence of SEQ ID NO:202. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:203. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:204. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:203, and a light chain having an amino acid sequence of SEQ ID NO:204. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:201. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:202. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:201, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:202. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:203. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:204. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:203, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:204.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:205, 206, and 207, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:208, 209, and 210, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:211, 212, and 213, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:214, 215, and 216, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:217, 218, and 219, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:220, 221, and 222, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:223, 224, and 225, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:226, 227, and 228, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:229, 230, and 231, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:232, 233, and 234, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:235; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:236. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:235. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:236. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:235, and a VL having an amino acid sequence of SEQ ID NO:236. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:237. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:238. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:237, and a light chain having an amino acid sequence of SEQ ID NO:238. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:235. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:236. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:235, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:236. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:237. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:238. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:237, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:238.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:239, 240, and 241, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:242, 243, and 244, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:245, 246, and 247, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:248, 249, and 250, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:251, 252, and 253, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:254, 255, and 256, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:257, 258, and 259, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:260, 261, and 262, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:263, 264, and 265, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:266, 267, and 268, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:269; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:270. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:269. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:270. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:269, and a VL having an amino acid sequence of SEQ ID NO:270. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:271. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:272. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:271, and a light chain having an amino acid sequence of SEQ ID NO:272. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:269. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:270. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:269, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:270. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:271. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:272. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:271, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:272.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:273, 274, and 275, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:276, 277, and 278, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:279, 280, and 281, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:282, 283, and 284, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:285, 286, and 287, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:288, 289, and 290, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:291, 292, and 293, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:294, 295, and 296, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:297, 298, and 299, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:300, 301, and 302, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:303; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:304. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:303. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:304. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:303, and a VL having an amino acid sequence of SEQ ID NO:304. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:305. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:306. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:305, and a light chain having an amino acid sequence of SEQ ID NO:306. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:303. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:304. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:303, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:304. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:305. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:306. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:305, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:306.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:307, 308, and 309, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:310, 311, and 312, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:313, 314, and 315, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:316, 317, and 318, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:319, 320, and 321, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:322, 323, and 324, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:325, 326, and 327, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:328, 329, and 330, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:331, 332, and 333, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:334, 335, and 336, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:337; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:338. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:337. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:338. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:337, and a VL having an amino acid sequence of SEQ ID NO:338. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:339. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:340. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:339, and a light chain having an amino acid sequence of SEQ ID NO:340. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:337. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:338. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:337, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:338. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:339. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:340. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:339, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:340.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:341, 342, and 343, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:344, 345, and 346, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:347, 348, and 349, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:350, 351, and 352, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:353, 354, and 355, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:356, 357, and 358, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:359, 360, and 361, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:362, 363, and 364, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:365, 366, and 367, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:368, 369, and 370, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:371; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:372. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:371. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:372. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:371, and a VL having an amino acid sequence of SEQ ID NO:372. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:373. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:374. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:373, and a light chain having an amino acid sequence of SEQ ID NO:374. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:371. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:372. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:371, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:372. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:373. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:374. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:373, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:374.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:375, 376, and 377, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:378, 379, and 380, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:381, 382, and 383, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:384, 385, and 386, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:387, 388, and 389, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:390, 391, and 392, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:393, 394, and 395, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:396, 397, and 398, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:399, 400, and 401, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:402, 403, and 404, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:405; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:406. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:405. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:406. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:405, and a VL having an amino acid sequence of SEQ ID NO:406. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:407. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:408. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:407, and a light chain having an amino acid sequence of SEQ ID NO:408. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:405. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:406. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:405, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:406. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:407. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:408. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:407, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:408.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:409, 410, and 411, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:412, 413, and 414, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:415, 416, and 417, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:418, 419, and 420, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:421, 422, and 423, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:424, 425, and 426, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:427, 428, and 429, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:430, 431, and 432, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:433, 434, and 435, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:436, 437, and 438, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:439; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:440. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:439. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:440. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:439, and a VL having an amino acid sequence of SEQ ID NO:440. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:441. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:442. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:441, and a light chain having an amino acid sequence of SEQ ID NO:442. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:439. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:440. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:439, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:440. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:441. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:442. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:441, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:442.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:443, 444, and 445, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:446, 447, and 448, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:449, 450, and 451, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:452, 453, and 454, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:455, 456, and 457, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:458, 459, and 460, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:461, 462, and 463, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:464, 465, and 466, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:467, 468, and 469, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:470, 471, and 472, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:473; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:474. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:473. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:474. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:473, and a VL having an amino acid sequence of SEQ ID NO:474. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:475. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:476. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:475, and a light chain having an amino acid sequence of SEQ ID NO:476. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:473. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:474. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:473, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:474. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:475. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:476. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:475, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:476.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:477, 478, and 479, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:480, 481, and 482, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:483, 484, and 485, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:486, 487, and 488, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:489, 490, and 491, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:492, 493, and 494, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:495, 496, and 497, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:498, 499, and 500, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:501, 502, and 503, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:504, 505, and 506, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:507; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:508. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:507. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:508. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:507, and a VL having an amino acid sequence of SEQ ID NO:508. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:509. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:510. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:509, and a light chain having an amino acid sequence of SEQ ID NO:510. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:507. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:508. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:507, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:508. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:509. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:510. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:509, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:510.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:511, 512, and 513, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:514, 515, and 516, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:517, 518, and 519, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:520, 521, and 522, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:523, 524, and 525, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:526, 527, and 528, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:529, 530, and 531, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:532, 533, and 534, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:535, 536, and 537, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:538, 539, and 540, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:541; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:542. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:541. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:542. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:541, and a VL having an amino acid sequence of SEQ ID NO:542. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:543. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:544. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:543, and a light chain having an amino acid sequence of SEQ ID NO:544. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:541. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:542. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:541, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:542. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:543. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:544. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:543, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:544.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:545, 546, and 547, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:548,549, and 550, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:551, 552, and 553, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:554, 555, and 556, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:557, 558, and 559, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:560, 561, and 562, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:563, 564, and 565, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:566, 567, and 568, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:569, 570, and 571, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:572, 573, and 574, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:575; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:576. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:575. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:576. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:575, and a VL having an amino acid sequence of SEQ ID NO:576. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:577. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:578. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:577, and a light chain having an amino acid sequence of SEQ ID NO:578. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:575. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:576. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:575, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:576. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:577. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:578. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:577, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:578.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:579, 580, and 581, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:582, 583, and 584, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:585, 586, and 587, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:588, 589, and 590, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:591, 592, and 593, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:594, 595, and 596, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:597, 598, and 599, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:600, 601, and 602, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:603, 604, and 605, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:606, 607, and 608, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:609; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:610. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:609. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:610. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:609, and a VL having an amino acid sequence of SEQ ID NO:610. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:611. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:612. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:611, and a light chain having an amino acid sequence of SEQ ID NO:612. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:609. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:610. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:609, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:610. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:611. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:612. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:611, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:612.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:613, 614, and 615, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:616, 617, and 618, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:619, 620, and 621, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:622, 523, and 624, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:625, 626, and 627, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:628, 629, and 630, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:631, 632, and 633, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:634, 635, and 636, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:637, 638, and 639, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:640, 641, and 642, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:643; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:644. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:643. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:644. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:643, and a VL having an amino acid sequence of SEQ ID NO:644. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:645. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:646. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:645, and a light chain having an amino acid sequence of SEQ ID NO:646. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:643. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:644. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:643, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:644. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:645. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:646. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:645, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:646.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:647, 648, and 649, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:650, 651, and 652, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:653, 654, and 655, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:656, 657, and 658, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:659, 660, and 661, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:662, 663, and 664, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:665, 666, and 667, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:668, 669, and 670, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:671, 672, and 673, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:674, 675, and 676, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:677; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:678. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:677. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:678. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:677, and a VL having an amino acid sequence of SEQ ID NO:678. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:679. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:680. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:679, and a light chain having an amino acid sequence of SEQ ID NO:680. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:677. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:678. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:677, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:678. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:679. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:680. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:679, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:680.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:681, 682, and 683, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:684, 685, and 686, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:687, 688, and 689, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:690, 691, and 692, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:693, 694, and 695, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:696, 697, and 698, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:699, 700, and 701, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:702, 703, and 704, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:705, 706, and 707, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:708, 709, and 710, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:711; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:712. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:711. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:712. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:711, and a VL having an amino acid sequence of SEQ ID NO:712. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:713. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:714. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:713, and a light chain having an amino acid sequence of SEQ ID NO:714. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:711. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:712. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:711, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:712. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:713. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:714. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:713, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:714.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:715, 716, and 717, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:718, 719, and 720, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:721, 722, and 723, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:724, 725, and 726, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:727, 728, and 729, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:730, 731, and 732, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:733, 734, and 735, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:736, 737, and 738, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:739, 740, and 741, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:742, 743, and 744, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:745; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:746. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:745. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:746. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:745, and a VL having an amino acid sequence of SEQ ID NO:746. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:747. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:748. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:747, and a light chain having an amino acid sequence of SEQ ID NO:748. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:745. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:746. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:745, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:746. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:747. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:748. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:747, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:748.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:749, 750, and 751, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:752, 753, and 754, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:755, 756, and 757, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:758, 759, and 760, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:761, 762, and 763, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:764, 765, and 766, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:767, 768, and 769, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:770, 771, and 772, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:773, 774, and 775, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:776, 777, and 778, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:779; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:780. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:779. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:780. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:779, and a VL having an amino acid sequence of SEQ ID NO:780. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:781. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:782. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:781, and a light chain having an amino acid sequence of SEQ ID NO:782. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:779. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:780. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:779, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:780. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:781. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:782. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:781, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:782.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:783, 784, and 785, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:786, 787, and 788, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:789, 790, and 791, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:792, 793, and 794, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:795, 796, and 797, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:798, 799, and 800, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:801, 802, and 803, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:804, 805, and 806, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:807, 808, and 809, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:810, 811, and 812, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:813; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:814. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:813. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:814. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:813, and a VL having an amino acid sequence of SEQ ID NO:814. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:815. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:816. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:815, and a light chain having an amino acid sequence of SEQ ID NO:816. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:813. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:814. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:813, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:814. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:815. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:816. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:815, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:816.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:817, 818, and 819, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:820, 821, and 822, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:823, 824, and 825, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:826, 827, and 828, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:829, 830, and 831, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:832, 833, and 834, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:835, 836, and 837, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:838, 839, and 840, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:841, 842, and 843, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:844, 845, and 846, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:847; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:848. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:847. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:848. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:847, and a VL having an amino acid sequence of SEQ ID NO:848. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:849. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:850. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:849, and a light chain having an amino acid sequence of SEQ ID NO:850. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:847. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:848. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:847, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:848. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:849. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:850. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:849, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:850.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:851, 852, and 853, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:854, 855, and 856, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:857, 858, and 859, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:860, 861, and 862, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:863, 864, and 865, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:866, 867, and 868, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:869, 870, and 871, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:872, 873, and 874, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:875, 876, and 877, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:878, 879, and 880, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:881; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:882. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:881. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:882. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:881, and a VL having an amino acid sequence of SEQ ID NO:882. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:883. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:884. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:883, and a light chain having an amino acid sequence of SEQ ID NO:884. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:881. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:882. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:881, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:882. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:883. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:884. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:883, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:884.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:885, 886, and 887, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:888, 889, and 890, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:891, 892, and 893, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:894, 895, and 896, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:897, 898, and 899, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:900, 901, and 902, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:903, 904, and 905, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:906, 907, and 908, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:909, 910, and 911, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:912, 913, and 914, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:915; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:916. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:915. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:916. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:915, and a VL having an amino acid sequence of SEQ ID NO:916. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:917. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:918. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:917, and a light chain having an amino acid sequence of SEQ ID NO:918. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:915. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:916. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:915, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:916. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:917. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:918. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:917, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:918.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:919, 920, and 921, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:922, 923, and 924, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:925, 926, and 927, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:928, 929, and 930, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:931, 932, and 933, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:934, 935, and 936, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:937, 938, and 939, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:940, 941, and 942, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:943, 944, and 945, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:946, 947, and 948, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:949; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:950. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:949. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:950. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:949, and a VL having an amino acid sequence of SEQ ID NO:950. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:951. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:952. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:951, and a light chain having an amino acid sequence of SEQ ID NO:952. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:949. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:950. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:949, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:950. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:951. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:952. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:951, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:952.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:953, 954, and 955, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:956, 957, and 958, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:959, 960, and 961, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:962, 963, and 964, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:965, 966, and 967, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:968, 969, and 970, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:971, 972, and 973, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:974, 975, and 976, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:977, 978, and 979, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:980, 981, and 982, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:983; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:984. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:983. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:984. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:983, and a VL having an amino acid sequence of SEQ ID NO:984. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:985. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:986. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:985, and a light chain having an amino acid sequence of SEQ ID NO:986. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:983. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:984. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:983, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:984. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:985. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:986. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:985, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:986.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:987, 988, and 989, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:990, 991, and 992, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:993, 994, and 995, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:996, 997, and 998, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:999, 1000, and 1001, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1002, 1003, and 1004, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1005, 1006, and 1007, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1008, 1009, and 1010, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1011, 1012, and 1013, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1014, 1015, and 1016, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1017; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1018. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1017. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1018. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1017, and a VL having an amino acid sequence of SEQ ID NO:1018. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1019. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1020. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1019, and a light chain having an amino acid sequence of SEQ ID NO:1020. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1017. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1018. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1017, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1018. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1019. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1020. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1019, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1020.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1021, 1022, and 1023, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1024, 1025, and 1026, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1027, 1028, and 1029, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1030, 1031, and 1032, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1033, 1034, and 1035, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1036, 1037, and 1038, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1039, 1040, and 1041, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1042, 1043, and 1044, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1045, 1046, and 1047, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1048, 1049, and 1050, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1051; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1052. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1051. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1052. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1051, and a VL having an amino acid sequence of SEQ ID NO:1052. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1053. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1054. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1053, and a light chain having an amino acid sequence of SEQ ID NO:1054. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1051. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1052. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1051, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1052. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1053. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1054. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1053, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1054.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1055, 1056, and 1057, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1058, 1059, and 1060, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1061, 1062, and 1063, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1064, 1065, and 1066, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1067, 1068, and 1069, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1070, 1071, and 1072, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1073, 1074, and 1075, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1076, 1077, and 1078, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1079, 1080, and 1081, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1082, 1083, and 1084, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1085; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1086. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1085. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1086. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1085, and a VL having an amino acid sequence of SEQ ID NO:1086. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1087. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1088. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1087, and a light chain having an amino acid sequence of SEQ ID NO:1088. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1085. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1086. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1085, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1086. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1087. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1088. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1087, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1088.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1089, 1090, and 1091, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1092, 1093, and 1094, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1095, 1096, and 1097, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1098, 1099, and 1100, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1101, 1102, and 1103, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1104, 1105, and 1106, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1107, 1108, and 1109, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1110, 1111, and 1112, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1113, 1114, and 1115, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1116, 1117, and 1118, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1119; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1120. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1119. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1120. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1119, and a VL having an amino acid sequence of SEQ ID NO:1120. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1121. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1122. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1121, and a light chain having an amino acid sequence of SEQ ID NO:1122. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1119. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1120. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1119, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1120. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1121. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1122. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1121, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1122.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1123, 1124, and 1125, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1126, 1127, and 1128, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1129, 1130, and 1131, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1132, 1133, and 1134, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1135, 1136, and 1137, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1138, 1139, and 1140, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1141, 1142, and 1143, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1144, 1145, and 1146, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1147, 1148, and 1149, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1150, 1151, and 1152, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1153; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1154. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1153. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1154. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1153, and a VL having an amino acid sequence of SEQ ID NO:1154. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1155. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1156. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1155, and a light chain having an amino acid sequence of SEQ ID NO:1156. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1153. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1154. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1153, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1154. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1155. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1156. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1155, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1156.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1157, 1158, and 1159, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1160, 1161, and 1162, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1163, 1164, and 1165, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1166, 1167, and 1168, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1169, 1170, and 1171, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1172, 1173, and 1174, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1175, 1176, and 1177, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1178, 1179, and 1180, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1181, 1182, and 1183, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1184, 1185, and 1186, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1187; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1188. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1187. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1188. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1187, and a VL having an amino acid sequence of SEQ ID NO:1188. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1189. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1190. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1189, and a light chain having an amino acid sequence of SEQ ID NO:1190. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1187. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1188. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1187, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1188. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1189. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1190. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1189, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1190.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1191, 1192, and 1193, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1194, 1195, and 1196, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1197, 1198, and 1199, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1200, 1201, and 1202, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1203, 1204, and 1205, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1206, 1207, and 1208, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1209, 1210, and 1211, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1212, 1213, and 1214, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1215, 1216, and 1217, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1218, 1219, and 1220, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1221; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1222. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1221. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1222. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1221, and a VL having an amino acid sequence of SEQ ID NO:1222. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1223. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1224. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1223, and a light chain having an amino acid sequence of SEQ ID NO:1224. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1221. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1222. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1221, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1222. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1223. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1224. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1223, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1224.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1225, 1226, and 1227, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1228, 1229, and 1230, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1231, 1232, and 1233, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1234, 1235, and 1236, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1237, 1238, and 1239, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1240, 1241, and 1242, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1243, 1244, and 1245, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1246, 1247, and 1248, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1249, 1250, and 1251, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1252, 1253, and 1254, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1255; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1256. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1255. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1256. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1255, and a VL having an amino acid sequence of SEQ ID NO:1256. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1257. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1258. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1257, and a light chain having an amino acid sequence of SEQ ID NO:1258. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1255. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1256. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1255, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1256. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1257. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1258. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1257, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1258.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1259, 1260, and 1261, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1262, 1263, and 1264, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1265, 1266, and 1267, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1268, 1269, and 1270, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1271, 1272, and 1273, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1274, 1275, and 1276, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1277, 1278, and 1279, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1280, 1281, and 1282, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1283, 1284, and 1285, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1286, 1287, and 1288, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1289; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1290. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1289. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1290. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1289, and a VL having an amino acid sequence of SEQ ID NO:1290. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1291. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1292. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1291, and a light chain having an amino acid sequence of SEQ ID NO:1292. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1289. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1290. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1289, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1290. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1291. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1292. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1291, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1292.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1293, 1294, and 1295, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1296, 1297, and 1298, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1299, 1300, and 1301, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1302, 1303, and 1304, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1305, 1306, and 1307, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1308, 1309, and 1310, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1311, 1312, and 1313, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1314, 1315, and 1316, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1317, 1318, and 1319, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1320, 1321, and 1322, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1323; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1324. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1323. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1324. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1323, and a VL having an amino acid sequence of SEQ ID NO:1324. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1325. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1326. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1325, and a light chain having an amino acid sequence of SEQ ID NO:1326. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1323. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1324. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1323, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1324. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1325. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1326. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1325, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1326.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1327, 1328, and 1329, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1330, 1331, and 1332, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1333, 1334, and 1335, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1336, 1337, and 1338, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1339, 1340, and 1341, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1342, 1343, and 1344, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1345, 1346, and 1347, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1348, 1349, and 1350, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1351, 1352, and 1353, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1354, 1355, and 1356, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1357; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1358. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1357. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1358. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1357, and a VL having an amino acid sequence of SEQ ID NO:1358. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1359. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1360. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1359, and a light chain having an amino acid sequence of SEQ ID NO:1360. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1357. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1358. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1357, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1358. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1359. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1360. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1359, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1360.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1361, 1362, and 1363, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1364, 1365, and 1366, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1367, 1368, and 1369, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1370, 1371, and 1372, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1373, 1374, and 1375, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1376, 1377, and 1378, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1379, 1380, and 1381, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1382, 1383, and 1384, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1385, 1386, and 1387, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1388, 1389, and 1390, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1391; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1392. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1391. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1392. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1391, and a VL having an amino acid sequence of SEQ ID NO:1392. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1393. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1394. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1393, and a light chain having an amino acid sequence of SEQ ID NO:1394. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1391. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1392. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1391, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1392. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1393. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1394. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1393, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1394.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1395, 1396, and 1397, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1398, 1399, and 1400, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1401, 1402, and 1403, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1404, 1405, and 1406, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1407, 1408, and 1409, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1410, 1411, and 1412, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1413, 1414, and 1415, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1416, 1417, and 1418, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1419, 1420, and 1421, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1422, 1423, and 1424, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1425; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1426. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1425. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1426. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1425, and a VL having an amino acid sequence of SEQ ID NO:1426. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1427. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1428. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1427, and a light chain having an amino acid sequence of SEQ ID NO:1428. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1425. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1426. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1425, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1426. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1427. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1428. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1427, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1428.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1429, 1430, and 1431, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1432, 1433, and 1434, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1435, 1436, and 1437, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1438, 1439, and 1440, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1441, 1442, and 1443, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1444, 1445, and 1446, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1447, 1448, and 1449, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1450, 1451, and 1452, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1453, 1454, and 1455, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1456, 1457, and 1458, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1459; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1460. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1459. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1460. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1459, and a VL having an amino acid sequence of SEQ ID NO:1460. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1461. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1462. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1461, and a light chain having an amino acid sequence of SEQ ID NO:1462. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1459. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1460. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1459, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1460. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1461. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1462. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1461, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1462.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1463, 1464, and 1465, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1466, 1467, and 1468, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1469, 1470, and 1471, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1472, 1473, and 1474, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1475, 1476, and 1477, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1478, 1479, and 1480, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1481, 1482, and 1483, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1484, 1485, and 1486, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1487, 1488, and 1489, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1490, 1491, and 1492, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1493; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1494. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1493. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1494. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1493, and a VL having an amino acid sequence of SEQ ID NO:1494. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1495. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1496. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1495, and a light chain having an amino acid sequence of SEQ ID NO:1496. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1493. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1494. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1493, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1494. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1495. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1496. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1495, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1496.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1497, 1498, and 1499, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1500, 1501, and 1502, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1503, 1504, and 1505, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1506, 1507, and 1508, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1509, 1510, and 1511, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1512, 1513, and 1514, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1515, 1516, and 1517, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1518, 1519, and 1520, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1521, 1522, and 1523, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1524, 1525, and 1526, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1527; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1528. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1527. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1528. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1527, and a VL having an amino acid sequence of SEQ ID NO:1528. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1529. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1530. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1529, and a light chain having an amino acid sequence of SEQ ID NO:1530. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1527. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1528. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1527, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1528. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1529. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1530. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1529, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1530.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1531, 1532, and 1533, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1534, 1535, and 1536, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1537, 1538, and 1539, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1540, 1541, and 1542, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1543, 1544, and 1545, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1546, 1547, and 1548, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1549, 1550, and 1551, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1552, 1553, and 1554, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1555, 1556, and 1557, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1558, 1559, and 1560, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1561; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1562. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1561. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1562. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1561, and a VL having an amino acid sequence of SEQ ID NO:1562. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1563. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1564. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1563, and a light chain having an amino acid sequence of SEQ ID NO:1564. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1561. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1562. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1561, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1562. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1563. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1564. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1563, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1564.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1565, 1566, and 1567, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1568, 1569, and 1570, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1571, 1572, and 1573, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1574, 1575, and 1576, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1577, 1578, and 1579, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1580, 1581, and 1582, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1583, 1584, and 1585, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1586, 1587, and 1588, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1589, 1590, and 1591, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1592, 1593, and 1594, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1595; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1596. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1595. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1596. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1595, and a VL having an amino acid sequence of SEQ ID NO:1596. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1597. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1598. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1597, and a light chain having an amino acid sequence of SEQ ID NO:1598. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1595. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1596. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1595, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1596. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1597. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1598. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1597, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1598.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1599, 1600, and 1601, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1602, 1603, and 1604, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1605, 1606, and 1607, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1608, 1609, and 1610, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1611, 1612, and 1613, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1614, 1615, and 1616, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1617, 1618, and 1619, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1620, 1621, and 1622, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1623, 1624, and 1625, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1626, 1627, and 1628, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1629; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1630. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1629. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1630. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1629, and a VL having an amino acid sequence of SEQ ID NO:1630. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1631. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1632. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1631, and a light chain having an amino acid sequence of SEQ ID NO:1632. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1629. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1630. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1629, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1630. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1631. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1632. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1631, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1632.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1633, 1634, and 1635, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1636, 1637, and 1638, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1639, 1640, and 1641, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1642, 1643, and 1644, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1645, 1646, and 1647, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1648, 1649, and 1650, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1651, 1652, and 1653, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1654, 1655, and 1656, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1657, 1658, and 1659, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1660, 1661, and 1662, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1663; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1664. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1663. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1664. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1663, and a VL having an amino acid sequence of SEQ ID NO:1664. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1665. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1666. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1665, and a light chain having an amino acid sequence of SEQ ID NO:1666. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1663. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1664. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1663, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1664. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1665. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1666. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1665, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1666.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1667, 1668, and 1669, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1670, 1671, and 1672, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1673, 1674, and 1675, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1676, 1677, and 1678, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1679, 1680, and 1681, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1682, 1683, and 1684, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1685, 1686, and 1687, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1688, 1689, and 1690, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1691, 1692, and 1693, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1694, 1695, and 1696, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1697; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1698. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1697. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1698. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1697, and a VL having an amino acid sequence of SEQ ID NO:1698. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1699. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1700. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1699, and a light chain having an amino acid sequence of SEQ ID NO:1700. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1697. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1698. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1697, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1698. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1699. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1700. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1699, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1700.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1701, 1702, and 1703, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1704, 1705, and 1706, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1707, 1708, and 1709, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1710, 1711, and 1712, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1713, 1714, and 1715, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1716, 1717, and 1718, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1719, 1720, and 1721, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1722, 1723, and 1724, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1725, 1726, and 1727, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1728, 1729, and 1730, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1731; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1732. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1731. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1732. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1731, and a VL having an amino acid sequence of SEQ ID NO:1732. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1733. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1734. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1733, and a light chain having an amino acid sequence of SEQ ID NO:1734. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1731. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1732. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1731, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1732. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1733. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1734. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1733, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1734.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1735, 1736, and 1737, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1738, 1739, and 1740, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1741, 1742, and 1743, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1744, 1745, and 1746, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1747, 1748, and 1749, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1750, 1751, and 1752, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1753, 1754, and 1755, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1756, 1757, and 1758, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1759, 1760, and 1761, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1762, 1763, and 1764, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1765; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1766. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1765. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1766. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1765, and a VL having an amino acid sequence of SEQ ID NO:1766. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1767. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1768. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1767, and a light chain having an amino acid sequence of SEQ ID NO:1768. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1765. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1766. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1765, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1766. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1767. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1768. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1767, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1768.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1769, 1770, and 1771, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1772, 1773, and 1774, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1775, 1776, and 1777, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1778, 1779, and 1780, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1781, 1782, and 1783, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1784, 1785, and 1786, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1787, 1788, and 1789, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1790, 1791, and 1792, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1793, 1794, and 1795, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1796, 1797, and 1798, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1799; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1800. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1799. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1800. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1799, and a VL having an amino acid sequence of SEQ ID NO:1800. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1801. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1802. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1801, and a light chain having an amino acid sequence of SEQ ID NO:1802. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1799. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1800. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1799, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1800. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1801. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1802. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1801, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1802.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1803, 1804, and 1805, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1806, 1807, and 1808, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1809, 1810, and 1811, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1812, 1813, and 1814, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1815, 1816, and 1817, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1818, 1819, and 1820, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1821, 1822, and 1823, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1824, 1825, and 1826, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1827, 1828, and 1829, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1830, 1831, and 1832, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1833; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1834. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1833. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1834. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1833, and a VL having an amino acid sequence of SEQ ID NO:1834. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1835. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1836. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1835, and a light chain having an amino acid sequence of SEQ ID NO:1836. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1833. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1834. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1833, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1834. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1835. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1836. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1835, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1836.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1837, 1838, and 1839, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1840, 1841, and 1842, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1843, 1844, and 1845, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1846, 1847, and 1848, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1849, 1850, and 1851, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1852, 1853, and 1854, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1855, 1856, and 1857, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1858, 1859, and 1860, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1861, 1862, and 1863, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1864, 1865, and 1866, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1867; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1868. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1867. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1868. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1867, and a VL having an amino acid sequence of SEQ ID NO:1868. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1869. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1870. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1869, and a light chain having an amino acid sequence of SEQ ID NO:1870. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1867. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1868. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1867, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1868. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1869. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1870. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1869, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1870.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1871, 1872, and 1873, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1874, 1875, and 1876, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1877, 1878, and 1879, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1880, 1881, and 1882, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1883, 1884, and 1885, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1886, 1887, and 1888, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1889, 1890, and 1891, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1892, 1893, and 1894, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1895, 1896, and 1897, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1898, 1899, and 1900, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1901; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1902. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1901. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1902. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1901, and a VL having an amino acid sequence of SEQ ID NO:1902. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1903. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1904. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1903, and a light chain having an amino acid sequence of SEQ ID NO:1904. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1901. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1902. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1901, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1902. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1903. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1904. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1903, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1904.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1905, 1906, and 1907, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1908, 1909, and 1910, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1911, 1912, and 1913, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1914, 1915, and 1916, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1917, 1918, and 1919, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1920, 1921, and 1922, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1923, 1924, and 1925, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1926, 1927, and 1928, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1929, 1930, and 1931, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1932, 1933, and 1934, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1935; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1936. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1935. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1936. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1935, and a VL having an amino acid sequence of SEQ ID NO:1936. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1937. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1938. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1937, and a light chain having an amino acid sequence of SEQ ID NO:1938. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1935. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1936. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1935, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1936. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1937. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1938. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1937, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1938.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1939, 1940, and 1941, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1942, 1943, and 1944, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1945, 1946, and 1947, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1948, 1949, and 1950, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1951, 1952, and 1953, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1954, 1955, and 1956, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1957, 1958, and 1959, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1960, 1961, and 1962, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1963, 1964, and 1965, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1966, 1967, and 1968, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1969; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:1970. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1969. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:1970. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:1969, and a VL having an amino acid sequence of SEQ ID NO:1970. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1971. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:1972. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:1971, and a light chain having an amino acid sequence of SEQ ID NO:1972. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1969. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1970. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1969, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1970. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1971. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1972. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1971, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:1972.

In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1973, 1974, and 1975, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1976, 1977, and 1978, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1979, 1980, and 1981, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1982, 1983, and 1984, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1985, 1986, and 1987, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1988, 1989, and 1990, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1991, 1992, and 1993, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:1994, 1995, and 1996, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:1997, 1998, and 1999, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2000, 2001, and 2002, respectively. In one aspect, provided herein is an antibody that binds TRGV9, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2003; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2004. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:2003. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence of SEQ ID NO:2004. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence of SEQ ID NO:2003, and a VL having an amino acid sequence of SEQ ID NO:2004. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2005. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence of SEQ ID NO:2006. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2005, and a light chain having an amino acid sequence of SEQ ID NO:2006. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2003. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2004. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2003, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2004. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2005. In one aspect, provided herein is an antibody that binds TRGV9, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2006. In one aspect, provided herein is an antibody that binds TRGV9, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2005, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2006.

In one aspect, provided herein is an antibody that binds TRGV9. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:31. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:32. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:31; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:32. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:65. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:66. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:65; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:66. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:99. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:100. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:99; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:100. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:133. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:134. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:133; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:134. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:167. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:168. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:167; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:168. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:201. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:202. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:201; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:202. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:235. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:236. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:235; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:236. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:269. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:270. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:269; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:270. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:303. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:304. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:303; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:304. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:337. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:338. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:337; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:338. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:371. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:372. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:371; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:372. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:405. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:406. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:405; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:406. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:439. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:440. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:439; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:440. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:473. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:474. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:473; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:474. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:507. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:508. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:507; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:508. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:541. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:542. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:541; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:542. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:575. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:576. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:575; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:576. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:609. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:610. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:609; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:610. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:643. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:644. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:643; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:644. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:677. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:678. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:677; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:678. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:711. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:712. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:711; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:712. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:745. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:746. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:745; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:746. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:779. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:780. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:779; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:780. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:813. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:814. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:813; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:814. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:847. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:848. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:847; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:848. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:881. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:882. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:881; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:882. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:915. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:916. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:915; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:916. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:949. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:950. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:949; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:950. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:983. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:984. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:983; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:984. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1017. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1018. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1017; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1018. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1051. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1052. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1051; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1052. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1085. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1086. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1085; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1086. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1119. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1120. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1119; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1120. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1153. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1154. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1153; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1154. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1187. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1188. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1187; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1188. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1221. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1222. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1221; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1222. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1255. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1256. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1255; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1256. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1289. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1290. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1289; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1290. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1323. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1324. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1323; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1324. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1357. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1358. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1357; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1358. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1391. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1392. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1391; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1392. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1425. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1426. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1425; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1426. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1459. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1460. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1459; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1460. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1493. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1494. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1493; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1494. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1527. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1528. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1527; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1528. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1561. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1562. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1561; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1562. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1595. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1596. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1595; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1596. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1629. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1630. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1629; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1630. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1663. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1664. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1663; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1664. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1697. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1698. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1697; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1698. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1731. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1732. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1731; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1732. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1765. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1766. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1765; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1766. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1799. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1800. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1799; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1800. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1833. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1834. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1833; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1834. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1867. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1868. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1867; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1868. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1901. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1902. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1901; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1902. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1935. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1936. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1935; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1936. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1969. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1970. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1969; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1970. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2003. In one embodiment, the TRGV9 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2004. In one embodiment, the TRGV9 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2003; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2004. In some embodiments, the TRGV9 antibody is a multispecific antibody. In some embodiments, the TRGV9 antibody is a bispecific antibody. In some embodiments, the TRGV9 antibody is a trispecific antibody. In some embodiments, the TRGV9 antibody is a quadraspecific antibody.

In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:25, wherein the third amino acid is A or T; a VH CDR2 having an amino acid sequence of SEQ ID NO:26, wherein the second amino acid is G or S, the fourth amino acid is S or T, the sixth amino acid is D or S; and a VH CDR3 having an amino acid sequence of SEQ ID NO:27, wherein the first amino acid is A, G, or V, the second amino acid is K, R, or T, the fourth amino acid is D, H, or G, the fifth amino acid is D, E, or V, the sixth amino acid is F, L, or Y, the eighth amino acid is A, G, P, or V, the ninth amino acid is F or L, the third amino acid is I of V. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:28, wherein the third amino acid is I or V, the fourth amino acid is R or S; a VL CDR2 having an amino acid sequence of SEQ ID NO:29, wherein the first amino acid is A, P or S; and a VL CDR3 having an amino acid sequence of SEQ ID NO:30, wherein the third amino acid is F or Y. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:25, wherein the third amino acid is A or T; a VH CDR2 having an amino acid sequence of SEQ ID NO:26, wherein the second amino acid is G or S, the fourth amino acid is S or T, the sixth amino acid is D or S; and a VH CDR3 having an amino acid sequence of SEQ ID NO:27, wherein the first amino acid is A, G, or V, the second amino acid is K, R, or T, the fourth amino acid is D, H, or G, the fifth amino acid is D, E, or V, the sixth amino acid is F, L, or Y, the eighth amino acid is A, G, P, or V, the ninth amino acid is F or L, the third amino acid is I of V; a VL CDR1 having an amino acid sequence of SEQ ID NO:28, wherein the third amino acid is I or V, the fourth amino acid is R or S; a VL CDR2 having an amino acid sequence of SEQ ID NO:29, wherein the first amino acid is A, P or S; and a VL CDR3 having an amino acid sequence of SEQ ID NO:30, wherein the third amino acid is F or Y.

In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:93; a VH CDR2 having an amino acid sequence of SEQ ID NO:94; a VH CDR3 having an amino acid sequence of SEQ ID NO:95. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:96; a VL CDR2 having an amino acid sequence of SEQ ID NO:97; and a VL CDR3 having an amino acid sequence of SEQ ID NO:98, wherein the third amino acid is A or Y, the fourth is N or S, the sixth is F or W, and the eighth is R or W. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:93; a VH CDR2 having an amino acid sequence of SEQ ID NO:94; a VH CDR3 having an amino acid sequence of SEQ ID NO:95; a VL CDR1 having an amino acid sequence of SEQ ID NO:96; a VL CDR2 having an amino acid sequence of SEQ ID NO:97; and a VL CDR3 having an amino acid sequence of SEQ ID NO:98, wherein the third amino acid is A or Y, the fourth is N or S, the sixth is F or W, and the eighth is R or W.

In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:127, wherein the first amino acid if G or R, the fourth amino acid is F or L, the fifth amino acid if R or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:128, wherein the second amino acid is S or T, the third amino acid is S or T, the fourth amino acid is S or T, the sixth amino acid is G, S, or Y; a VH CDR3 having an amino acid sequence of SEQ ID NO:129, wherein the fourth amino acid is L or R, the sixth amino acid if I or V, the seventh amino acid A, G, or R, the eighth amino acid is G or B, the ninth amino acid is A, T, or V, the tenth amino acid is D or G, the eleventh amino acid is D or Y, the sixteenth amino acid is L or M. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:130; a VL CDR2 having an amino acid sequence of SEQ ID NO:131; and a VL CDR3 having an amino acid sequence of SEQ ID NO:132. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:127, wherein the first amino acid if G or R, the fourth amino acid is F or L, the fifth amino acid if R or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:128, wherein the second amino acid is S or T, the third amino acid is S or T, the fourth amino acid is S or T, the sixth amino acid is G, S, or Y; a VH CDR3 having an amino acid sequence of SEQ ID NO:129, wherein the fourth amino acid is L or R, the sixth amino acid if I or V, the seventh amino acid A, G, or R, the eighth amino acid is G or B, the ninth amino acid is A, T, or V, the tenth amino acid is D or G, the eleventh amino acid is D or Y, the sixteenth amino acid is L or M; a VL CDR1 having an amino acid sequence of SEQ ID NO:130; a VL CDR2 having an amino acid sequence of SEQ ID NO:131; and a VL CDR3 having an amino acid sequence of SEQ ID NO:132.

In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:297, wherein the fifth amino acid is N or S, the sixth amino acid is N or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:298; a VH CDR3 having an amino acid sequence of SEQ ID NO:299, wherein the fourth amino acid is R or V, the sixth amino acid is I or V, the seventh amino acid is G or T, the eighth amino acid is G or T, the twelfth amino acid is S or Y, the fourteenth amino acid is A or G. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:300, wherein the fourth amino acid is A or S; a VL CDR2 having an amino acid sequence of SEQ ID NO:301 and a VL CDR3 having an amino acid sequence of SEQ ID NO:302. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:297, wherein the fifth amino acid is N or S, the sixth amino acid is N or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:298; a VH CDR3 having an amino acid sequence of SEQ ID NO:299, wherein the fourth amino acid is R or V, the sixth amino acid is I or V, the seventh amino acid is G or T, the eighth amino acid is G or T, the twelfth amino acid is S or Y, the fourteenth amino acid is A or G; a VL CDR1 having an amino acid sequence of SEQ ID NO:300, wherein the fourth amino acid is A or S; a VL CDR2 having an amino acid sequence of SEQ ID NO:301 and a VL CDR3 having an amino acid sequence of SEQ ID NO:302.

In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:569; a VH CDR2 having an amino acid sequence of SEQ ID NO:570; a VH CDR3 having an amino acid sequence of SEQ ID NO:571. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:572, wherein the second amino acid is G or N, the third amino acid is I or V, the fourth amino acid is A or S, the fifth amino acid is S or there is no amino acid added to the fifth position and sequence continues to the sixth position; a VL CDR2 having an amino acid sequence of SEQ ID NO:573, wherein the first amino acid is A or G, the third amino acid is C or S; and a VL CDR3 having an amino acid sequence of SEQ ID NO:574, wherein the second amino acid is K or Q, the fourth amino acid is G or N, the sixth amino acid is A or S, the ninth amino acid is Y or W. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:569; a VH CDR2 having an amino acid sequence of SEQ ID NO:570; a VH CDR3 having an amino acid sequence of SEQ ID NO:571; a VL CDR1 having an amino acid sequence of SEQ ID NO:572, wherein the second amino acid is G or N, the third amino acid is I or V, the fourth amino acid is A or S, the fifth amino acid is S or there is no amino acid added to the fifth position and sequence continues to the sixth position; a VL CDR2 having an amino acid sequence of SEQ ID NO:573, wherein the first amino acid is A or G, the third amino acid is C or S; and a VL CDR3 having an amino acid sequence of SEQ ID NO:574, wherein the second amino acid is K or Q, the fourth amino acid is G or N, the sixth amino acid is A or S, the ninth amino acid is Y or W.

In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:739; a VH CDR2 having an amino acid sequence of SEQ ID NO:740; a VH CDR3 having an amino acid sequence of SEQ ID NO:741, wherein the third amino acid is D or E, the fourth amino acid is I or L, the sixth amino acid I or V, the eleventh amino acid is M or Y, the twelfth amino acid is D or Y, the thirteenth amino acid is Q or Y, the fourteenth amino acid is D or Y. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:742, wherein the third amino acid is F or V, the sixth amino acid is N or S; a VL CDR2 having an amino acid sequence of SEQ ID NO:743; and a VL CDR3 having an amino acid sequence of SEQ ID NO:744. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:739; a VH CDR2 having an amino acid sequence of SEQ ID NO:740; a VH CDR3 having an amino acid sequence of SEQ ID NO:741, wherein the third amino acid is D or E, the fourth amino acid is I or L, the sixth amino acid I or V, the eleventh amino acid is M or Y, the twelfth amino acid is D or Y, the thirteenth amino acid is Q or Y, the fourteenth amino acid is D or Y; a VL CDR1 having an amino acid sequence of SEQ ID NO:742, wherein the third amino acid is F or V, the sixth amino acid is N or S; a VL CDR2 having an amino acid sequence of SEQ ID NO:743; and a VL CDR3 having an amino acid sequence of SEQ ID NO:744.

In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:1181, wherein the fifth amino acid is G or S, the sixth amino acid is A or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:1182, wherein the third amino acid is S or T; a VH CDR3 having an amino acid sequence of SEQ ID NO:1183, wherein the sixth amino acid is I or M, the seventh amino acid is L or V, the eighth amino acid is A or S, the ninth amino acid is P or T, the eleventh amino acid is K or R. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:1184, wherein the fifth amino acid is D or N, the eighth amino acid is A or D; a VL CDR2 having an amino acid sequence of SEQ ID NO:1185; and a VL CDR3 having an amino acid sequence of SEQ ID NO:1186. In one aspect, provided herein is an antibody that binds TRGV9, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:1181, wherein the fifth amino acid is G or S, the sixth amino acid is A or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:1182, wherein the third amino acid is S or T; a VH CDR3 having an amino acid sequence of SEQ ID NO:1183, wherein the sixth amino acid is I or M, the seventh amino acid is L or V, the eighth amino acid is A or S, the ninth amino acid is P or T, the eleventh amino acid is K or R; a VL CDR1 having an amino acid sequence of SEQ ID NO:1184, wherein the fifth amino acid is D or N, the eighth amino acid is A or D; a VL CDR2 having an amino acid sequence of SEQ ID NO:1185; and a VL CDR3 having an amino acid sequence of SEQ ID NO:1186.

In one aspect, provided herein is an antibody that binds to TRDV2. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region. In some embodiments, the TRDV2 antibody is a humanized antibody.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2007, 2008, and 2009, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2010, 2011, and 2012, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2013, 2014, and 2015, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2016, 2017, and 2018, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2019, 2020, and 2021, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2022, 2023, and 2024, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2025, 2026, and 2027, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2028, 2029, and 2030, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2031, 2032, and 2033, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2034, 2035, and 2036, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2037; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2038. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2037. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2038. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2037, and a VL having an amino acid sequence of SEQ ID NO:2038. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2039. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2040. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2039, and a light chain having an amino acid sequence of SEQ ID NO:2040. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2037. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2038. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2037, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2038. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2039. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2040. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2039, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2040.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2041, 2042, and 2043, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2044, 2045, and 2046, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2047, 2048, and 2049, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2050, 2051, and 2052, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2053, 2054, and 2055, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2056, 2057, and 2058, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2059, 2060, and 2061, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2062, 2063, and 2064, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2065, 2066, and 2067, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2068, 2069, and 2070, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2071; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2072. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2071. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2072. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2071, and a VL having an amino acid sequence of SEQ ID NO:2072. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2073. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2074. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2073, and a light chain having an amino acid sequence of SEQ ID NO:2074. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2071. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2072. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2071, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2072. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2073. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2074. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2073, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2074.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2075, 2076, and 2077, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2078, 2079, and 2080, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2081, 2082, and 2083, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2084, 2085, and 2086, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2087, 2088, and 2089, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2090, 2091, and 2092, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2093, 2094, and 2095, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2096, 2097, and 2098, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2099, 2100, and 2101, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2102, 2103, and 2104, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2105; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2106. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2105. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2106. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2105, and a VL having an amino acid sequence of SEQ ID NO:2106. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2107. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2108. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2107, and a light chain having an amino acid sequence of SEQ ID NO:2108. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2105. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2106. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2105, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2106. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2107. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2108. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2107, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2108.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2109, 2110, and 2111, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2112, 2113, and 2114, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2115, 2116, and 2117, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2118, 2119, and 2120, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2121, 2122, and 2123, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2124, 2125, and 2126, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2127, 2128, and 2129, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2130, 2131, and 2132, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2133, 2134, and 2135, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2136, 2137, and 2138, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2139; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2140. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2139. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2140. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2139, and a VL having an amino acid sequence of SEQ ID NO:2140. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2141. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2142. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2141, and a light chain having an amino acid sequence of SEQ ID NO:2142. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2139. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2140. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2139, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2140. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2141. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2142. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2141, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2142.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2143, 2144, and 2145, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2146, 2147, and 2148, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2149, 2150, and 2151, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2152, 2153, and 2154, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2155, 2156, and 2157, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2158, 2159, and 2160, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2161, 2162, and 2163, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2164, 2165, and 2166, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2167, 2168, and 2169, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2170, 2171, and 2172, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2173; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2174. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2173. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2174. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2173, and a VL having an amino acid sequence of SEQ ID NO:2174. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2175. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2176. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2175, and a light chain having an amino acid sequence of SEQ ID NO:2176. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2173. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2174. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2173, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2174. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2175. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2176. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2175, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2176.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2177, 2178, and 2179, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2180, 2181, and 2182, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2183, 2184, and 2185, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2186, 2187, and 2188, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2189, 2190, and 2191, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2192, 2193, and 2194, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2195, 2196, and 2197, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2198, 2199, and 2200, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2201, 2202, and 2203, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2204, 2205, and 2206, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2207; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2208. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2207. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2208. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2207, and a VL having an amino acid sequence of SEQ ID NO:2208. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2209. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2210. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2209, and a light chain having an amino acid sequence of SEQ ID NO:2210. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2207. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2208. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2207, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2208. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2209. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2210. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2209, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2210.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2211, 2212, and 2213, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2214, 2215, and 2216, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2217, 2218, and 2219, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2220, 2221, and 2222, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2223, 2224, and 2225, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2226, 2227, and 2228, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2229, 2230, and 2231, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2232, 2233, and 2234, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2235, 2236, and 2237, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2238, 2239, and 2240, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2241; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2242. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2241. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2242. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2241, and a VL having an amino acid sequence of SEQ ID NO:2242. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2243. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2244. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2243, and a light chain having an amino acid sequence of SEQ ID NO:2244. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2241. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2242. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2241, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2242. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2243. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2244. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2243, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2244.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2245, 2246, and 2247, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2248, 2249, and 2250, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2251, 2252, and 2253, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2254, 2255, and 2256, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2257, 2258, and 2259, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2260, 2261, and 2262, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2263, 2264, and 2265, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2266, 2267, and 2268, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2269, 2270, and 2271, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2272, 2273, and 2274, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2275; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2276. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2275. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2276. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2275, and a VL having an amino acid sequence of SEQ ID NO:2276. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2277. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2278. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2277, and a light chain having an amino acid sequence of SEQ ID NO:2278. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2275. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2276. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2275, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2276. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2277. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2278. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2277, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2278.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2279, 2280, and 2281, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2282, 2283, and 2284, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2285, 2286, and 2287, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2288, 2289, and 2290, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2291, 2292, and 2293, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2294, 2295, and 2296, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2297, 2298, and 2299, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2300, 2301, and 2302, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2303, 2304, and 2305, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2306, 2307, and 2308, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2309; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2310. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2309. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2310. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2309, and a VL having an amino acid sequence of SEQ ID NO:2310. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2311. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2312. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2311, and a light chain having an amino acid sequence of SEQ ID NO:2312. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2309. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2310. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2309, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2310. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2311. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2312. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2311, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2312.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2313, 2314, and 2315, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2316, 2317, and 2318, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2319, 2320, and 2321, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2322, 2323, and 2324, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2325, 2326, and 2327, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2328, 2329, and 2330, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2331, 2332, and 2333, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2334, 2335, and 2336, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2337, 2338, and 2339, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2340, 2341, and 2342, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2343; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2344. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2343. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2344. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2343, and a VL having an amino acid sequence of SEQ ID NO:2344. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2345. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2346. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2345, and a light chain having an amino acid sequence of SEQ ID NO:2346. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2343. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2344. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2343, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2344. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2345. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2346. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2345, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2346.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2347, 2348, and 2349, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2350, 2351, and 2352, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2353, 2354, and 2355, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2356, 2357, and 2358, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2359, 2360, and 2361, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2362, 2363, and 2364, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2365, 2366, and 2367, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2368, 2369, and 2370, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2371, 2372, and 2373, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2374, 2375, and 2376, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2377; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2378. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2377. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2378. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2377, and a VL having an amino acid sequence of SEQ ID NO:2378. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2379. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2380. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2379, and a light chain having an amino acid sequence of SEQ ID NO:2380. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2377. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2378. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2377, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2378. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2379. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2380. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2379, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2380.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2381, 2382, and 2383, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2384, 2385, and 2386, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2387, 2388, and 2389, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2390, 2391, and 2392, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2393, 2394, and 2395, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2396, 2397, and 2398, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2399, 2400, and 2401, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2402, 2403, and 2404, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2405, 2406, and 2407, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2408, 2409, and 2410, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2411; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2412. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2411. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2412. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2411, and a VL having an amino acid sequence of SEQ ID NO:2412. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2413. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2414. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2413, and a light chain having an amino acid sequence of SEQ ID NO:2414. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2411. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2412. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2411, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2412. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2413. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2414. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2413, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2414.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2415, 2416, and 2417, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2418, 2419, and 2420, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2421, 2422, and 2423, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2424, 2425, and 2426, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2427, 2428, and 2429, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2430, 2431, and 2432, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2433, 2434, and 2435, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2436, 2437, and 2438, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2439, 2440, and 2441, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2442, 2443, and 2444, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2445; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2446. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2445. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2446. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2445, and a VL having an amino acid sequence of SEQ ID NO:2446. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2447. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2448. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2447, and a light chain having an amino acid sequence of SEQ ID NO:2448. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2445. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2446. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2445, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2446. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2447. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2448. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2447, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2448.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2449, 2450, and 2451, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2452, 2453, and 2454, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2455, 2456, and 2457, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2458, 2459, and 2460, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2461, 2462, and 2463, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2464, 2465, and 2466, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2467, 2468, and 2469, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2470, 2471, and 2472, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2473, 2474, and 2475, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2476, 2477, and 2478, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2479; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2480. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2479. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2480. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2479, and a VL having an amino acid sequence of SEQ ID NO:2480. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2481. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2482. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2481, and a light chain having an amino acid sequence of SEQ ID NO:2482. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2479. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2480. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2479, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2480. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2481. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2482. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2481, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2482.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2483, 2484, and 2485, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2486, 2487, and 2488, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2489, 2490, and 2491, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2492, 2493, and 2494, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2495, 2496, and 2497, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2498, 2499, and 2500, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2501, 2502, and 2503, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2504, 2505, and 2506, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2507, 2508, and 2509, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2510, 2511, and 2512, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2513; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2514. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2513. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2514. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2513, and a VL having an amino acid sequence of SEQ ID NO:2514. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2515. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2516. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2515, and a light chain having an amino acid sequence of SEQ ID NO:2516. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2513. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2514. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2513, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2514. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2515. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2516. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2515, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2516.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2517, 2518, and 2519, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2520, 2521, and 2522, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2523, 2524, and 2525, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2526, 2527, and 2528, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2529, 2530, and 2531, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2532, 2533, and 2534, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2535, 2536, and 2537, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2538, 2539, and 2540, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2541, 2542, and 2543, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2544, 2545, and 2546, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2547; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2548. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2547. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2548. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2547, and a VL having an amino acid sequence of SEQ ID NO:2548. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2549. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2550. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2549, and a light chain having an amino acid sequence of SEQ ID NO:2550. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2547. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2548. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2547, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2548. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2549. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2550. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2549, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2550.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2551, 2552, and 2553, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2554, 2555, and 2556, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2557, 2558, and 2559, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2560, 2561, and 2562, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2563, 2564, and 2565, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2566, 2567, and 2568, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2569, 2570, and 2571, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2572, 2573, and 2574, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2575, 2576, and 2577, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2578, 2579, and 2580, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2581; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2582. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2581. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2582. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2581, and a VL having an amino acid sequence of SEQ ID NO:2582. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2583. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2584. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2583, and a light chain having an amino acid sequence of SEQ ID NO:2584. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2581. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2582. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2581, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2582. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2583. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2584. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2583, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2584.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2585, 2586, and 2587, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2588, 2589, and 2590, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2591, 2592, and 2593, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2594, 2595, and 2596, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2597, 2598, and 2599, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2600, 2601, and 2602, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2603, 2604, and 2605, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2606, 2607, and 2608, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2609, 2610, and 2611, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2612, 2613, and 2614, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2615; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2616. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2615. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2616. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2615, and a VL having an amino acid sequence of SEQ ID NO:2616. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2617. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2618. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2617, and a light chain having an amino acid sequence of SEQ ID NO:2618. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2615. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2616. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2615, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2616. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2617. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2618. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2617, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2618.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2619, 2620, and 2621, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2622, 2623, and 2624, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2625, 2626, and 2627, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2628, 2629, and 2630, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2631, 2632, and 2633, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2634, 2635, and 2636, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2637, 2638, and 2639, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2640, 2641, and 2642, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2643, 2644, and 2645, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2646, 2647, and 2648, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2649; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2650. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2649. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2650. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2649, and a VL having an amino acid sequence of SEQ ID NO:2650. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2651. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2652. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2651, and a light chain having an amino acid sequence of SEQ ID NO:2652. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2649. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2650. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2649, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2650. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2651. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2652. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2651, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2652.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2653, 2654, and 2655, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2656, 2657, and 2658, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2659, 2660, and 2661, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2662, 2663, and 2664, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2665, 2666, and 2667, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2668, 2669, and 2670, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2671, 2672, and 2673, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2674, 2675, and 2676, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2677, 2678, and 2679, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2680, 2681, and 2682, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2683; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2684. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2683. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2684. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2683, and a VL having an amino acid sequence of SEQ ID NO:2684. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2685. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2686. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2685, and a light chain having an amino acid sequence of SEQ ID NO:2686. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2683. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2684. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2683, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2684. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2685. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2686. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2685, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:266.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2687, 2688, and 2689, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2690, 2691, and 2692, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2693, 2694, and 2695, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2696, 2697, and 2698, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2699, 2700, and 2701, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2702, 2703, and 2704, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2705, 2706, and 2707, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2708, 2709, and 2710, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2711, 2712, and 2713, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2714, 2715, and 2716, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2717; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2718. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2717. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2718. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2717, and a VL having an amino acid sequence of SEQ ID NO:2718. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2719. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2720. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2719, and a light chain having an amino acid sequence of SEQ ID NO:2720. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2717. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2718. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2717, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2718. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2719. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2720. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2719, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2720.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2721, 2722, and 2723, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2724, 2725, and 2726, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2727, 2728, and 2729, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2730, 2731, and 2732, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2733, 2734, and 2735, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2736, 2737, and 2738, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2739, 2740, and 2741, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2742, 2743, and 2744, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2745, 2746, and 2747, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2748, 2749, and 2750, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2751; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2752. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2751. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2752. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2751, and a VL having an amino acid sequence of SEQ ID NO:2752. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2753. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2754. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2753, and a light chain having an amino acid sequence of SEQ ID NO:2754. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2751. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2752. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2751, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2752. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2753. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2754. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2753, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2754.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2755, 2756, and 2757, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2758, 2759, and 2760, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2761, 2762, and 2763, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2764, 2765, and 2766, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2767, 2768, and 2769, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2770, 2771, and 2772, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2773, 2774, and 2775, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2776, 2777, and 2778, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2779, 2780, and 2781, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2782, 2783, and 2784, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2785; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2786. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2785. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2786. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2785, and a VL having an amino acid sequence of SEQ ID NO:2786. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2787. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2788. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2787, and a light chain having an amino acid sequence of SEQ ID NO:2788. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2785. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2786. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2785, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2786. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2787. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2788. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2787, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2788.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2789, 2790, and 2791, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2792, 2793, and 2794, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2795, 2796, and 2797, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2798, 2799, and 2800, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2801, 2802, and 2803, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2804, 2805, and 2806, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2807, 2808, and 2809, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2810, 2811, and 2812, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2813, 2814, and 2815, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2816, 2817, and 2818, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2819; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2820. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2819. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2820. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2819, and a VL having an amino acid sequence of SEQ ID NO:2820. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2821. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2822. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2821, and a light chain having an amino acid sequence of SEQ ID NO:2822. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2819. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2820. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2819, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2820. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2821. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2822. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2821, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2822.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2823, 2824, and 2825, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2826, 2827, and 2828, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2829, 2830, and 2831, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2832, 2833, and 2834, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2835, 2836, and 2837, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2838, 2839, and 2840, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2841, 2842, and 2843, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2844, 2845, and 2846, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2847, 2848, and 2849, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2850, 2851, and 2852, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2853; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2854. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2853. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2854. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2853, and a VL having an amino acid sequence of SEQ ID NO:2854. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2855. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2856. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2855, and a light chain having an amino acid sequence of SEQ ID NO:2856. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2853. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2854. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2853, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2854. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2855. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2856. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2855, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2856.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2857, 2858, and 2859, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2860, 2861, and 2862, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2863, 2864, and 2865, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2866, 2867, and 2868, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2869, 2870, and 2871, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2872, 2873, and 2874, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2875, 2876, and 2877, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2878, 2879, and 2880, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2881, 2882, and 2883, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2884, 2885, and 2886, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2887; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2888. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2887. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2888. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2887, and a VL having an amino acid sequence of SEQ ID NO:2888. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2889. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2890. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2889, and a light chain having an amino acid sequence of SEQ ID NO:2890. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2887. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2888. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2887, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2888. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2889. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2890. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2889, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2890.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2891, 2892, and 2893, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2894, 2895, and 2896, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2897, 2898, and 2899, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2900, 2901, and 2902, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2903, 2904, and 2905, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2906, 2907, and 2908, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2909, 2910, and 2911, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2912, 2913, and 2914, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2915, 2916, and 2917, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2918, 2919, and 2920, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2921; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2922. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2921. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2922. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2921, and a VL having an amino acid sequence of SEQ ID NO:2922. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2923. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2924. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2923, and a light chain having an amino acid sequence of SEQ ID NO:2924. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2921. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2922. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2921, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2922. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2923. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2924. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2923, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2924.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2925, 2926, and 2927, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2928, 2929, and 2930, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2931, 2932, and 2933, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2934, 2935, and 2936, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2937, 2938, and 2939, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2940, 2941, and 2942, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2943, 2944, and 2945, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2946, 2947, and 2948, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2949, 2950, and 2951, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2952, 2953, and 2954, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2955; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2956. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2955. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2956. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2955, and a VL having an amino acid sequence of SEQ ID NO:2956. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2957. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2958. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2957, and a light chain having an amino acid sequence of SEQ ID NO:2958. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2955. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2956. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2955, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2956. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2957. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2958. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2957, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2958.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2959, 2960, and 2961, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2962, 2963, and 2964, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2965, 2966, and 2967, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2968, 2969, and 2970, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2971, 2972, and 2973, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2974, 2975, and 2976, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2977, 2978, and 2979, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2980, 2981, and 2982, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2983, 2984, and 2985, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2986, 2987, and 2988, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2989; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:2990. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2989. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:2990. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:2989, and a VL having an amino acid sequence of SEQ ID NO:2990. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2991. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:2992. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:2991, and a light chain having an amino acid sequence of SEQ ID NO:2992. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2989. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2990. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2989, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2990. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2991. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2992. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2991, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:2992.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2993, 2994, and 2995, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:2996, 2997, and 2998, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:2999, 3000, and 3001, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3002, 3003, and 3004, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3005, 3006, and 3007, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3008, 3009, and 3010, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3011, 3012, and 3013, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3014, 3015, and 3016, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3017, 3018, and 3019, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3020, 3021, and 3022, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3023; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3024. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3023. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3024. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3023, and a VL having an amino acid sequence of SEQ ID NO:3024. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3025. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3026. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3025, and a light chain having an amino acid sequence of SEQ ID NO:3026. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3023. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3024. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3023, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3024. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3025. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3026. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3025, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3026.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3027, 3028, and 3029, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3030, 3031, and 3032, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3033, 3034, and 3035, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3036, 3037, and 3038, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3039, 3040, and 3041, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3042, 3043, and 3044, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3045, 3046, and 3047, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3048, 3049, and 3050, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3051, 3052, and 3053, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3054, 3055, and 3056, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3057; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3058. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3057. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3058. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3057, and a VL having an amino acid sequence of SEQ ID NO:3058. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3059. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3060. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3059, and a light chain having an amino acid sequence of SEQ ID NO:3060. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3057. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3058. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3057, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3058. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3059. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3060. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3059, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3060.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3061, 3062, and 3063, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3064, 3065, and 3066, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3067, 3068, and 3069, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3070, 3071, and 3072, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3073, 3074, and 3075, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3076, 3077, and 3078, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3079, 3080, and 3081, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3082, 3083, and 3084, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3085, 3086, and 3087, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3088, 3089, and 3090, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3091; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3092. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3091. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3092. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3091, and a VL having an amino acid sequence of SEQ ID NO:3092. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3093. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3094. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3093, and a light chain having an amino acid sequence of SEQ ID NO:3094. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3091. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3092. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3091, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3092. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3093. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3094. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3093, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3094.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3095, 3096, and 3097, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3098, 3099, and 3100, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3101, 3102, and 3103, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3104, 3105, and 3106, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3107, 3108, and 3109, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3110, 3111, and 3112, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3113, 3114, and 3115, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3116, 3117, and 3118, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3119, 3120, and 3121, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3122, 3123, and 3124, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3125; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3126. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3125. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3126. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3125, and a VL having an amino acid sequence of SEQ ID NO:3126. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3127. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3128. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3127, and a light chain having an amino acid sequence of SEQ ID NO:3128. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3125. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3126. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3125, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3126. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3127. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3128. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3127, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3128.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3129, 3130, and 3131, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3132, 3133, and 3134, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3135, 3136, and 3137, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3138, 3139, and 3140, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3141, 3142, and 3143, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3144, 3145, and 3146, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3147, 3148, and 3149, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3150, 3151, and 3152, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3153, 3154, and 3155, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3156, 3157, and 3158, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3159; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3160. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3159. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3160. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3159, and a VL having an amino acid sequence of SEQ ID NO:3160. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3161. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3162. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3161, and a light chain having an amino acid sequence of SEQ ID NO:3162. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3159. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3160. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3159, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3160. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3161. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3162. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3161, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3162.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3163, 3164, and 3165, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3166, 3167, and 3168, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3169, 3170, and 3171, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3172, 3173, and 3174, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3175, 3176, and 3177, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3178, 3179, and 3180, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3181, 3182, and 3183, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3184, 3185, and 3186, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3187, 3188, and 3189, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3190, 3191, and 3192, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3193; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3194. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3193. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3194. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3193, and a VL having an amino acid sequence of SEQ ID NO:3194. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3195. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3196. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3195, and a light chain having an amino acid sequence of SEQ ID NO:3196. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3193. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3194. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3193, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3194. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3195. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3196. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3195, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3196.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3197, 3198, and 3199, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3200, 3201, and 3202, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3203, 3204, and 3205, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3206, 3207, and 3208, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3209, 3210, and 3211, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3212, 3213, and 3214, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3215, 3216, and 3217, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3218, 3219, and 3220, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3221, 3222, and 3223, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3224, 3225, and 3226, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3227; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3228. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3227. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3228. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3227, and a VL having an amino acid sequence of SEQ ID NO:3228. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3229. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3230. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3229, and a light chain having an amino acid sequence of SEQ ID NO:3230. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3227. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3228. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3227, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3228. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3229. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3230. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3229, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3230.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3231, 3232, and 3233, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3234, 3235, and 3236, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3237, 3238, and 3239, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3240, 3241, and 3242, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3243, 3244, and 3245, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3246, 3247, and 3248, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3249, 3250, and 3251, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3252, 3253, and 3254, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3255, 3256, and 3257, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3258, 3259, and 3260, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3261; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3262. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3261. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3262. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3261, and a VL having an amino acid sequence of SEQ ID NO:3262. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3263. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3264. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3263, and a light chain having an amino acid sequence of SEQ ID NO:3264. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3261. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3262. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3261, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3262. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3263. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3264. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3263, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3264.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3265, 3266, and 3267, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3268, 3269, and 3270, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3271, 3272, and 3273, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3274, 3275, and 3276, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3277, 3278, and 3279, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3280, 3281, and 3282, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3283, 3284, and 3285, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3286, 3287, and 3288, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3289, 3290, and 3291, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3292, 3293, and 3294, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3295; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3296. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3295. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3296. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3295, and a VL having an amino acid sequence of SEQ ID NO:3296. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3297. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3298. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3297, and a light chain having an amino acid sequence of SEQ ID NO:3298. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3295. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3296. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3295, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3296. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3297. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3298. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3297, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3298.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3299, 3300, and 3301, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3302, 3303, and 3304, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3305, 3306, and 3307, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3308, 3309, and 3310, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3311, 3312, and 3313, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3314, 3315, and 3316, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3317, 3318, and 3319, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3320, 3321, and 3322, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3323, 3324, and 3325, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3326, 3327, and 3328, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3329; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3330. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3329. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3330. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3329, and a VL having an amino acid sequence of SEQ ID NO:3330. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3331. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3332. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3331, and a light chain having an amino acid sequence of SEQ ID NO:3332. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3329. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3330. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3329, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3330. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3331. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3332. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3331, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3332.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3333, 3334, and 3335, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3336, 3337, and 3338, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3339, 3340, and 3341, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3342, 3343, and 3344, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3345, 3346, and 3347, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3348, 3349, and 3350, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3351, 3352, and 3353, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3354, 3355, and 3356, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3357, 3358, and 3359, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3360, 3361, and 3362, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3363; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3364. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3363. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3364. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3363, and a VL having an amino acid sequence of SEQ ID NO:3364. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3365. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3366. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3365, and a light chain having an amino acid sequence of SEQ ID NO:3366. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3363. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3364. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3363, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3364. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3365. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3366. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3365, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3366.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3367, 3368, and 3369, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3370, 3371, and 3372, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3373, 3374, and 3375, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3376, 3377, and 3378, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3379, 3380, and 3381, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3382, 3383, and 3384, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3385, 3386, and 3387, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3388, 3389, and 3390, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3391, 3392, and 3393, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3394, 3395, and 3396, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3397; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3398. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3397. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3398. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3397, and a VL having an amino acid sequence of SEQ ID NO:3398. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3399. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3400. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3399, and a light chain having an amino acid sequence of SEQ ID NO:3400. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3397. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3398. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3397, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3398. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3399. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3400. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3399, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3400.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3401, 3402, and 3403, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3404, 3405, and 3406, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3407, 3408, and 3409, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3410, 3411, and 3412, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3413, 3414, and 3415, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3416, 3417, and 3418, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3419, 3420, and 3421, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3422, 3423, and 3424, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3425, 3426, and 3427, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3428, 3429, and 3430, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3431; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3432. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3431. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3432. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3431, and a VL having an amino acid sequence of SEQ ID NO:3432. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3433. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3434. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3433, and a light chain having an amino acid sequence of SEQ ID NO:3434. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3431. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3432. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3431, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3432. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3433. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3434. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3433, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3434.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3435, 3436, and 3437, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3438, 3439, and 3440, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3441, 3442, and 3443, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3444, 3445, and 3446, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3447, 3448, and 3449, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3450, 3451, and 3452, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3453, 3454, and 3455, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3456, 3457, and 3458, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3459, 3460, and 3461, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3462, 3463, and 3464, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3465; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3466. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3465. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3466. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3465, and a VL having an amino acid sequence of SEQ ID NO:3466. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3467. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3468. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3467, and a light chain having an amino acid sequence of SEQ ID NO:3468. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3465. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3466. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3465, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3466. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3467. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3468. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3467, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3468.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3469, 3470, and 3471, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3472, 3473, and 3474, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3475, 3476, and 3477, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3478, 3479, and 3480, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3481, 3482, and 3483, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3484, 3485, and 3486, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3487, 3488, and 3489, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3490, 3491, and 3492, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3493, 3494, and 3495, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3496, 3497, and 3498, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3499; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3500. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3499. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3500. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3499, and a VL having an amino acid sequence of SEQ ID NO:3500. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3501. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3502. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3501, and a light chain having an amino acid sequence of SEQ ID NO:3502. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3499. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3500. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3499, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3500. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3501. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3502. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3501, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3502.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3503, 3504, and 3505, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3506, 3507, and 3508, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3509, 3510, and 3511, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3512, 3513, and 3514, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3515, 3516, and 3517, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3518, 3519, and 3520, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3521, 3522, and 3523, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3524, 3525, and 3526, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3527, 3528, and 3529, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3530, 3531, and 3532, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3533; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3534. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3533. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3534. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3533, and a VL having an amino acid sequence of SEQ ID NO:3534. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3535. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3536. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3535, and a light chain having an amino acid sequence of SEQ ID NO:3536. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3533. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3534. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3533, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3534. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3535. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3536. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3535, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3536.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3537, 3538, and 3539, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3540, 3541, and 3542, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3543, 3544, and 3545, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3546, 3547, and 3548, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3549, 3550, and 3551, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3552, 3553, and 3554, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3555, 3556, and 3557, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3558, 3559, and 3560, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3561, 3562, and 3563, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3564, 3565, and 3566, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3567; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3568. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3567. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3568. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3567, and a VL having an amino acid sequence of SEQ ID NO:3568. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3569. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3570. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3569, and a light chain having an amino acid sequence of SEQ ID NO:3570. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3567. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3568. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3567, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3568. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3569. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3570. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3569, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3570.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3571, 3572, and 3573, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3574, 3575, and 3576, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3577, 3578, and 3579, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3580, 3581, and 3582, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3583, 3584, and 3585, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3586, 3587, and 3588, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3589, 3590, and 3591, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3592, 3593, and 3594, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3595, 3596, and 3597, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3598, 3599, and 3600, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3601; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3602. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3601. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3602. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3601, and a VL having an amino acid sequence of SEQ ID NO:3602. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3603. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3604. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3603, and a light chain having an amino acid sequence of SEQ ID NO:3604. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3601. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3602. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3601, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3602. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3603. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3604. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3603, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3604.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3605, 3606, and 3607, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3608, 3609, and 3610, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3611, 3612, and 3613, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3614, 3615, and 3616, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3617, 3618, and 3619, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3620, 3621, and 3622, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3623, 3624, and 3625, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3626, 3627, and 3628, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3629, 3630, and 3631, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3632, 3633, and 3634, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3635; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3636. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3635. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3636. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3635, and a VL having an amino acid sequence of SEQ ID NO:3636. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3637. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3638. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3637, and a light chain having an amino acid sequence of SEQ ID NO:3638. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3635. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3636. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3635, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3636. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3637. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3638. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3637, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3638.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3639, 3640, and 3641, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3642, 3643, and 3644, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3645, 3646, and 3647, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3648, 3649, and 3650, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3651, 3652, and 3653, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3654, 3655, and 3656, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3657, 3658, and 3659, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3660, 3661, and 3662, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3663, 3664, and 3665, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3666, 3667, and 3668, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3669; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3670. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3669. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3670. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3669, and a VL having an amino acid sequence of SEQ ID NO:3670. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3671. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3672. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3671, and a light chain having an amino acid sequence of SEQ ID NO:3672. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3669. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3670. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3669, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3670. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3671. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3672. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3671, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3672.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3673, 3674, and 3675, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3676, 3677, and 3678, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3679, 3680, and 3681, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3682, 3683, and 3684, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3685, 3686, and 3687, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3688, 3689, and 3690, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3691, 3692, and 3693, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3694, 3695, and 3696, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3697, 3698, and 3699, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3700, 3701, and 3702, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3703; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3704. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3703. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3704. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3703, and a VL having an amino acid sequence of SEQ ID NO:3704. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3705. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3706. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3705, and a light chain having an amino acid sequence of SEQ ID NO:3706. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3703. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3704. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3703, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3704. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3705. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3706. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3705, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3706.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3707, 3708, and 3709, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3710, 3711, and 3712, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3713, 3714, and 3715, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3716, 3717, and 3718, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3719, 3720, and 3721, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3722, 3723, and 3724, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3725, 3726, and 3727, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3728, 3729, and 3730, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3731, 3732, and 3733, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3734, 3735, and 3736, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3737; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3738. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3737. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3738. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3737, and a VL having an amino acid sequence of SEQ ID NO:3738. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3739. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3740. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3739, and a light chain having an amino acid sequence of SEQ ID NO:3740. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3737. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3738. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3737, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3738. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3739. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3740. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3739, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3740.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3741, 3742, and 3743, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3744, 3745, and 3746, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3747, 3748, and 3749, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3750, 3751, and 3752, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3753, 3754, and 3755, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3756, 3757, and 3758, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3759, 3760, and 3761, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3762, 3763, and 3764, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3765, 3766, and 3767, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3768, 3769, and 3770, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3771; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3772. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3771. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3772. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3771, and a VL having an amino acid sequence of SEQ ID NO:3772. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3773. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3774. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3773, and a light chain having an amino acid sequence of SEQ ID NO:3774. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3771. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3772. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3771, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3772. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3773. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3774. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3773, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3774.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3775, 3776, and 3777, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3778, 3779, and 3780, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3781, 3782, and 3783, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3784, 3785, and 3786, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3787, 3788, and 3789, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3790, 3791, and 3792, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3793, 3794, and 3795, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3796, 3797, and 3798, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3799, 3800, and 3801, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3802, 3803, and 3804, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3805; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3806. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3805. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3806. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3805, and a VL having an amino acid sequence of SEQ ID NO:3806. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3807. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3808. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3807, and a light chain having an amino acid sequence of SEQ ID NO:3808. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3805. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3806. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3805, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3806. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3807. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3808. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3807, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3808.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3809, 3810, and 3811, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3812, 3813, and 3814, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3815, 3816, and 3817, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3818, 3819, and 3820, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3821, 3822, and 3823, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3824, 3825, and 3826, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3827, 3828, and 3829, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3830, 3831, and 3832, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3833, 3834, and 3835, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3836, 3837, and 3838, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3839; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3840. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3839. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3840. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3839, and a VL having an amino acid sequence of SEQ ID NO:3840. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3841. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3842. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3841, and a light chain having an amino acid sequence of SEQ ID NO:3842. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3839. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3840. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3839, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3840. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3841. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3842. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3841, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3842.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3843, 3844, and 3845, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3846, 3847, and 3848, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3849, 3850, and 3851, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3852, 3853, and 3854, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3855, 3856, and 3857, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3858, 3859, and 3860, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3861, 3862, and 3863, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3864, 3865, and 3866, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3867, 3868, and 3869, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3870, 3871, and 3872, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3873; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3874. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3873. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3874. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3873, and a VL having an amino acid sequence of SEQ ID NO:3874. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3875. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3876. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3875, and a light chain having an amino acid sequence of SEQ ID NO:3876. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3873. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3874. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3873, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3874. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3875. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3876. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3875, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3876.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3877, 3878, and 3879, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3880, 3881, and 3882, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3883, 3884, and 3885, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3886, 3887, and 3888, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3889, 3890, and 3891, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3892, 3893, and 3894, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3895, 3896, and 3897, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3898, 3899, and 3900, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3901, 3902, and 3903, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3904, 3905, and 3906, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3907; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3908. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3907. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3908. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3907, and a VL having an amino acid sequence of SEQ ID NO:3908. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3909. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3910. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3909, and a light chain having an amino acid sequence of SEQ ID NO:3910. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3907. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3908. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3907, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3908. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3909. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3910. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3909, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3910.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3911, 3912, and 3913, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3914, 3915, and 3916, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3917, 3918, and 3919, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3920, 3921, and 3922, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3923, 3924, and 3925, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3926, 3927, and 3928, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3929, 3930, and 3931, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3932, 3933, and 3934, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3935, 3936, and 3937, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3938, 3939, and 3940, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3941; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3942. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3941. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3942. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3941, and a VL having an amino acid sequence of SEQ ID NO:3942. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3943. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3944. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3943, and a light chain having an amino acid sequence of SEQ ID NO:3944. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3941. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3942. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3941, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3942. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3943. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3944. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3943, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3944.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3945, 3946, and 3947, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3948, 3949, and 3950, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3951, 3952, and 3953, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3954, 3955, and 3956, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3957, 3958, and 3959, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3960, 3961, and 3962, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3963, 3964, and 3965, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3966, 3967, and 3968, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3969, 3970, and 3971, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3972, 3973, and 3974, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3975; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:3976. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3975. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:3976. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:3975, and a VL having an amino acid sequence of SEQ ID NO:3976. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3977. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:3978. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:3977, and a light chain having an amino acid sequence of SEQ ID NO:3978. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3975. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3976. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3975, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3976. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3977. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3978. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3977, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:3978.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3979, 3980, and 3981, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3982, 3983, and 3984, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3985, 3986, and 3987, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3988, 3989, and 3990, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3991, 3992, and 3993, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:3994, 3995, and 3996, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:3997, 3998, and 3999, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4000, 4001, and 4002, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4003, 4004, and 4005, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4006, 4007, and 4008, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4009; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4010. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:4009. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:4010. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:4009, and a VL having an amino acid sequence of SEQ ID NO:4010. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4011. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:4012. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4011, and a light chain having an amino acid sequence of SEQ ID NO:4012. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4009. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4010. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4009, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4010. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4011. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4012. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4011, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4012.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4013, 4014, and 4015, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4016, 4017, and 4018, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4019, 4020, and 4021, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4022, 4023, and 4024, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4025, 4026, and 4027, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4028, 4029, and 4030, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4031, 4032, and 4033, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4034, 4035, and 4036, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4037, 4038, and 4039, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4040, 4041, and 4042, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4043; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4044. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:4043. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:4044. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:4043, and a VL having an amino acid sequence of SEQ ID NO:4044. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4045. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:4046. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4045, and a light chain having an amino acid sequence of SEQ ID NO:4046. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4043. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4044. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4043, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4044. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4045. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4046. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4045, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4046.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4047, 4048, and 4049, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4050, 4051, and 4052, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4053, 4054, and 4055, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4056, 4057, and 4058, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4059, 4060, and 4061, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4062, 4063, and 4064, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4065, 4066, and 4067, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4068, 4069, and 4070, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4071, 4072, and 4073, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4074, 4075, and 4076, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4077; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4078. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:4077. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:4078. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:4077, and a VL having an amino acid sequence of SEQ ID NO:4078. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4079. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:4080. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4079, and a light chain having an amino acid sequence of SEQ ID NO:4080. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4077. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4078. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4077, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4078. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4079. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4080. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4079, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4080.

In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4081, 4082, and 4083, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4084, 4085, and 4086, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4087, 4088, and 4089, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4090, 4091, and 4092, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4093, 4094, and 4095, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4096, 4097, and 4098, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4099, 4100, and 4101, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4102, 4103, and 4104, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4105, 4106, and 4107, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4108, 4109, and 4110, respectively. In one aspect, provided herein is an antibody that binds TRDV2, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4111; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4112. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:4111. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence of SEQ ID NO:4112. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence of SEQ ID NO:4111, and a VL having an amino acid sequence of SEQ ID NO:4112. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4113. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence of SEQ ID NO:4114. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4113, and a light chain having an amino acid sequence of SEQ ID NO:4114. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4111. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4112. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4111, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4112. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4113. In one aspect, provided herein is an antibody that binds TRDV2, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4114. In one aspect, provided herein is an antibody that binds TRDV2, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4113, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4114.

In one aspect, provided herein is an antibody that binds TRDV2. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2037. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2038. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2037; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2038. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2071. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2072. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2071; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2072. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2105. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2106. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2105; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2106. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2139. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2140. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2139; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2140. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2173. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2174. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2173; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2174. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2207. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2208. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2207; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2208. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2241. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2242. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2241; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2242. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2275. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2276. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2275; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2276. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2309. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2310. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2309; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2310. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2343. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2344. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2343; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2344. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2377. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2378. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2377; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2378. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2411. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2412. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2411; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2412. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2445. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2446. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2445; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2446. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2479. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2480. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2479; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2480. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2513. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2514. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2513; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2514. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2547. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2548. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2547; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2548. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2581. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2582. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2581; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2582. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2615. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2616. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2615; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2616. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2649. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2650. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2649; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2650. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2683. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2684. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2683; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2684. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2717. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2718. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2717; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2718. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2751. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2752. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2751; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2752. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2785. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2786. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2785; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2786. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2819. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2820. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2819; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2820. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2853. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2854. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2853; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2854. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2887. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2888. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2887; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2888. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2921. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2922. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2921; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2922. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2955. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2956. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2955; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2956. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2989. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2990. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2989; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2990. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3023. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3024. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3023; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3024. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3057. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3058. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3057; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3058. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3091. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3092. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3091; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3092. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3125. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3126. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3125; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3126. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3159. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3160. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3159; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3160. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3193. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3194. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3193; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3194. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3227. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3228. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3227; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3228. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3261. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3262. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3261; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3262. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3295. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3296. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3295; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3296. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3329. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3330. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3329; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3330. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3363. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3364. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3363; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3364. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3397. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3398. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3397; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3398. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3431. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3432. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3431; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3432. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3465. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3466. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3465; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3466. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3499. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3500. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3499; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3500. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3533. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3534. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3533; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3534. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3567. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3568. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3567; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3568. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3601. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3602. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3601; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3602. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3635. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3636. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3635; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3636. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3669. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3670. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3669; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3670. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3703. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3704. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3703; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3704. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3737. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3738. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3737; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3738. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3771. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3772. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3771; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3772. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3805. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3806. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3805; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3806. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3839. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3840. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3839; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3840. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3873. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3874. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3873; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3874. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3907. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3908. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3907; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3908. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3941. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3942. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3941; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3942. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3975. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3976. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3975; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3976. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4009. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4010. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4009; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4010. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4043. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4044. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4043; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4044. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4077. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4078. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4077; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4078. In one embodiment, the TRDV2 antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4111. In one embodiment, the TRDV2 antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4112. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4111; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4112. In some embodiments, the TRDV2 antibody is a multispecific antibody. In some embodiments, the TRDV2 antibody is a bispecific antibody. In some embodiments, the TRDV2 antibody is a trispecific antibody. In some embodiments, the TRDV2 antibody is a quadraspecific antibody.

In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:2031, wherein the fifth amino acid is R or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:2032; a VH CDR3 having an amino acid sequence of SEQ ID NO:2033, wherein the sixteenth amino acid is F or Y. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:2034; a VL CDR2 having an amino acid sequence of SEQ ID NO:2035, wherein the third amino acid is S or T; and a VL CDR3 having an amino acid sequence of SEQ ID NO:2036, wherein the sixth amino acid is R or S, the seventh amino acid is L or M, the eighth amino acid is S or T. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:2031, wherein the fifth amino acid is R or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:2032; a VH CDR3 having an amino acid sequence of SEQ ID NO:2033, wherein the sixteenth amino acid is F or Y; a VL CDR1 having an amino acid sequence of SEQ ID NO:2034; a VL CDR2 having an amino acid sequence of SEQ ID NO:2035, wherein the third amino acid is S or T; and a VL CDR3 having an amino acid sequence of SEQ ID NO:2036, wherein the sixth amino acid is R or S, the seventh amino acid is L or M, the eighth amino acid is S or T.

In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:2099, wherein the fifth amino acid is S or T, the eighth amino acid is R or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:2100, wherein the fourth amino acid is D or S, the sixth amino acid is I or S; a VH CDR3 having an amino acid sequence of SEQ ID NO:2101, wherein the third amino acid is D or E, the fourth amino acid is R or S, the sixth amino acid is Y or there is no amino acid added to the sixth position and sequence continues to the seventh position, the eighth amino acid is G or V, the ninth amino acid is P or S. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:2102; a VL CDR2 having an amino acid sequence of SEQ ID NO:2103; and a VL CDR3 having an amino acid sequence of SEQ ID NO:2104. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:2099, wherein the fifth amino acid is S or T, the eighth amino acid is R or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:2100, wherein the fourth amino acid is D or S, the sixth amino acid is I or S; a VH CDR3 having an amino acid sequence of SEQ ID NO:2101, wherein the third amino acid is D or E, the fourth amino acid is R or S, the sixth amino acid is Y or there is no amino acid added to the sixth position and sequence continues to the seventh position, the eighth amino acid is G or V, the ninth amino acid is P or S; a VL CDR1 having an amino acid sequence of SEQ ID NO:2102; a VL CDR2 having an amino acid sequence of SEQ ID NO:2103; and a VL CDR3 having an amino acid sequence of SEQ ID NO:2104.

In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:2133, wherein the second amino acid is D or G, the fifth amino acid is N, S, or T, the sixth amino acid is N or S, the seventh amino acid is H or Y; a VH CDR2 having an amino acid sequence of SEQ ID NO:2134, wherein the first amino acid is I or V, the fourth amino acid is N or S, the sixth amino acid is N or S; a VH CDR3 having an amino acid sequence of SEQ ID NO:2135, wherein the seventh amino acid is E or V, the tenth amino acid is G or T. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:2136; a VL CDR2 having an amino acid sequence of SEQ ID NO:2137; and a VL CDR3 having an amino acid sequence of SEQ ID NO:2138, wherein the ninth amino acid is G or S. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:2133, wherein the second amino acid is D or G, the fifth amino acid is N, S, or T, the sixth amino acid is N or S, the seventh amino acid is H or Y; a VH CDR2 having an amino acid sequence of SEQ ID NO:2134, wherein the first amino acid is I or V, the fourth amino acid is N or S, the sixth amino acid is N or S; a VH CDR3 having an amino acid sequence of SEQ ID NO:2135, wherein the seventh amino acid is E or V, the tenth amino acid is G or T; a VL CDR1 having an amino acid sequence of SEQ ID NO:2136; a VL CDR2 having an amino acid sequence of SEQ ID NO:2137; and a VL CDR3 having an amino acid sequence of SEQ ID NO:2138, wherein the ninth amino acid is G or S.

In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:2269, wherein the first amino acid is G or S, the fifth amino acid is S or T; a VH CDR2 having an amino acid sequence of SEQ ID NO:2270; a VH CDR3 having an amino acid sequence of SEQ ID NO:2271, wherein the seventh amino acid is D or E, the ninth amino acid is D or S, the eighteenth amino acid is G or N. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:2272; a VL CDR2 having an amino acid sequence of SEQ ID NO:2273; and a VL CDR3 having an amino acid sequence of SEQ ID NO:2274, wherein the third amino acid is F or Y, the sixth amino acid is A or T. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:2269, wherein the first amino acid is G or S, the fifth amino acid is S or T; a VH CDR2 having an amino acid sequence of SEQ ID NO:2270; a VH CDR3 having an amino acid sequence of SEQ ID NO:2271, wherein the seventh amino acid is D or E, the ninth amino acid is D or S, the eighteenth amino acid is G or N; a VL CDR1 having an amino acid sequence of SEQ ID NO:2272; a VL CDR2 having an amino acid sequence of SEQ ID NO:2273; and a VL CDR3 having an amino acid sequence of SEQ ID NO:2274, wherein the third amino acid is F or Y, the sixth amino acid is A or T.

In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:2337, wherein the first amino acid is G or N, the fifth amino acid is N or S, the sixth amino acid is G, N, or Y; a VH CDR2 having an amino acid sequence of SEQ ID NO:2338, wherein the second amino acid is F or Y; a VH CDR3 having an amino acid sequence of SEQ ID NO:2339, wherein the second amino acid is K or R, the third amino acid is E or L, the tenth amino acid is S or T, the eleventh amino acid is A or T. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:2340, wherein the first amino acid is S or T, the fifth amino acid is E or G, the seventh amino acid is D or N; a VL CDR2 having an amino acid sequence of SEQ ID NO:2341; and a VL CDR3 having an amino acid sequence of SEQ ID NO:2342, wherein the first amino acid is A or T. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:2337, wherein the first amino acid is G or N, the fifth amino acid is N or S, the sixth amino acid is G, N, or Y; a VH CDR2 having an amino acid sequence of SEQ ID NO:2338, wherein the second amino acid is F or Y; a VH CDR3 having an amino acid sequence of SEQ ID NO:2339, wherein the second amino acid is K or R, the third amino acid is E or L, the tenth amino acid is S or T, the eleventh amino acid is A or T; a VL CDR1 having an amino acid sequence of SEQ ID NO:2340, wherein the first amino acid is S or T, the fifth amino acid is E or G, the seventh amino acid is D or N; a VL CDR2 having an amino acid sequence of SEQ ID NO:2341; and a VL CDR3 having an amino acid sequence of SEQ ID NO:2342, wherein the first amino acid is A or T.

In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:3017, wherein the sixth amino acid is S or T; a VH CDR2 having an amino acid sequence of SEQ ID NO:3018; a VH CDR3 having an amino acid sequence of SEQ ID NO:3019, wherein the eighth amino acid is S or T. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:3020, wherein the second amino acid is G or S; a VL CDR2 having an amino acid sequence of SEQ ID NO:3021; and a VL CDR3 having an amino acid sequence of SEQ ID NO:3022, wherein the first amino acid is I or M. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:3017, wherein the sixth amino acid is S or T; a VH CDR2 having an amino acid sequence of SEQ ID NO:3018; a VH CDR3 having an amino acid sequence of SEQ ID NO:3019, wherein the eighth amino acid is S or T; a VL CDR1 having an amino acid sequence of SEQ ID NO:3020, wherein the second amino acid is G or S; a VL CDR2 having an amino acid sequence of SEQ ID NO:3021; and a VL CDR3 having an amino acid sequence of SEQ ID NO:3022, wherein the first amino acid is I or M.

In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:2983; a VH CDR2 having an amino acid sequence of SEQ ID NO:2984, wherein the third amino acid is P or S; a VH CDR3 having an amino acid sequence of SEQ ID NO:2985, wherein the fourth amino acid is M or V, the sixth amino acid is T or V, the eleventh amino acid is A or D. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:2986; a VL CDR2 having an amino acid sequence of SEQ ID NO:2987; and a VL CDR3 having an amino acid sequence of SEQ ID NO:2988. In one aspect, provided herein is an antibody that binds TRDV2, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:2983; a VH CDR2 having an amino acid sequence of SEQ ID NO:2984, wherein the third amino acid is P or S; a VH CDR3 having an amino acid sequence of SEQ ID NO:2985, wherein the fourth amino acid is M or V, the sixth amino acid is T or V, the eleventh amino acid is A or D; a VL CDR1 having an amino acid sequence of SEQ ID NO:2986; a VL CDR2 having an amino acid sequence of SEQ ID NO:2987; and a VL CDR3 having an amino acid sequence of SEQ ID NO:2988.

In one aspect, provided herein is an antibody that binds to TRGDC. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region. In some embodiments, the TRGDC antibody is a humanized antibody.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4115, 4116, and 4117, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4118, 4119, and 4120, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4121, 4122, and 4123, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4124, 4125, and 4126, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4127, 4128, and 4129, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4130, 4131, and 4132, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4133, 4134, and 4135, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4136, 4137, and 4138, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4139, 4140, and 4141, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4142, 4143, and 4144, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4145; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4146. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4145. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4146. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4145, and a VL having an amino acid sequence of SEQ ID NO:4146. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4147. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4148. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4147, and a light chain having an amino acid sequence of SEQ ID NO:4148. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4145. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4146. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4145, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4146. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4147. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4148. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4147, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4148.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4149, 4150, and 4151, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4152, 4153, and 4154, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4155, 4156, and 4157, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4158, 4159, and 4160, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4161, 4162, and 4163, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4164, 4165, and 4166, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4167, 4168, and 4169, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4170, 4171, and 4172, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4173, 4174, and 4175, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4176, 4177, and 4178, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4179; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4180. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4179. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4180. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4179, and a VL having an amino acid sequence of SEQ ID NO:4180. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4181. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4182. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4181, and a light chain having an amino acid sequence of SEQ ID NO:4182. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4179. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4180. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4179, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4180. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4181. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4182. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4181, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4182.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4183, 4184, and 4185, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4186, 4187, and 4188, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4189, 4190, and 4191, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4192, 4193, and 4194, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4195, 4196, and 4197, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4198, 4199, and 4200, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4201, 4202, and 4203, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4204, 4205, and 4206, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4207, 4208, and 4209, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4210, 4211, and 4212, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4213; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4214. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4213. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4214. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4213, and a VL having an amino acid sequence of SEQ ID NO:4214. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4215. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4216. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4215, and a light chain having an amino acid sequence of SEQ ID NO:4216. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4213. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4214. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4213, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4214. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4215. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4216. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4215, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4216.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4217, 4218, and 4219, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4220, 4221, and 4222, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4223, 4224, and 4225, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4226, 4227, and 4228, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4229, 4230, and 4231, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4232, 4233, and 4234, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4235, 4236, and 4237, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4238, 4239, and 4240, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4241, 4242, and 4243, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4244, 4245, and 4246, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4247; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4248. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4247. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4248. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4247, and a VL having an amino acid sequence of SEQ ID NO:4248. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4249. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4250. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4249, and a light chain having an amino acid sequence of SEQ ID NO:4250. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4247. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4248. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4247, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4248. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4249. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4250. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4249, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4250.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4251, 4252, and 4253, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4254, 4255, and 4256, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4257, 4258, and 4259, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4260, 4261, and 4262, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4263, 4264, and 4265, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4266, 4267, and 4268, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4269, 4270, and 4271, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4272, 4273, and 4274, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4275, 4276, and 4277, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4278, 4279, and 4280, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4281; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4282. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4281. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4282. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4281, and a VL having an amino acid sequence of SEQ ID NO:4282. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4283. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4284. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4283, and a light chain having an amino acid sequence of SEQ ID NO:4284. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4281. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4282. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4281, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4282. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4283. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4284. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4283, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4284.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4285, 4286, and 4287, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4288, 4289, and 4290, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4291, 4292, and 4293, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4294, 4295, and 4296, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4297, 4298, and 4299, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4300, 4301, and 4302, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4303, 4304, and 4305, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4306, 4307, and 4308, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4309, 4310, and 4311, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4312, 4313, and 4314, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4315; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4316. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4315. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4316. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4315, and a VL having an amino acid sequence of SEQ ID NO:4316. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4317. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4318. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4317, and a light chain having an amino acid sequence of SEQ ID NO:4318. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4315. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4316. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4315, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4316. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4317. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4318. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4317, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4318.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4319, 4320, and 4321, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4322, 4323, and 4324, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4325, 4326, and 4327, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4328, 4329, and 4330, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4331, 4332, and 4333, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4334, 4335, and 4336, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4337, 4338, and 4339, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4340, 4341, and 4342, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4343, 4344, and 4345, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4346, 4347, and 4348, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4349; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4350. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4349. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4350. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4349, and a VL having an amino acid sequence of SEQ ID NO:4350. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4351. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4352. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4351, and a light chain having an amino acid sequence of SEQ ID NO:4352. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4349. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4350. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4349, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4350. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4351. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4352. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4351, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4352.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4353, 4354, and 4355, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4356, 4357, and 4358, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4359, 4360, and 4361, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4362, 4363, and 4364, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4365, 4366, and 4367, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4368, 4369, and 4370, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4371, 4372, and 4373, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4374, 4375, and 4376, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4377, 4378, and 4379, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4380, 4381, and 4382, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4383; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4384. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4383. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4384. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4383, and a VL having an amino acid sequence of SEQ ID NO:4384. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4385. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4386. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4385, and a light chain having an amino acid sequence of SEQ ID NO:4386. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4383. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4384. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4383, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4384. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4385. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4386. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4385, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4386.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4387, 4388, and 4389, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4390, 4391, and 4392, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4393, 4394, and 4395, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4396, 4397, and 4398, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4399, 4400, and 4401, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4402, 4403, and 4404, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4405, 4406, and 4407, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4408, 4409, and 4410, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4411, 4412, and 4413, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4414, 4415, and 4416, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4417; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4418. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4417. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4418. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4417, and a VL having an amino acid sequence of SEQ ID NO:4418. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4419. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4420. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4419, and a light chain having an amino acid sequence of SEQ ID NO:4420. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4417. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4418. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4417, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4418. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4419. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4420. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4419, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4420.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4421, 4422, and 4423, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4424, 4425, and 4426, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4427, 4428, and 4429, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4430, 4431, and 4432, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4433, 4434, and 4435, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4436, 4437, and 4438, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4439, 4440, and 4441, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4442, 4443, and 4444, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4445, 4446, and 4447, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4448, 4449, and 4450, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4451; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4452. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4451. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4452. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4451, and a VL having an amino acid sequence of SEQ ID NO:4452. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4453. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4454. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4453, and a light chain having an amino acid sequence of SEQ ID NO:4454. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4451. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4452. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4451, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4452. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4453. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4454. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4453, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4454.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4455, 4456, and 4457, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4458, 4459, and 4460, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4461, 4462, and 4463, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4464, 4465, and 4466, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4467, 4468, and 4469, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4470, 4471, and 4472, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4473, 4474, and 4475, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4476, 4477, and 4478, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4479, 4480, and 4481, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4482, 4483, and 4484, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4485; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4486. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4485. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4486. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4485, and a VL having an amino acid sequence of SEQ ID NO:4486. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4487. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4488. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4487, and a light chain having an amino acid sequence of SEQ ID NO:4488. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4485. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4486. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4485, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4486. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4487. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4488. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4487, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4488.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4489, 4490, and 4491, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4492, 4493, and 4494, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4495, 4496, and 4497, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4498, 4499, and 4500, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4501, 4502, and 4503, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4504, 4505, and 4506, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4507, 4508, and 4509, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4510, 4511, and 4512, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4513, 4514, and 4515, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4516, 4517, and 4518, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4519; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4520. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4519. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4520. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4519, and a VL having an amino acid sequence of SEQ ID NO:4520. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4521. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4522. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4521, and a light chain having an amino acid sequence of SEQ ID NO:4522. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4519. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4520. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4519, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4520. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4521. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4522. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4521, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4522.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4523, 4524, and 4525, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4526, 4527, and 4528, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4529, 4530, and 4531, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4532, 4533, and 4534, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4535, 4536, and 4537, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4538, 4539, and 4540, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4541, 4542, and 4543, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4544, 4545, and 4546, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4547, 4548, and 4549, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4550, 4551, and 4552, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4553; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4554. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4553. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4554. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4553, and a VL having an amino acid sequence of SEQ ID NO:4554. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4555. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4556. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4555, and a light chain having an amino acid sequence of SEQ ID NO:4556. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4553. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4554. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4553, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4554. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4555. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4556. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4555, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4556.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4557, 4558, and 4559, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4560, 4561, and 4562, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4563, 4564, and 4565, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4566, 4567, and 4568, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4569, 4570, and 4571, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4572, 4573, and 4574, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4575, 4576, and 4577, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4578, 4579, and 4580, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4581, 4582, and 4583, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4584, 4585, and 4586, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4587; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4588. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4587. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4588. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4587, and a VL having an amino acid sequence of SEQ ID NO:4588. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4589. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4590. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4589, and a light chain having an amino acid sequence of SEQ ID NO:4590. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4587. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4588. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4587, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4588. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4589. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4590. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4589, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4590.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4591, 4592, and 4593, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4594, 4595, and 4596, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4597, 4598, and 4599, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4600, 4601, and 4602, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4603, 4604, and 4605, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4606, 4607, and 4608, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4609, 4610, and 4611, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4612, 4613, and 4614, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4615, 4616, and 4617, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4618, 4619, and 4620, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4621; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4622. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4621. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4622. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4621, and a VL having an amino acid sequence of SEQ ID NO:4622. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4623. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4624. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4623, and a light chain having an amino acid sequence of SEQ ID NO:4624. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4621. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4622. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4621, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4622. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4623. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4624. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4623, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4624.

In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4625, 4626, and 4627, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4628, 4629, and 4630, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4631, 4632, and 4633, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4634, 4635, and 4636, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4637, 4638, and 4639, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4640, 4641, and 4642, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4643, 4644, and 4645, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4646, 4647, and 4648, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of SEQ ID NOs:4649, 4650, and 4651, respectively, and (ii) a VL comprising a VL CDR1, VL CDR2, and VL CDR3 having an amino acid sequence of SEQ ID NOs:4652, 4653, and 4654, respectively. In one aspect, provided herein is an antibody that binds TRGDC, comprising: (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4655; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of SEQ ID NO:4656. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4655. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence of SEQ ID NO:4656. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence of SEQ ID NO:4655, and a VL having an amino acid sequence of SEQ ID NO:4656. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4657. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence of SEQ ID NO:4658. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence of SEQ ID NO:4657, and a light chain having an amino acid sequence of SEQ ID NO:4658. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4655. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4656. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4655, and a VL having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4656. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4657. In one aspect, provided herein is an antibody that binds TRGDC, comprising a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4658. In one aspect, provided herein is an antibody that binds TRGDC, comprising a heavy chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4657, and a light chain having an amino acid sequence having at least 95% identity to an amino acid sequence of SEQ ID NO:4658.

In one aspect, provided herein is an antibody that binds TRGDC. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4145. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4146. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4145; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4146. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4179. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4180. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4179; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4180. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4213. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4214. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4213; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4214. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4247. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4248. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4247; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4248. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4281. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4282. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4281; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4282. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4315. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4316. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4315; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4316. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4349. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4350. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4349; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4350. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4383. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4384. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4383; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4384. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4417. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4418. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4417; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4418. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4451. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4452. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4451; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4452. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4485. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4486. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4485; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4486. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4519. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4520. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4519; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4520. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4553. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4554. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4553; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4554. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4587. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4588. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4587; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4588. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4621. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4622. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4621; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4622. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4655. In one embodiment, the TRGDC antibody comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4656. In one embodiment, the TRGDC antibody comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4655; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4656. In some embodiments, the TRGDC antibody is a multispecific antibody. In some embodiments, the TRGDC antibody is a bispecific antibody. In some embodiments, the TRGDC antibody is a trispecific antibody. In some embodiments, the TRGDC antibody is a quadraspecific antibody.

In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4139, wherein the eighth amino acid is R or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:4140; a VH CDR3 having an amino acid sequence of SEQ ID NO:4141, wherein the third amino acid is D or G, the fourth amino acid is E or L, the sixth amino acid is E or G, the ninth amino acid is E or D, the eleventh amino acid is C or F. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:4142, wherein the fourth amino acid is H or S; a VL CDR2 having an amino acid sequence of SEQ ID NO:4143; and a VL CDR3 having an amino acid sequence of SEQ ID NO:4144, wherein the eighth amino acid is F or W. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4139, wherein the eighth amino acid is R or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:4140; a VH CDR3 having an amino acid sequence of SEQ ID NO:4141, wherein the third amino acid is D or G, the fourth amino acid is E or L, the sixth amino acid is E or G, the ninth amino acid is E or D, the eleventh amino acid is C or F; a VL CDR1 having an amino acid sequence of SEQ ID NO:4142, wherein the fourth amino acid is H or S; a VL CDR2 having an amino acid sequence of SEQ ID NO:4143; and a VL CDR3 having an amino acid sequence of SEQ ID NO:4144, wherein the eighth amino acid is F or W.

In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4173, wherein the first amino acid is G or R, the fourth amino acid is F or L, the sixth amino acid is N or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:4174; a VH CDR3 having an amino acid sequence of SEQ ID NO:4175, wherein the fourth amino acid is R or V, the seventh amino acid is G or T, the eighth amino acid is G or T, there is no ninth amino acid or is T, the sixteenth amino acid is L or M. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:4176, wherein the fourth amino acid is A or S; a VL CDR2 having an amino acid sequence of SEQ ID NO:4177; and a VL CDR3 having an amino acid sequence of SEQ ID NO:4178. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4173, wherein the first amino acid is G or R, the fourth amino acid is F or L, the sixth amino acid is N or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:4174; a VH CDR3 having an amino acid sequence of SEQ ID NO:4175, wherein the fourth amino acid is R or V, the seventh amino acid is G or T, the eighth amino acid is G or T, there is no ninth amino acid or is T, the sixteenth amino acid is L or M; a VL CDR1 having an amino acid sequence of SEQ ID NO:4176, wherein the fourth amino acid is A or S; a VL CDR2 having an amino acid sequence of SEQ ID NO:4177; and a VL CDR3 having an amino acid sequence of SEQ ID NO:4178.

In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4479, wherein the third amino acid is S or T, the sixth amino acid is N or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:4480, wherein the fourth amino acid is I or F, the sixth amino acid is G or S, the seventh amino acid is A or T, the eighth amino acid is A, G, or P; a VH CDR3 having an amino acid sequence of SEQ ID NO:4481, wherein the first amino acid is S or no amino acid in this position, the second amino acid is S, T, or no amino acid in this position, the third amino acid is A, G, or S, the fourth amino acid is G, N, or T, the fifth amino acid is A, G, or S, the sixth amino acid is G, T, or Y, the seventh amino acid is G, T, or V, the eighth amino acid is D, T, or Y, the ninth amino acid is T or Y, the fifteenth amino acid is I or M, the sixteenth amino acid is D or N. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:4482; a VL CDR2 having an amino acid sequence of SEQ ID NO:4483, wherein the first amino acid is E or K, the third amino acid is F or S; and a VL CDR3 having an amino acid sequence of SEQ ID NO:4484, wherein the fifth amino acid is E or Q. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4479, wherein the third amino acid is S or T, the sixth amino acid is N or S; a VH CDR2 having an amino acid sequence of SEQ ID NO:4480, wherein the fourth amino acid is I or F, the sixth amino acid is G or S, the seventh amino acid is A or T, the eighth amino acid is A, G, or P; a VH CDR3 having an amino acid sequence of SEQ ID NO:4481, wherein the first amino acid is S or no amino acid in this position, the second amino acid is S, T, or no amino acid in this position, the third amino acid is A, G, or S, the fourth amino acid is G, N, or T, the fifth amino acid is A, G, or S, the sixth amino acid is G, T, or Y, the seventh amino acid is G, T, or V, the eighth amino acid is D, T, or Y, the ninth amino acid is T or Y, the fifteenth amino acid is I or M, the sixteenth amino acid is D or N; a VL CDR1 having an amino acid sequence of SEQ ID NO:4482; a VL CDR2 having an amino acid sequence of SEQ ID NO:4483, wherein the first amino acid is E or K, the third amino acid is F or S; and a VL CDR3 having an amino acid sequence of SEQ ID NO:4484, wherein the fifth amino acid is E or Q.

In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4241; a VH CDR2 having an amino acid sequence of SEQ ID NO:4242, wherein the seventh amino acid is A or Y; a VH CDR3 having an amino acid sequence of SEQ ID NO:4243, wherein the third amino acid is E or L, the ninth amino acid is I or V. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:4244, wherein the first amino acid is N or S, the fourth amino acid is N or S; a VL CDR2 having an amino acid sequence of SEQ ID NO:4245; and a VL CDR3 having an amino acid sequence of SEQ ID NO:4246, wherein the fifth amino acid is N or S, the tenth amino acid is V or W. In one aspect, provided herein is an antibody that binds TRGDC, comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4241; a VH CDR2 having an amino acid sequence of SEQ ID NO:4242, wherein the seventh amino acid is A or Y; a VH CDR3 having an amino acid sequence of SEQ ID NO:4243, wherein the third amino acid is E or L, the ninth amino acid is I or V; a VL CDR1 having an amino acid sequence of SEQ ID NO:4244, wherein the first amino acid is N or S, the fourth amino acid is N or S; a VL CDR2 having an amino acid sequence of SEQ ID NO:4245; and a VL CDR3 having an amino acid sequence of SEQ ID NO:4246, wherein the fifth amino acid is N or S, the tenth amino acid is V or W.

In another aspect, provided herein is a multispecific antibody that binds TRGV9. In some embodiments, the multispecific antibody is a bispecific antibody. In some embodiments, the multispecific antibody is a trispecific antibody. In some embodiments, the multispecific antibody is a quadraspecific antibody. In one embodiment, the multispecific TRGV9 antibody comprises: (a) a first binding domain that binds TRGV9, and (b) a second binding domain that binds to a second target. In one embodiment, the multispecific TRGV9 antibody comprises: (a) a first binding domain that binds TRGV9, and (b) a second binding domain that binds to a second target, and (c) a third binding domain that binds to a third target. In one embodiment, the multispecific TRGV9 antibody comprises: (a) a first binding domain that binds TRGV9, and (b) a second binding domain that binds to a second target, (c) a third binding domain that binds to a third target, and (d) a fourth binding domain that binds to a fourth target.

In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:31. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:32. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:31; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:32. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:65. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:66. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:65; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:66. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:99. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:100. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:99; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:100. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:133. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:134. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:133; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:134. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:167. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:168. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:167; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:168. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:201. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:202. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:201; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:202. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:235. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:236. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:235; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:236. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:269. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:270. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:269; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:270. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:303. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:304. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:303; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:304. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:337. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:338. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:337; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:338. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:371. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:372. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:371; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:372. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:405. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:406. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:405; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:406. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:439. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:440. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:439; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:440. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:473. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:474. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:473; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:474. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:507. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:508. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:507; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:508. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:541. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:542. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:541; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:542. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:575. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:576. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:575; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:576. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:609. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:610. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:609; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:610. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:643. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:644. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:643; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:644. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:677. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:678. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:677; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:678. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:711. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:712. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:711; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:712. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:745. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:746. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:745; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:746. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:779. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:780. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:779; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:780. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:813. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:814. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:813; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:814. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:847. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:848. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:847; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:848. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:881. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:882. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:881; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:882. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:915. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:916. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:915; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:916. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:949. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:950. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:949; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:950. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:983. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:984. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:983; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:984. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1017. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1018. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1017; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1018. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1051. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1052. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1051; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1052. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1085. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1086. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1085; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1086. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1119. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1120. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1119; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1120. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1153. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1154. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1153; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1154. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1187. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1188. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1187; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1188. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1221. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1222. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1221; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1222. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1255. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1256. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1255; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1256. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1289. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1290. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1289; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1290. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1323. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1324. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1323; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1324. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1357. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1358. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1357; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1358. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1391. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1392. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1391; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1392. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1425. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1426. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1425; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1426. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1459. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1460. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1459; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1460. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1493. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1494. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1493; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1494. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1527. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1528. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1527; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1528. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1561. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1562. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1561; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1562. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1595. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1596. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1595; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1596. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1629. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1630. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1629; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1630. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1663. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1664. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1663; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1664. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1697. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1698. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1697; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1698. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1731. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1732. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1731; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1732. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1765. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1766. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1765; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1766. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1799. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1800. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1799; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1800. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1833. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1834. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1833; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1834. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1867. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1868. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1867; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1868. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1901. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1902. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1901; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1902. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1935. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1936. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1935; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1936. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1969. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1970. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1969; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1970. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2003. In one embodiment, the first binding domain that binds TRGV9 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2004. In one embodiment, the first binding domain that binds TRGV9 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2003; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2004.

In another aspect, provided herein is a multispecific antibody that binds TRDV2. In some embodiments, the multispecific antibody is a bispecific antibody. In some embodiments, the multispecific antibody is a trispecific antibody. In some embodiments, the multispecific antibody is a quadraspecific antibody. In one embodiment, the multispecific TRDV2 antibody comprises: (a) a first binding domain that binds TRDV2, and (b) a second binding domain that binds to a second target. In one embodiment, the multispecific TRDV2 antibody comprises: (a) a first binding domain that binds TRDV2, and (b) a second binding domain that binds to a second target, and (c) a third binding domain that binds to a third target. In one embodiment, the multispecific TRDV2 antibody comprises: (a) a first binding domain that binds TRDV2, and (b) a second binding domain that binds to a second target, (c) a third binding domain that binds to a third target, and (d) a fourth binding domain that binds to a fourth target.

In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2037. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2038. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2037; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2038. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2071. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2072. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2071; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2072. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2105. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2106. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2105; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2106. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2139. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2140. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2139; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2140. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2173. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2174. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2173; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2174. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2207. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2208. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2207; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2208. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2241. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2242. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2241; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2242. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2275. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2276. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2275; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2276. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2309. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2310. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2309; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2310. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2343. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2344. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2343; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2344. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2377. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2378. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2377; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2378. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2411. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2412. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2411; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2412. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2445. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2446. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2445; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2446. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2479. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2480. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2479; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2480. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2513. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2514. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2513; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2514. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2547. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2548. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2547; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2548. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2581. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2582. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2581; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2582. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2615. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2616. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2615; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2616. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2649. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2650. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2649; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2650. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2683. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2684. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2683; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2684. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2717. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2718. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2717; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2718. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2751. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2752. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2751; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2752. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2785. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2786. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2785; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2786. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2819. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2820. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2819; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2820. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2853. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2854. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2853; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2854. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2887. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2888. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2887; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2888. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2921. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2922. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2921; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2922. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2955. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2956. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2955; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2956. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2989. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2990. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2989; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2990. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3023. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3024. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3023; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3024. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3057. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3058. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3057; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3058. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3091. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3092. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3091; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3092. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3125. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3126. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3125; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3126. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3159. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3160. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3159; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3160. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3193. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3194. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3193; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3194. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3227. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3228. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3227; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3228. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3261. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3262. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3261; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3262. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3295. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3296. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3295; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3296. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3329. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3330. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3329; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3330. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3363. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3364. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3363; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3364. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3397. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3398. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3397; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3398. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3431. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3432. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3431; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3432. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3465. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3466. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3465; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3466. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3499. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3500. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3499; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3500. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3533. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3534. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3533; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3534. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3567. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3568. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3567; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3568. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3601. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3602. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3601; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3602. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3635. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3636. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3635; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3636. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3669. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3670. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3669; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3670. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3703. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3704. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3703; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3704. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3737. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3738. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3737; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3738. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3771. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3772. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3771; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3772. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3805. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3806. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3805; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3806. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3839. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3840. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3839; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3840. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3873. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3874. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3873; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3874. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3907. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3908. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3907; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3908. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3941. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3942. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3941; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3942. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3975. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3976. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3975; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3976. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4009. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4010. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4009; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4010. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4043. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4044. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4043; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4044. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4077. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4078. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4077; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4078. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4111. In one embodiment, the first binding domain that binds TRDV2 comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4112. In one embodiment, the first binding domain that binds TRDV2 comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4111; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4112.

In another aspect, provided herein is a multispecific antibody that binds TRGDC. In some embodiments, the multispecific antibody is a bispecific antibody. In some embodiments, the multispecific antibody is a trispecific antibody. In some embodiments, the multispecific antibody is a quadraspecific antibody. In one embodiment, the multispecific TRGDC antibody comprises: (a) a first binding domain that binds TRGDC, and (b) a second binding domain that binds to a second target. In one embodiment, the multispecific TRGDC antibody comprises: (a) a first binding domain that binds TRGDC, and (b) a second binding domain that binds to a second target, and (c) a third binding domain that binds to a third target. In one embodiment, the multispecific TRGDC antibody comprises: (a) a first binding domain that binds TRGDC, and (b) a second binding domain that binds to a second target, (c) a third binding domain that binds to a third target, and (d) a fourth binding domain that binds to a fourth target.

In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4145. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4146. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4145; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4146. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4179. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4180. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4179; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4180. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4213. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4214. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4213; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4214. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4247. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4248. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4247; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4248. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4281. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4282. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4281; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4282. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4315. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4316. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4315; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4316. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4349. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4350. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4349; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4350. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4383. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4384. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4383; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4384. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4417. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4418. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4417; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4418. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4451. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4452. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4451; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4452. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4485. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4486. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4485; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4486. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4519. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4520. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4519; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4520. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4553. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4554. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4553; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4554. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4587. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4588. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4587; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4588. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4621. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4622. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4621; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4622. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4655. In one embodiment, the first binding domain that binds TRGDC comprises: a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4656. In one embodiment, the first binding domain that binds TRGDC comprises: a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4655; and a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4656.

In some embodiments, a multispecific antibody provided herein is a diabody, a cross-body, or a multispecific antibody obtained via a controlled Fab arm exchange as those described herein.

In some embodiments, the multispecific antibodies include IgG-like molecules with complementary CH3 domains that promote heterodimerization; recombinant IgG-like dual targeting molecules, wherein the two sides of the molecule each contain the Fab fragment or part of the Fab fragment of at least two different antibodies; IgG fusion molecules, wherein full length IgG antibodies are fused to an extra Fab fragment or parts of Fab fragment; Fc fusion molecules, wherein single chain Fv molecules or stabilized diabodies are fused to heavy-chain constant-domains, Fc-regions or parts thereof; Fab fusion molecules, wherein different Fab-fragments are fused together; ScFv- and diabody-based and heavy chain antibodies (e.g., domain antibodies, nanobodies) wherein different single chain Fv molecules or different diabodies or different heavy-chain antibodies (e.g. domain antibodies, nanobodies) are fused to each other or to another protein or carrier molecule.

In some embodiments, IgG-like molecules with complementary CH3 domains molecules include the Triomab/Quadroma (Trion Pharma/Fresenius Biotech), the Knobs-into-Holes (Genentech), CrossMAbs (Roche) and the electrostatically-matched (Amgen), the LUZ-Y (Genentech), the Strand Exchange Engineered Domain body (SEEDbody) (EMD Serono), the Biclonic (Merus) and the DuoBody (Genmab A/S).

In some embodiments, recombinant IgG-like dual targeting molecules include Dual Targeting (DT)-Ig (GSK/Domantis), Two-in-one Antibody (Genentech), Cross-linked Mabs (Karmanos Cancer Center), mAb2 (F-Star) and CovX-body (CovX/Pfizer).

In some embodiments, IgG fusion molecules include Dual Variable Domain (DVD)-Ig (Abbott), IgG-like Bispecific (ImClone/Eli Lilly), Ts2Ab (Medlmmune/AZ) and BsAb (Zymogenetics), HERCULES (Biogen Idec) and TvAb (Roche).

In some embodiments, Fc fusion molecules can include ScFv/Fc Fusions (Academic Institution), SCORPION (Emergent BioSolutions/Trubion, Zymogenetics/BMS), Dual Affinity Retargeting Technology (Fc-DART) (MacroGenics) and Dual(ScFv)₂-Fab (National Research Center for Antibody Medicine—China).

In some embodiments, Fab fusion bispecific antibodies include F(ab)₂ (Medarex/AMGEN), Dual-Action or Bis-Fab (Genentech), Dock-and-Lock (DNL) (ImmunoMedics), Bivalent Bispecific (Biotecnol) and Fab-Fv (UCB-Celltech). ScFv-, diabody-based, and domain antibodies, include but are not limited to, Bispecific T Cell Engager (BiTE) (Micromet), Tandem Diabody (Tandab) (Affimed), Dual Affinity Retargeting Technology (DART) (MacroGenics), Single-chain Diabody (Academic), TCR-like Antibodies (AIT, ReceptorLogics), Human Serum Albumin ScFv Fusion (Merrimack) and COMBODY (Epigen Biotech), dual targeting nanobodies (Ablynx), dual targeting heavy chain only domain antibodies.

Full length bispecific antibodies provided herein can be generated for example using Fab arm exchange (or half molecule exchange) between two mono specific bivalent antibodies by introducing substitutions at the heavy chain CH3 interface in each half molecule to favor heterodimer formation of two antibody half molecules having distinct specificity either in vitro in cell-free environment or using co-expression. The Fab arm exchange reaction is the result of a disulfide-bond isomerization reaction and dissociation-association of CH3 domains. The heavy-chain disulfide bonds in the hinge regions of the parent mono specific antibodies are reduced. The resulting free cysteines of one of the parent monospecific antibodies form an inter heavy-chain disulfide bond with cysteine residues of a second parent mono specific antibody molecule and simultaneously CH3 domains of the parent antibodies release and reform by dissociation-association. The CH3 domains of the Fab arms can be engineered to favor heterodimerization over homodimerization. The resulting product is a bispecific antibody having two Fab arms or half molecules which each binding a distinct epitope, e.g., an epitope on CD8 and an epitope on CD4. Other methods of making multispecific antibodies are known and contemplated.

“Homodimerization” as used herein refers to an interaction of two heavy chains having identical CH3 amino acid sequences. “Homodimer” as used herein refers to an antibody having two heavy chains with identical CH3 amino acid sequences.

“Heterodimerization” as used herein refers to an interaction of two heavy chains having non-identical CH3 amino acid sequences. “Heterodimer” as used herein refers to an antibody having two heavy chains with non-identical CH3 amino acid sequences.

The “knob-in-hole” strategy (see, e.g., PCT Publ. No. WO2006/028936) can be used to generate full length bispecific antibodies. Briefly, selected amino acids forming the interface of the CH3 domains in human IgG can be mutated at positions affecting CH3 domain interactions to promote heterodimer formation. An amino acid with a small side chain (hole) is introduced into a heavy chain of an antibody specifically binding a first antigen and an amino acid with a large side chain (knob) is introduced into a heavy chain of an antibody specifically binding a second antigen. After co-expression of the two antibodies, a heterodimer is formed as a result of the preferential interaction of the heavy chain with a “hole” with the heavy chain with a “knob.” Exemplary CH3 substitution pairs forming a knob and a hole are (expressed as modified position in the first CH3 domain of the first heavy chain/modified position in the second CH3 domain of the second heavy chain): T366Y/F405A, T366W/F405W, F405W/Y407A, T394W/Y407T, T394S/Y407A, T366W/T394S, F405W/T394S and T366W/T366S_L368A_Y407V.

Other strategies such as promoting heavy chain heterodimerization using electrostatic interactions by substituting positively charged residues at one CH3 surface and negatively charged residues at a second CH3 surface can be used, as described in US Pat. Publ. No. US2010/0015133; US Pat. Publ. No. US2009/0182127; US Pat. Publ. No. US2010/028637; or US Pat. Publ. No. US2011/0123532. In other strategies, heterodimerization can be promoted by the following substitutions (expressed as modified position in the first CH3 domain of the first heavy chain/modified position in the second CH3 domain of the second heavy chain): L351Y_F405AY407V/T394W, T3661_K392M_T394W/F405A_Y407V, T366L_K392M_T394W/F405A_Y407V, L351Y_Y407A/T366A_K409F, L351Y_Y407A/T366V K409F Y407A/T366A_K409F, or T350V_L351Y_F405A Y407V/T350V_T366L_K392L_T394W as described in U.S. Pat. Publ. No. US2012/0149876 or U.S. Pat. Publ. No. US2013/0195849.

In addition to methods described above, bispecific antibodies provided herein can be generated in vitro in a cell-free environment by introducing asymmetrical mutations in the CH3 regions of two mono specific homodimeric antibodies and forming the bispecific heterodimeric antibody from two parent monospecific homodimeric antibodies in reducing conditions to allow disulfide bond isomerization according to methods described in PCT Pat. Publ. No. WO2011/131746. In the methods, the first monospecific bivalent antibody and the second monospecific bivalent antibody are engineered to have certain substitutions at the CH3 domain that promotes heterodimer stability; the antibodies are incubated together under reducing conditions sufficient to allow the cysteines in the hinge region to undergo disulfide bond isomerization; thereby generating the bispecific antibody by Fab arm exchange. The incubation conditions can optionally be restored to non-reducing conditions. Exemplary reducing agents that can be used are 2-mercaptoethylamine (2-MEA), dithiothreitol (DTT), dithioerythritol (DTE), glutathione, tris (2-carboxyethyl) phosphine (TCEP), L-cysteine and beta-mercaptoethanol, preferably a reducing agent selected from the group consisting of: 2-mercaptoethylamine, dithiothreitol and tris (2-carboxyethyl) phosphine. For example, incubation for at least 90 min at a temperature of at least 20° C. in the presence of at least 25 mM 2-MEA or in the presence of at least 0.5 mM dithiothreitol at a pH from 5-8, for example at pH of 7.0 or at pH of 7.4 can be used.

In some embodiments, the TRGV9 antibody comprises a single chain antibody. In some embodiments, the TRGV9 antibody comprises a single domain antibody. In certain embodiments, the TRGV9 antibody comprises a nanobody. In certain embodiments, the TRGV9 antibody comprises a VHH antibody. In certain embodiments, the TRGV9 antibody comprises a llama antibody. In some embodiments, the TRGV9 antibody does not comprise a single chain antibody. In some embodiments, the TRGV9 antibody does not comprise a single domain antibody. In certain embodiments, the TRGV9 antibody does not comprise a nanobody. In certain embodiments, the TRGV9 antibody does not comprise a VHH antibody. In certain embodiments, the TRGV9 antibody does not comprise a llama antibody.

In some embodiments, the TRGV9 multispecific antibody comprises a single chain antibody. In some embodiments, the TRGV9 multispecific antibody comprises a single domain antibody. In certain embodiments, the TRGV9 multispecific antibody comprises a nanobody. In certain embodiments, the TRGV9 multispecific antibody comprises a VHH antibody. In certain embodiments, the TRGV9 multispecific antibody comprises a llama antibody. In some embodiments, the TRGV9 multispecific antibody does not comprise a single chain antibody. In some embodiments, the TRGV9 multispecific antibody does not comprise a single domain antibody. In certain embodiments, the TRGV9 multispecific antibody does not comprise a nanobody. In certain embodiments, the TRGV9 multispecific antibody does not comprise a VHH antibody. In certain embodiments, the TRGV9 multispecific antibody does not comprise a llama antibody.

According to another particular aspect, provided herein is a TRGV9 antibody or antigen-binding fragment thereof that induces antibody-dependent cell-mediated cytotoxicity (ADCC). The antibody or antigen-binding fragment thereof can, for example, induce ADCC in vitro.

In certain embodiments, the antibody or antigen-binding fragment thereof induces T cell dependent cytotoxicity of a second cell in vitro with an EC₅₀ of less than about 160 pM, when assessed in vitro at an effector to target cell ratio of 1:1.

In some embodiments, TRGV9 is present on the surface of a T cell. In some embodiments, the TRGV9 is present on the surface of a T cell, and the second target antigen is on the surface of a second cell. In some embodiments, the second cell is killed when the multispecific antibody binds to the TRGV9 on the surface of the T cell and the second target antigen on the surface of the second cell.

In some embodiments, the TRDV2 antibody comprises a single chain antibody. In some embodiments, the TRDV2 antibody comprises a single domain antibody. In certain embodiments, the TRDV2 antibody comprises a nanobody. In certain embodiments, the TRDV2 antibody comprises a VHH antibody. In certain embodiments, the TRDV2 antibody comprises a llama antibody. In some embodiments, the TRDV2 antibody does not comprise a single chain antibody. In some embodiments, the TRDV2 antibody does not comprise a single domain antibody. In certain embodiments, the TRDV2 antibody does not comprise a nanobody. In certain embodiments, the TRDV2 antibody does not comprise a VHH antibody. In certain embodiments, the TRDV2 antibody does not comprise a llama antibody.

In some embodiments, the TRDV2 multispecific antibody comprises a single chain antibody. In some embodiments, the TRDV2 multispecific antibody comprises a single domain antibody. In certain embodiments, the TRDV2 multispecific antibody comprises a nanobody. In certain embodiments, the TRDV2 multispecific antibody comprises a VHH antibody. In certain embodiments, the TRDV2 multispecific antibody comprises a llama antibody. In some embodiments, the TRDV2 multispecific antibody does not comprise a single chain antibody. In some embodiments, the TRDV2 multispecific antibody does not comprise a single domain antibody. In certain embodiments, the TRDV2 multispecific antibody does not comprise a nanobody. In certain embodiments, the TRDV2 multispecific antibody does not comprise a VHH antibody. In certain embodiments, the TRDV2 multispecific antibody does not comprise a llama antibody.

According to another particular aspect, provided herein is a TRDV2 antibody or antigen-binding fragment thereof that induces antibody-dependent cell-mediated cytotoxicity (ADCC). The antibody or antigen-binding fragment thereof can, for example, induce ADCC in vitro.

In certain embodiments, the antibody or antigen-binding fragment thereof induces T cell dependent cytotoxicity of a second cell in vitro with an EC₅₀ of less than about 160 pM, when assessed in vitro at an effector to target cell ratio of 1:1.

In some embodiments, TRDV2 is present on the surface of a T cell. In some embodiments, the TRDV2 is present on the surface of a T cell, and the second target antigen is on the surface of a second cell. In some embodiments, the second cell is killed when the multispecific antibody binds to the TRDV2 on the surface of the T cell and the second target antigen on the surface of the second cell.

In some embodiments, the TRGDC antibody comprises a single chain antibody. In some embodiments, the TRGDC antibody comprises a single domain antibody. In certain embodiments, the TRGDC antibody comprises a nanobody. In certain embodiments, the TRGDC antibody comprises a VHH antibody. In certain embodiments, the TRGDC antibody comprises a llama antibody. In some embodiments, the TRGDC antibody does not comprise a single chain antibody. In some embodiments, the TRGDC antibody does not comprise a single domain antibody. In certain embodiments, the TRGDC antibody does not comprise a nanobody. In certain embodiments, the TRGDC antibody does not comprise a VHH antibody. In certain embodiments, the TRGDC antibody does not comprise a llama antibody.

In some embodiments, the TRGDC multispecific antibody comprises a single chain antibody. In some embodiments, the TRGDC multispecific antibody comprises a single domain antibody. In certain embodiments, the TRGDC multispecific antibody comprises a nanobody. In certain embodiments, the TRGDC multispecific antibody comprises a VHH antibody. In certain embodiments, the TRGDC multispecific antibody comprises a llama antibody. In some embodiments, the TRGDC multispecific antibody does not comprise a single chain antibody. In some embodiments, the TRGDC multispecific antibody does not comprise a single domain antibody. In certain embodiments, the TRGDC multispecific antibody does not comprise a nanobody. In certain embodiments, the TRGDC multispecific antibody does not comprise a VHH antibody. In certain embodiments, the TRGDC multispecific antibody does not comprise a llama antibody.

According to another particular aspect, provided herein is a TRGDC antibody or antigen-binding fragment thereof that induces antibody-dependent cell-mediated cytotoxicity (ADCC). The antibody or antigen-binding fragment thereof can, for example, induce ADCC in vitro.

In certain embodiments, the antibody or antigen-binding fragment thereof induces T cell dependent cytotoxicity of a second cell in vitro with an EC₅₀ of less than about 160 pM, when assessed in vitro at an effector to target cell ratio of 1:1.

In some embodiments, TRGDC is present on the surface of a T cell. In some embodiments, the TRGDC is present on the surface of a T cell, and the second target antigen is on the surface of a second cell. In some embodiments, the second cell is killed when the multispecific antibody binds to the TRGDC on the surface of the T cell and the second target antigen on the surface of the second cell.

In some embodiments, the multispecific antibody induces T cell dependent cytotoxicity of the second cell in vitro with an EC₅₀ of less than about 500 pM. In some embodiments, the multispecific antibody induces T cell dependent cytotoxicity of the second cell in vitro with an EC₅₀ of less than about 300 pM. In some embodiments, the multispecific antibody induces γδ T cell dependent cytotoxicity of the second cell in vitro with an EC₅₀ of less than about 160 pM. In some embodiments, the EC₅₀ is assessed with a mixture of γδ T effector cells and target cells expressing the second target antigen. In some embodiments, the effector cell to target cell ratio is about 0.01 to 1 to about 5 to 1. In some embodiments, the effector cell to target cell ratio is about 0.1 to 1 to about 2 to 1. In some embodiments, the effector cell to target cell ratio is about 1:1.

In certain embodiments, the EC₅₀ is less than about 1000 pM, less than about 900 pM, less than about 800 pM, less than about 700 pM, less than about 600 pM, less than about 500 pM, less than about 400 pM, less than about 300 pM, less than about 200 pM, less than about 190 pM, less than about 180 pM, less than about 170 pM, less than about 160 pM, less than about 150 pM, less than about 140 pM, less than about 130 pM, less than about 120 pM, less than about 110 pM, less than about 100 pM, less than about 90 pM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, or less than about 10 pM.

In certain embodiments, the effector to target cell ratio can, for example, be 0.01:1, 0.02:1, 0.03:1, 0.04:1, 0.05:1, 0.06:1, 0.07:1, 0.08:1, 0.09:1, 1:1, 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, or 10:1. In certain embodiments, the effector to target cell ratio can, for example, be between 0.01:1 and 10:1. In certain embodiments, the concentration of the multispecific antibody or antigen-binding fragment thereof is about 0.000005 ng/mL, about 0.00005 ng/mL, about 0.0005, about 0.005 ng/mL, about 0.01 ng/mL, about 0.02 ng/mL, about 0.03 ng/mL, about 0.04 ng/mL, about 0.05 ng/mL, about 0.06 ng/mL, about 0.07 ng/mL, about 0.08 ng/mL, about 0.09 ng/mL, about 0.1 ng/mL, about 0.5 ng/mL, about 1.0 ng/mL, about 10 ng/mL, about 20 ng/mL about, about 30 ng/mL about 40 ng/mL, about 50 ng/mL, about 60 ng/mL, about 70 ng/mL, about 80 ng/mL, about 90 ng/mL, about 100 ng/mL, or about 1000 ng/mL. In certain embodiments, the concentration of the multispecific antibody or antigen-binding fragment thereof is between about 0.000005 ng/mL and about 1000 ng/mL.

In another aspect, provided herein is an antibody that competes for binding to TRGV9 with any of the TRGV9 antibodies described herein. In another aspect, provided herein is an antibody that binds to the same epitope as any of the TRGV9 antibodies described herein. In another aspect, provided is a TRGV9 antibody that binds an epitope on TRGV9 that overlaps with the epitope on TRGV9 bound by a TRGV9 antibody described herein. In some embodiments, the TRGV9 antibody comprises a VH CDR1, VH CDR2, and VH CDR3 of a TRGV9 antibody provided herein. In some embodiments, the TRGV9 antibody comprises a VL CDR1, VL CDR2, and VL CDR3 of a TRGV9 antibody provided herein. In some embodiments, the TRGV9 antibody comprises a VH CDR1, VH CDR2, VH CDR3, a VL CDR1, VL CDR2, and VL CDR3 of a TRGV9 antibody provided herein. In some embodiments, the TRGV9 antibody comprises a VH of a TRGV9 antibody provided herein. In some embodiments, the TRGV9 antibody comprises a VL of a TRGV9 antibody provided herein. In some embodiments, the TRGV9 antibody comprises a VH and a VL of a TRGV9 antibody provided herein. In some embodiments, the TRGV9 antibody comprises a VH CDR1, VH CDR2, VH CDR3, a VL CDR1, VL CDR2, and VL CDR3 of a TRGV9 antibody provided herein. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 antibody are according to the Kabat numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 antibody are according to the Chothia numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 antibody are according to the AbM numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 antibody are according to the Contact numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 antibody are according to the IMGT numbering system. In certain embodiments, the TRGV9 antibody is a multispecific antibody. In some embodiments, the TRGV9 antibody is a bispecific antibody.

In another aspect, provided is an antibody that competes for binding to TRGV9 with a TRGV9 reference antibody. In another aspect, provided is a TRGV9 antibody that binds to the same TRGV9 epitope as a TRGV9 reference antibody. In another aspect, provided is a TRGV9 antibody that binds an epitope on TRGV9 that overlaps with the epitope on TRGV9 bound by a TRGV9 reference antibody. In some embodiments, the TRGV9 reference antibody comprises a VH CDR1, VH CDR2, and VH CDR3 of a TRGV9 reference antibody provided herein. In some embodiments, the TRGV9 reference antibody comprises a VL CDR1, VL CDR2, and VL CDR3 of a TRGV9 reference antibody provided herein. In some embodiments, the TRGV9 reference antibody comprises a VH CDR1, VH CDR2, VH CDR3, a VL CDR1, VL CDR2, and VL CDR3 of a TRGV9 reference antibody provided herein. In some embodiments, the TRGV9 reference antibody comprises a VH of a TRGV9 reference antibody provided herein. In some embodiments, the TRGV9 reference antibody comprises a VL of a TRGV9 reference antibody provided herein. In some embodiments, the TRGV9 reference antibody comprises a VH and a VL of a TRGV9 reference antibody provided herein. In some embodiments, the TRGV9 reference antibody comprises a VH CDR1, VH CDR2, VH CDR3, a VL CDR1, VL CDR2, and VL CDR3 of a TRGV9 reference antibody provided herein. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 reference antibody are according to the Kabat numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 reference antibody are according to the Chothia numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 reference antibody are according to the AbM numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 reference antibody are according to the Contact numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGV9 reference antibody are according to the IMGT numbering system. In certain embodiments, the antibody is a multispecific antibody. In some embodiments, the antibody is a bispecific antibody. In certain embodiments, the TRGV9 reference antibody is a multispecific antibody. In some embodiments, the TRGV9 reference antibody is a bispecific antibody.

In another aspect, provided herein is an antibody that competes for binding to TRDV2 with any of the TRDV2 antibodies described herein. In another aspect, provided herein is an antibody that binds to the same epitope as any of the TRDV2 antibodies described herein. In another aspect, provided is a TRDV2 antibody that binds an epitope on TRDV2 that overlaps with the epitope on TRDV2 bound by a TRDV2 antibody described herein. In some embodiments, the TRDV2 antibody comprises a VH CDR1, VH CDR2, and VH CDR3 of a TRDV2 antibody provided herein. In some embodiments, the TRDV2 antibody comprises a VL CDR1, VL CDR2, and VL CDR3 of a TRDV2 antibody provided herein. In some embodiments, the TRDV2 antibody comprises a VH CDR1, VH CDR2, VH CDR3, a VL CDR1, VL CDR2, and VL CDR3 of a TRDV2 antibody provided herein. In some embodiments, the TRDV2 antibody comprises a VH of a TRDV2 antibody provided herein. In some embodiments, the TRDV2 antibody comprises a VL of a TRDV2 antibody provided herein. In some embodiments, the TRDV2 antibody comprises a VH and a VL of a TRDV2 antibody provided herein. In some embodiments, the TRDV2 antibody comprises a VH CDR1, VH CDR2, VH CDR3, a VL CDR1, VL CDR2, and VL CDR3 of a TRDV2 antibody provided herein. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 antibody are according to the Kabat numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 antibody are according to the Chothia numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 antibody are according to the AbM numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 antibody are according to the Contact numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 antibody are according to the IMGT numbering system. In certain embodiments, the TRDV2 antibody is a multispecific antibody. In some embodiments, the TRDV2 antibody is a bispecific antibody.

In another aspect, provided is an antibody that competes for binding to TRDV2 with a TRDV2 reference antibody. In another aspect, provided is a TRDV2 antibody that binds to the same TRDV2 epitope as a TRDV2 reference antibody. In another aspect, provided is a TRDV2 antibody that binds an epitope on TRDV2 that overlaps with the epitope on TRDV2 bound by a TRDV2 reference antibody. In some embodiments, the TRDV2 reference antibody comprises a VH CDR1, VH CDR2, and VH CDR3 of a TRDV2 reference antibody provided herein. In some embodiments, the TRDV2 reference antibody comprises a VL CDR1, VL CDR2, and VL CDR3 of a TRDV2 reference antibody provided herein. In some embodiments, the TRDV2 reference antibody comprises a VH CDR1, VH CDR2, VH CDR3, a VL CDR1, VL CDR2, and VL CDR3 of a TRDV2 reference antibody provided herein. In some embodiments, the TRDV2 reference antibody comprises a VH of a TRDV2 reference antibody provided herein. In some embodiments, the TRDV2 reference antibody comprises a VL of a TRDV2 reference antibody provided herein. In some embodiments, the TRDV2 reference antibody comprises a VH and a VL of a TRDV2 reference antibody provided herein. In some embodiments, the TRDV2 reference antibody comprises a VH CDR1, VH CDR2, VH CDR3, a VL CDR1, VL CDR2, and VL CDR3 of a TRDV2 reference antibody provided herein. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 reference antibody are according to the Kabat numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 reference antibody are according to the Chothia numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 reference antibody are according to the AbM numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 reference antibody are according to the Contact numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRDV2 reference antibody are according to the IMGT numbering system. In certain embodiments, the antibody is a multispecific antibody. In some embodiments, the antibody is a bispecific antibody. In certain embodiments, the TRDV2 reference antibody is a multispecific antibody. In some embodiments, the TRDV2 reference antibody is a bispecific antibody.

In another aspect, provided herein is an antibody that competes for binding to TRGDC with any of the TRGDC antibodies described herein. In another aspect, provided herein is an antibody that binds to the same epitope as any of the TRGDC antibodies described herein. In another aspect, provided is a TRGDC antibody that binds an epitope on TRGDC that overlaps with the epitope on TRGDC bound by a TRGDC antibody described herein. In some embodiments, the TRGDC antibody comprises a VH CDR1, VH CDR2, and VH CDR3 of a TRGDC antibody provided herein. In some embodiments, the TRGDC antibody comprises a VL CDR1, VL CDR2, and VL CDR3 of a TRGDC antibody provided herein. In some embodiments, the TRGDC antibody comprises a VH CDR1, VH CDR2, VH CDR3, a VL CDR1, VL CDR2, and VL CDR3 of a TRGDC antibody provided herein. In some embodiments, the TRGDC antibody comprises a VH of a TRGDC antibody provided herein. In some embodiments, the TRGDC antibody comprises a VL of a TRGDC antibody provided herein. In some embodiments, the TRGDC antibody comprises a VH and a VL of a TRGDC antibody provided herein. In some embodiments, the TRGDC antibody comprises a VH CDR1, VH CDR2, VH CDR3, a VL CDR1, VL CDR2, and VL CDR3 of a TRGDC 30 antibody provided herein. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC antibody are according to the Kabat numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC antibody are according to the Chothia numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC antibody are according to the AbM numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC antibody are according to the Contact numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC antibody are according to the IMGT numbering system. In certain embodiments, the TRGDC antibody is a multispecific antibody. In some embodiments, the TRGDC antibody is a bispecific antibody.

In another aspect, provided is an antibody that competes for binding to TRGDC with a TRGDC reference antibody. In another aspect, provided is a TRGDC antibody that binds to the same TRGDC epitope as a TRGDC reference antibody. In another aspect, provided is a TRGDC antibody that binds an epitope on TRGDC that overlaps with the epitope on TRGDC bound by a TRGDC reference antibody. In some embodiments, the TRGDC reference antibody comprises a VH CDR1, VH CDR2, and VH CDR3 of a TRGDC reference antibody provided herein. In some embodiments, the TRGDC reference antibody comprises a VL CDR1, VL CDR2, and VL CDR3 of a TRGDC reference antibody provided herein. In some embodiments, the TRGDC reference antibody comprises a VH CDR1, VH CDR2, VH CDR3, a VL CDR1, VL CDR2, and VL CDR3 of a TRGDC reference antibody provided herein. In some embodiments, the TRGDC reference antibody comprises a VH of a TRGDC reference antibody provided herein. In some embodiments, the TRGDC reference antibody comprises a VL of a TRGDC reference antibody provided herein. In some embodiments, the TRGDC reference antibody comprises a VH and a VL of a TRGDC reference antibody provided herein. In some embodiments, the TRGDC reference antibody comprises a VH CDR1, VH CDR2, VH CDR3, a VL CDR1, VL CDR2, and VL CDR3 of a TRGDC reference antibody provided herein. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC reference antibody are according to the Kabat numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC reference antibody are according to the Chothia numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC reference antibody are according to the AbM numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC reference antibody are according to the Contact numbering system. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences of the TRGDC reference antibody are according to the IMGT numbering system. In certain embodiments, the antibody is a multispecific antibody. In some embodiments, the antibody is a bispecific antibody. In certain embodiments, the TRGDC reference antibody is a multispecific antibody. In some embodiments, the TRGDC reference antibody is a bispecific antibody.

In some embodiments described herein, immune effector properties of the antibodies provided herein can be enhanced or silenced through Fc modifications by techniques known to those skilled in the art. For example, Fc effector functions such as Clq binding, complement dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cell-mediated phagocytosis (ADCP), down regulation of cell surface receptors (e.g., B cell receptor; BCR), etc. can be provided and/or controlled by modifying residues in the Fc responsible for these activities.

“Antibody-dependent cell-mediated cytotoxicity” or “ADCC” refers to a cell-mediated reaction in which non-specific cytotoxic cells that express Fc receptors (FcRs) (e.g. Natural Killer (NK) cells, neutrophils, and macrophages) recognize bound antibody on a target cell and subsequently cause lysis of the target cell.

The ability of antibodies to induce ADCC can be enhanced by engineering their oligosaccharide component. Human IgG1 or IgG3 are N-glycosylated at Asn297 with the majority of the glycans in the well-known biantennary G0, G0F, G1, G1F, G2 or G2F forms. Antibodies produced by non-engineered CHO cells typically have a glycan fucose content of about at least 85%. The removal of the core fucose from the biantennary complex-type oligosaccharides attached to the Fc regions enhances the ADCC of antibodies via improved FcγRIIIa binding without altering antigen binding or CDC activity. Such Abs can be achieved using different methods reported to lead to the successful expression of relatively high defucosylated antibodies bearing the biantennary complex-type of Fc oligosaccharides such as control of culture osmolality (Konno et al., Cytotechnology 64:249-65, 2012), application of a variant CHO line Lec13 as the host cell line (Shields et al., J Biol Chem 277:26733-26740, 2002), application of a variant CHO line EB66 as the host cell line (Olivier et al., MAbs; 2(4), 2010; Epub ahead of print; PMID:20562582), application of a rat hybridoma cell line YB2/0 as the host cell line (Shinkawa et al., J Biol Chem 278:3466-3473, 2003), introduction of small interfering RNA specifically against the α-1,6-fucosyltrasferase (FUT8) gene (Mori et al., Biotechnol Bioeng 88:901-908, 2004), or coexpression of β-1,4-N-acetylglucosaminyltransferase III and golgi α-mannosidase II or a potent alpha-mannosidase I inhibitor, kifunensine (Ferrara et al., J Biol Chem 281:5032-5036, 2006, Ferrara et al., Biotechnol Bioeng 93:851-861, 2006; Xhou et al., Biotechnol Bioeng 99:652-65, 2008).

In some embodiments described herein, ADCC elicited by the antibodies provided herein can also be enhanced by certain substitutions in the antibody Fc. Exemplary substitutions are for example substitutions at amino acid positions 256, 290, 298, 312, 356, 330, 333, 334, 360, 378 or 430 (residue numbering according to the EU index) as described in U.S. Pat. No. 6,737,056.

In some embodiments, a TRGV9 antibody provided herein is chimeric. In some embodiments, a TRGV9 antibody provided herein is human. In some embodiments, a TRGV9 antibody provided herein is humanized. In certain embodiments, a TRGV9 antibody provided herein is an isolated TRGV9 antibody. In some embodiments, a TRGV9 antigen binding fragment provided herein is chimeric. In some embodiments, a TRGV9 antigen binding fragment provided herein is human. In some embodiments, a TRGV9 antigen binding fragment provided herein is humanized. In certain embodiments, a TRGV9 antigen binding fragment provided herein is an isolated TRGV9 antigen binding fragment. In some embodiments, a TRGV9 antibody provided herein is an IgG antibody. In some embodiments, the IgG antibody is an IgG1 antibody. In some embodiments, the IgG antibody is an IgG2 antibody. In some embodiments, the IgG antibody is an IgG3 antibody. In some embodiments, the IgG antibody is an IgG4 antibody. In some embodiments, a TRGV9 antibody provided herein is multivalent. In some embodiments, the antibody is capable of binding at least three antigens. In some embodiments, a TRGV9 antibody provided herein is multivalent. In some embodiments, the antibody is capable of binding at least four antigens. In some embodiments, the antibody is capable of binding at least five antigens.

In some embodiments, a TRGV9 multispecific antibody provided herein is chimeric. In some embodiments, a TRGV9 multispecific antibody provided herein is human. In some embodiments, a TRGV9 multispecific antibody provided herein is humanized. In certain embodiments, a TRGV9 multispecific antibody provided herein is an isolated TRGV9 multispecific antibody. In some embodiments, a TRGV9 multispecific antibody comprising a TRGV9 antigen binding fragment provided herein is chimeric. In some embodiments, a TRGV9 multispecific antibody comprising a TRGV9 antigen binding fragment provided herein is human. In some embodiments, a TRGV9 multispecific antibody comprising a TRGV9 antigen binding fragment provided herein is humanized. In certain embodiments, a TRGV9 multispecific antibody comprising a TRGV9 antigen binding fragment provided herein is an isolated TRGV9 multispecific antibody.

In some embodiments of the TRGV9 multispecific antibodies provided herein, the first binding domain is human. In some embodiments, the second binding domain is human. In some embodiments of the TRGV9 multispecific antibodies provided herein, both the first binding domain and the second binding domain are human. In some embodiments of the TRGV9 multispecific antibodies provided herein, the first binding domain is humanized. In some embodiments of the TRGV9 multispecific antibodies provided herein, the second binding domain is humanized. In some embodiments of the TRGV9 multispecific antibodies provided herein, both the first binding domain and the second binding domain are humanized. In some embodiments of the TRGV9 multispecific antibodies provided herein, both the first binding domain is human and the second binding domain is humanized. In some embodiments of the TRGV9 multispecific antibodies provided herein, both the first binding domain is humanized and the second binding domain is human.

In some embodiments, a TRGV9 multispecific antibody provided herein is multivalent. In some embodiments, the multispecific antibody is capable of binding at least three antigens. In some embodiments, the multispecific antibody is capable of binding at least five antigens. In certain embodiments, the multispecific antibody is a multispecific antibody. In some embodiments, a TRGV9 multispecific antibody provided herein is an IgG antibody. In some embodiments, the IgG antibody is an IgG1 antibody. In some embodiments, the IgG antibody is an IgG2 antibody. In some embodiments, the IgG antibody is an IgG3 antibody. In some embodiments, the IgG antibody is an IgG4 antibody.

In certain embodiments, the antibodies provided herein are part of a multispecific antibody. In some embodiments, the multispecific antibody comprises a first binding domain that binds to a TRGV9 antigen. In some embodiments, the multispecific antibody comprises a first binding domain that binds to a TRGV9 antigen and comprises a second binding domain that binds to a second target antigen, as provided herein. In certain embodiments, the multispecific antibody binds to a TRGV9 antigen, a second target antigen, and one or more additional antigens. In some embodiments of the various antibodies provided herein, the antibody binds to an epitope of a given antigen.

In some embodiments, a TRDV2 antibody provided herein is chimeric. In some embodiments, a TRDV2 antibody provided herein is human. In some embodiments, a TRDV2 antibody provided herein is humanized. In certain embodiments, a TRDV2 antibody provided herein is an isolated TRDV2 antibody. In some embodiments, a TRDV2 antigen binding fragment provided herein is chimeric. In some embodiments, a TRDV2 antigen binding fragment provided herein is human. In some embodiments, a TRDV2 antigen binding fragment provided herein is humanized. In certain embodiments, a TRDV2 antigen binding fragment provided herein is an isolated TRDV2 antigen binding fragment. In some embodiments, a TRDV2 antibody provided herein is an IgG antibody. In some embodiments, the IgG antibody is an IgG1 antibody. In some embodiments, the IgG antibody is an IgG2 antibody. In some embodiments, the IgG antibody is an IgG3 antibody. In some embodiments, the IgG antibody is an IgG4 antibody. In some embodiments, a TRDV2 antibody provided herein is multivalent. In some embodiments, the antibody is capable of binding at least three antigens. In some embodiments, the antibody is capable of binding at least four antigens. In some embodiments, the antibody is capable of binding at least five antigens.

In some embodiments, a TRDV2 multispecific antibody provided herein is 15 chimeric. In some embodiments, a TRDV2 multispecific antibody provided herein is human. In some embodiments, a TRDV2 multispecific antibody provided herein is humanized. In certain embodiments, a TRDV2 multispecific antibody provided herein is an isolated TRDV2 multispecific antibody. In some embodiments, a TRDV2 multispecific antibody comprising a TRDV2 antigen binding fragment provided herein is chimeric. In some embodiments, a TRDV2 multispecific antibody comprising a TRDV2 antigen binding fragment provided herein is human. In some embodiments, a TRDV2 multispecific antibody comprising a TRDV2 antigen binding fragment provided herein is humanized. In certain embodiments, a TRDV2 multispecific antibody comprising a TRDV2 antigen binding fragment provided herein is an isolated TRDV2 multispecific antibody.

In some embodiments of the TRDV2 multispecific antibodies provided herein, the first binding domain is human. In some embodiments, the second binding domain is human. In some embodiments of the TRDV2 multispecific antibodies provided herein, both the first binding domain and the second binding domain are human. In some embodiments of the TRDV2 multispecific antibodies provided herein, the first binding domain is humanized. In some embodiments of the TRDV2 multispecific antibodies provided herein, the second binding domain is humanized. In some embodiments of the TRDV2 multispecific antibodies provided herein, both the first binding domain and the second binding domain are humanized. In some embodiments of the TRDV2 multispecific antibodies provided herein, both the first binding domain is human and the second binding domain is humanized. In some embodiments of the TRDV2 multispecific antibodies provided herein, both the first binding domain is humanized and the second binding domain is human.

In some embodiments, a TRDV2 multispecific antibody provided herein is multivalent. In some embodiments, the multispecific antibody is capable of binding at least three antigens. In some embodiments, the multispecific antibody is capable of binding at least five antigens. In certain embodiments, the multispecific antibody is a multispecific antibody. In some embodiments, a TRDV2 multispecific antibody provided herein is an IgG antibody. In some embodiments, the IgG antibody is an IgG1 antibody. In some embodiments, the IgG antibody is an IgG2 antibody. In some embodiments, the IgG antibody is an IgG3 antibody. In some embodiments, the IgG antibody is an IgG4 antibody.

In certain embodiments, the antibodies provided herein are part of a multispecific antibody. In some embodiments, the multispecific antibody comprises a first binding domain that binds to a TRDV2 antigen. In some embodiments, the multispecific antibody comprises a first binding domain that binds to a TRDV2 antigen and comprises a second binding domain that binds to a second target antigen, as provided herein. In certain embodiments, the multispecific antibody binds to a TRDV2 antigen, a second target antigen, and one or more additional antigens. In some embodiments of the various antibodies provided herein, the antibody binds to an epitope of a given antigen.

In some embodiments, a TRGDC antibody provided herein is chimeric. In some embodiments, a TRGDC antibody provided herein is human. In some embodiments, a TRGDC antibody provided herein is humanized. In certain embodiments, a TRGDC antibody provided herein is an isolated TRGDC antibody. In some embodiments, a TRGDC antigen binding fragment provided herein is chimeric. In some embodiments, a TRGDC antigen binding fragment provided herein is human. In some embodiments, a TRGDC antigen binding fragment provided herein is humanized. In certain embodiments, a TRGDC antigen binding fragment provided herein is an isolated TRGDC antigen binding fragment. In some embodiments, a TRGDC antibody provided herein is an IgG antibody. In some embodiments, the IgG antibody is an IgG1 antibody. In some embodiments, the IgG antibody is an IgG2 antibody. In some embodiments, the IgG antibody is an IgG3 antibody. In some embodiments, the IgG antibody is an IgG4 antibody. In some embodiments, a TRGDC antibody provided herein is multivalent. In some embodiments, the antibody is capable of binding at least three antigens. In some embodiments, the antibody is capable of binding at least four antigens. In some embodiments, the antibody is capable of binding at least five antigens.

In some embodiments, a TRGDC multispecific antibody provided herein is chimeric. In some embodiments, a TRGDC multispecific antibody provided herein is human. In some embodiments, a TRGDC multispecific antibody provided herein is humanized. In certain embodiments, a TRGDC multispecific antibody provided herein is an isolated TRGDC multispecific antibody. In some embodiments, a TRGDC multispecific antibody comprising a TRGDC antigen binding fragment provided herein is chimeric. In some embodiments, a TRGDC multispecific antibody comprising a TRGDC antigen binding fragment provided herein is human. In some embodiments, a TRGDC multispecific antibody comprising a TRGDC antigen binding fragment provided herein is humanized. In certain embodiments, a TRGDC multispecific antibody comprising a TRGDC antigen binding fragment provided herein is an isolated TRGDC multispecific antibody.

In some embodiments of the TRGDC multispecific antibodies provided herein, the first binding domain is human. In some embodiments, the second binding domain is human. In some embodiments of the TRGDC multispecific antibodies provided herein, both the first binding domain and the second binding domain are human. In some embodiments of the TRGDC multispecific antibodies provided herein, the first binding domain is humanized. In some embodiments of the TRGDC multispecific antibodies provided herein, the second binding domain is humanized. In some embodiments of the TRGDC multispecific antibodies provided herein, both the first binding domain and the second binding domain are humanized. In some embodiments of the TRGDC multispecific antibodies provided herein, both the first binding domain is human and the second binding domain is humanized. In some embodiments of the TRGDC multispecific antibodies provided herein, both the first binding domain is humanized and the second binding domain is human.

In some embodiments, a TRGDC multispecific antibody provided herein is multivalent. In some embodiments, the multispecific antibody is capable of binding at least three antigens. In some embodiments, the multispecific antibody is capable of binding at least five antigens. In certain embodiments, the multispecific antibody is a multispecific antibody. In some embodiments, a TRGDC multispecific antibody provided herein is an IgG antibody. In some embodiments, the IgG antibody is an IgG1 antibody. In some embodiments, the IgG antibody is an IgG2 antibody. In some embodiments, the IgG antibody is an IgG3 antibody. In some embodiments, the IgG antibody is an IgG4 antibody.

In certain embodiments, the antibodies provided herein are part of a multispecific antibody. In some embodiments, the multispecific antibody comprises a first binding domain that binds to a TRGDC antigen. In some embodiments, the multispecific antibody comprises a first binding domain that binds to a TRGDC antigen and comprises a second binding domain that binds to a second target antigen, as provided herein. In certain embodiments, the multispecific antibody binds to a TRGDC antigen, a second target antigen, and one or more additional antigens. In some embodiments of the various antibodies provided herein, the antibody binds to an epitope of a given antigen.

Also provided is a nucleic acid sequence encoding an antibody provided herein. In another general aspect, provide is a vector comprising an isolated nucleic acid sequence encoding an antibody provided herein. In another general aspect, provided is a vector comprising an isolated nucleic acid sequence encoding an antibody provided herein. Also provided is a vector comprising a nucleic acid sequence encoding an antibody provided herein. Also provided is a host cell comprising a vector comprising a nucleic acid sequence encoding an antibody provided herein. Also provided is a kit comprising the vector comprising a nucleic acid sequence encoding an antibody provided herein, and packaging for the same. In another general aspect, provided herein is an isolated nucleic acid sequence encoding a monoclonal antibody or antigen-binding fragment thereof provided herein. In certain embodiments, the antibody is a TRGV9 antibody. In certain embodiments, the antibody is a TRDV2 antibody. In certain embodiments, the antibody is a TRGDC antibody.

It will be appreciated by those skilled in the art that the coding sequence of a protein can be changed (e.g., replaced, deleted, inserted, etc.) without changing the amino acid sequence of the protein. Accordingly, it will be understood by those skilled in the art that nucleic acid sequences encoding antibodies provided herein can be altered without changing the amino acid sequences of the proteins.

Any vector known to those skilled in the art in view of the present disclosure can be used, such as a plasmid, a cosmid, a phage vector or a viral vector. In some embodiments, the vector is a recombinant expression vector such as a plasmid. The vector can include any element to establish a conventional function of an expression vector, for example, a promoter, ribosome binding element, terminator, enhancer, selection marker, and origin of replication. The promoter can be a constitutive, inducible or repressible promoter. A number of expression vectors capable of delivering nucleic acids to a cell are known in the art and can be used herein for production of an antibody or antigen-binding fragment thereof in the cell. Conventional cloning techniques or artificial gene synthesis can be used to generate a recombinant expression vector according to certain embodiments. Such techniques are well known to those skilled in the art in view of the present disclosure.

Also provided is a host cell comprising an isolated nucleic acid sequence encoding an antibody provided herein. Also provided is a host cell comprising an isolated nucleic acid sequence encoding an antigen binding fragment provided herein. Any host cell known to those skilled in the art in view of the present disclosure can be used for recombinant expression of antibodies or antigen-binding fragments thereof provided herein. In some embodiments, the host cells are E. coli TG1 or BL21 cells (for expression of, e.g., an scFv or Fab antibody), CHO-DG44 or CHO-K1 cells or HEK293 cells (for expression of, e.g., a full-length IgG antibody). According to particular embodiments, the recombinant expression vector is transformed into host cells by conventional methods such as chemical transfection, heat shock, or electroporation, where it is stably integrated into the host cell genome such that the recombinant nucleic acid sequence is effectively expressed.

Also provided are methods of producing an antibody disclosed herein. The methods comprise culturing a cell comprising a nucleic acid encoding the antibody under conditions to produce an antibody and recovering the antibody from the cell or cell culture (e.g., from the supernatant). Expressed antibodies can be harvested from the cells and purified according to conventional techniques known in the art and as described herein.

Pharmaceutical Compositions

In another general aspect, provided is a pharmaceutical composition comprising a TRGV9 antibody provided herein and a pharmaceutically acceptable carrier. In another general aspect, provided is a pharmaceutical composition comprising a TRDV2 antibody provided herein and a pharmaceutically acceptable carrier. In another general aspect, provided is a pharmaceutical composition comprising a TRGDC antibody provided herein and a pharmaceutically acceptable carrier. In certain embodiments, the antibody is isolated. Also provided is a method of producing the pharmaceutical composition, comprising combining the antibody with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.

In another aspect, provided herein is a pharmaceutical composition comprising a comprising: (a) a first binding domain that binds to TRGV9, and (b) a second binding domain that binds to a second target, and a pharmaceutically acceptable carrier. In another aspect, provided herein is a pharmaceutical composition comprising a comprising: (a) a first binding domain that binds to TRDV2, and (b) a second binding domain that binds to a second target, and a pharmaceutically acceptable carrier. In another aspect, provided herein is a pharmaceutical composition comprising a comprising: (a) a first binding domain that binds to TRGDC, and (b) a second binding domain that binds to a second target, and a pharmaceutically acceptable carrier. Any of the multispecific antibodies provided herein are contemplated in the pharmaceutical compositions.

The term “pharmaceutical composition” as used herein means a product comprising an antibody provided herein together with a pharmaceutically acceptable carrier. Antibodies of provided herein and compositions comprising them are also useful in the manufacture of a medicament for therapeutic applications.

As used herein, the term “carrier” refers to any excipient, diluent, filler, salt, buffer, stabilizer, solubilizer, oil, lipid, lipid containing vesicle, microsphere, liposomal encapsulation, or other material well known in the art for use in pharmaceutical formulations. It will be understood that the characteristics of the carrier, excipient or diluent will depend on the route of administration for a particular application. As used herein, the term “pharmaceutically acceptable carrier” refers to a non-toxic material that does not interfere with the effectiveness of a composition provided herein the biological activity of a composition provided herein. According to particular embodiments, in view of the present disclosure, any pharmaceutically acceptable carrier suitable for use in an antibody pharmaceutical composition can be used herein.

The formulation of pharmaceutically active ingredients with pharmaceutically acceptable carriers is known in the art, e.g., Remington: The Science and Practice of Pharmacy (e.g. 21st edition (2005), and any later editions). Non-limiting examples of additional ingredients include: buffers, diluents, solvents, tonicity regulating agents, preservatives, stabilizers, and chelating agents. One or more pharmaceutically acceptable carriers can be used in formulating the pharmaceutical compositions provided herein.

In one embodiment, the pharmaceutical composition is a liquid formulation. A preferred example of a liquid formulation is an aqueous formulation, i.e., a formulation comprising water. The liquid formulation can comprise a solution, a suspension, an emulsion, a microemulsion, a gel, and the like. An aqueous formulation typically comprises at least 50% w/w water, or at least 60%, 70%, 75%, 80%, 85%, 90%, or at least 95% w/w of water.

In one embodiment, the pharmaceutical composition can be formulated as an injectable which can be injected, for example, via an injection device (e.g., a syringe or an infusion pump). The injection can be delivered subcutaneously, intramuscularly, intraperitoneally, intravitreally, or intravenously, for example.

In another embodiment, the pharmaceutical composition is a solid formulation, e.g., a freeze-dried or spray-dried composition, which can be used as is, or whereto the physician or the patient adds solvents, and/or diluents prior to use. Solid dosage forms can include tablets, such as compressed tablets, and/or coated tablets, and capsules (e.g., hard or soft gelatin capsules). The pharmaceutical composition can also be in the form of sachets, dragees, powders, granules, lozenges, or powders for reconstitution, for example.

The dosage forms can be immediate release, in which case they can comprise a water-soluble or dispersible carrier, or they can be delayed release, sustained release, or modified release, in which case they can comprise water-insoluble polymers that regulate the rate of dissolution of the dosage form in the gastrointestinal tract or under the skin.

In other embodiments, the pharmaceutical composition can be delivered intranasally, intrabuccally, or sublingually.

The pH in an aqueous formulation can be between pH 3 and pH 10. In one embodiment, the pH of the formulation is from about 7.0 to about 9.5. In another embodiment, the pH of the formulation is from about 3.0 to about 7.0.

In another embodiment, the pharmaceutical composition comprises a buffer. Non-limiting examples of buffers include: arginine, aspartic acid, bicine, citrate, disodium hydrogen phosphate, fumaric acid, glycine, glycylglycine, histidine, lysine, maleic acid, malic acid, sodium acetate, sodium carbonate, sodium dihydrogen phosphate, sodium phosphate, succinate, tartaric acid, tricine, and tris(hydroxymethyl)-aminomethane, and mixtures thereof. The buffer can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific buffers constitute alternative embodiments.

In another embodiment, the pharmaceutical composition comprises a preservative. Non-limiting examples of preservatives include: benzethonium chloride, benzoic acid, benzyl alcohol, bronopol, butyl 4-hydroxybenzoate, chlorobutanol, chlorocresol, chlorohexidine, chlorphenesin, o-cresol, m-cresol, p-cresol, ethyl 4-hydroxybenzoate, imidurea, methyl 4-hydroxybenzoate, phenol, 2-phenoxyethanol, 2-phenylethanol, propyl 4-hydroxybenzoate, sodium dehydroacetate, thiomerosal, and mixtures thereof. The preservative can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific preservatives constitute alternative embodiments.

In another embodiment, the pharmaceutical composition comprises an isotonic agent. Non-limiting examples of isotonic agents include a salt (such as sodium chloride), an amino acid (such as glycine, histidine, arginine, lysine, isoleucine, aspartic acid, tryptophan, and threonine), an alditol (such as glycerol, 1,2-propanediol propyleneglycol), 1,3-propanediol, and 1,3-butanediol), polyethyleneglycol (e.g. PEG400), and mixtures thereof. Another example of an isotonic agent includes a sugar. Non-limiting examples of sugars can include mono-, di-, or polysaccharides, or water-soluble glucans, including for example fructose, glucose, mannose, sorbose, xylose, maltose, lactose, sucrose, trehalose, dextran, pullulan, dextrin, cyclodextrin, alpha and beta-HPCD, soluble starch, hydroxyethyl starch, and sodium carboxymethyl-cellulose. Another example of an isotonic agent is a sugar alcohol, wherein the term “sugar alcohol” is defined as a C(4-8) hydrocarbon having at least one —OH group. Non-limiting examples of sugar alcohols include mannitol, sorbitol, inositol, galactitol, dulcitol, xylitol, and arabitol. The isotonic agent can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific isotonic agents constitute alternative embodiments.

In another embodiment, the pharmaceutical composition comprises a chelating agent. Non-limiting examples of chelating agents include citric acid, aspartic acid, salts of ethylenediaminetetraacetic acid (EDTA), and mixtures thereof. The chelating agent can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific chelating agents constitute alternative embodiments.

In another embodiment, the pharmaceutical composition comprises a stabilizer. Non-limiting examples of stabilizers include one or more aggregation inhibitors, one or more oxidation inhibitors, one or more surfactants, and/or one or more protease inhibitors.

In another embodiment, the pharmaceutical composition comprises a stabilizer, wherein said stabilizer is carboxy-/hydroxycellulose and derivates thereof (such as HPC, HPC-SL, HPC-L and HPMC), cyclodextrins, 2-methylthioethanol, polyethylene glycol (such as PEG 3350), polyvinyl alcohol (PVA), polyvinyl pyrrolidone, salts (such as sodium chloride), sulphur-containing substances such as monothioglycerol), or thioglycolic acid. The stabilizer can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific stabilizers constitute alternative embodiments.

In further embodiments, the pharmaceutical composition comprises one or more surfactants, preferably a surfactant, at least one surfactant, or two different surfactants. The term “surfactant” refers to any molecules or ions that are comprised of a water-soluble (hydrophilic) part, and a fat-soluble (lipophilic) part. The surfactant can, for example, be selected from the group consisting of anionic surfactants, cationic surfactants, nonionic surfactants, and/or zwitterionic surfactants. The surfactant can be present individually or in the aggregate, in a concentration from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific surfactants constitute alternative embodiments.

In a further embodiment, the pharmaceutical composition comprises one or more protease inhibitors, such as, e.g., EDTA, and/or benzamidine hydrochloric acid (HCl). The protease inhibitor can be present individually or in the aggregate, in a concentration from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific protease inhibitors constitute alternative embodiments.

In another general aspect, provided herein is a method of producing a pharmaceutical composition comprising an antibody or antigen-binding fragment thereof provided herein, comprising combining an antibody or antigen-binding fragment thereof with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.

Methods of Use

The functional activity of antibodies provided herein can be characterized by methods known in the art and as described herein. Methods for characterizing antibodies and antigen-binding fragments thereof include, but are not limited to, affinity and specificity assays including Biacore, ELISA, and OctetRed analysis; binding assays to detect the binding of antibodies to target cells by FACS; binding assays to detect the binding of antibodies to the target antigen on cells. According to particular embodiments, the methods for characterizing antibodies and antigen-binding fragments thereof include those described below. In certain embodiments, the antibody is a TRGV9 antibody. In certain embodiments, the antibody is a TRDV2 antibody. In certain embodiments, the antibody is a TRGDC antibody.

In one aspect, provided is a method of activating a T cell expressing TRGV9, comprising contacting the T cell with a TRGV9 antibody provided herein. In some embodiments, the contacting results in an increase in CD69, CD25, and/or Granzyme B expression, as compared to a control T cell expressing TRGV9.

In another general aspect, provided is a method of inactivating a T cell expressing TRGV9, comprising contacting the T cell with an antibody that binds to a TRGV9 provided herein. In another general aspect, provided is a method of blocking activation of a T cell expressing TRGV9, comprising contacting the T cell with an antibody that binds to a TRGV9 provided herein. In another general aspect, provided is a method of modulating the activation of a T cell expressing TRGV9, comprising contacting the T cell with an antibody that binds to a TRGV9 provided herein.

In another aspect, provided herein is a method of directing a T cell expressing TRGV9 to a target cell, the method comprising contacting the T cell with a multispecific TRGV9 antibody provided herein. In another aspect, provided herein is a method of directing a T cell expressing TRGV9 to a target cell, the method comprising contacting the T cell with a pharmaceutical composition comprising a multispecific TRGV9 antibody provided herein. In some embodiments, the contacting directs the T cell to the target cell. Also provided is a method of targeting an antigen on the surface of a target cell, the method comprising exposing the target cell to a TRGV9 multispecific antibody provided herein. Also provided is a method of targeting an antigen on the surface of a target cell, the method comprising exposing the target cell to a pharmaceutical composition comprising a TRGV9 multispecific antibody provided herein. In another general aspect, provided is a method of targeting an antigen on the surface of a target cell, the method comprising exposing the target cell to a TRGV9 multispecific antibody provided herein. In another general aspect, provided is a method of targeting an antigen on the surface of a target cell, the method comprising exposing the target cell to a pharmaceutical composition comprising a TRGV9 multispecific antibody provided herein.

Also provided herein is a method of treating a disease or disorder in a subject, comprising administering to the subject a TRGV9 antibody provided herein. Also provided herein is a method of treating a disease or disorder in a subject, comprising administering to the subject a TRGV9 antigen binding fragment provided herein. Also provided herein is a method of treating a disease or disorder in a subject, comprising administering to the subject a pharmaceutical composition comprising a TRGV9 antibody provided herein. Also provided herein is a method of treating a disease or disorder in a subject, comprising administering to the subject a pharmaceutical composition comprising a TRGV9 antigen binding fragment provided herein. In a specific embodiment, the disease or disorder is caused all or in part by target cells expressing the second target.

In some embodiments, also provided is a method of directing a γδ T cell to a target cell, the method comprising contacting the γδ T cell with a multispecific TRGV9 antibody provided herein. In some embodiments, also provided is a TRGV9 antibody provided herein for use in directing a γδ T cell to a target cell. In some embodiments, also provided is a TRGV9 multispecific antibody provided herein for use in the manufacture of a medicament for directing a γδ T cell to a target cell. In certain embodiments, the target cell expresses the second target. In some embodiments, the contacting directs the γδ T cell to the target cell.

In some embodiments, also provided is a method of inhibiting growth or proliferation of target cells, the method comprising contacting the target cells with a multispecific TRGV9 antibody provided herein. In some embodiments, also provided is a TRGV9 multispecific antibody provided herein for use in inhibiting growth or proliferation of target cells. In some embodiments, also provided is a TRGV9 multispecific antibody provided herein for use in the manufacture of a medicament for inhibiting growth or proliferation of target cells. In certain embodiments, the target cells express the second target on the cell surface. In specific embodiments, the contacting the target cells with the multispecific TRGV9 antibody inhibits growth or proliferation of the target cells. In certain embodiments, the target cells are in the presence of a T cell expressing TRGV9 while in contact with the multispecific antibody. In a specific embodiment, the T cell expressing TRGV9 is a γδ T cell.

In some embodiments, also provided is a method for eliminating target cells in a subject, comprising administering an effective amount of a multispecific TRGV9 antibody provided herein to the subject. In some embodiments, also provided is a multispecific TRGV9 antibody provided herein for use in eliminating target cells in a subject. In some embodiments, also provided is a TRGV9 multispecific antibody provided herein for use in the manufacture of a medicament for the elimination of target cells in a subject. In some embodiments, the target cells express the second target on the cell surface. In certain embodiments, the target cells are in the presence of a T cell expressing TRGV9 in the subject. In a specific embodiment, the T cell expressing TRGV9 is a γδ T cell. In a specific embodiment, the subject is a subject in need thereof.

In some embodiments, also is a method for treating a disease caused all or in part by target cells in a subject, comprising administering an effective amount of a multispecific TRGV9 antibody provided herein to the subject. In some embodiments, also is a TRGV9 multispecific antibody for use in the treatment of a disease caused all or in part by target cells in a subject. In some embodiments, also provided is a TRGV9 multispecific antibody provided herein for use in the manufacture of a medicament for the treatment of a disease caused all or in part by target cells in a subject. In some embodiments, the target cells express the second target on the cell surface. In certain embodiments, the target cells are in the presence of a T cell expressing TRGV9 in the subject. In a specific embodiment, the T cell expressing TRGV9 is a γδ T cell. In a specific embodiment, the subject is a subject in need thereof. In some embodiments, the second target is a cancer antigen. In some embodiments, the second target is a tumor associated antigen.

Also provided is a method of activating a T cell expressing TRDV2, comprising contacting the T cell with a TRDV2 antibody provided herein. In some embodiments, the contacting results in an increase in CD69, CD25, and/or Granzyme B expression, as compared to a control T cell expressing TRDV2.

In another general aspect, provided is a method of inactivating a T cell expressing TRDV2, comprising contacting the T cell with an antibody that binds to a TRDV2 provided herein. In another general aspect, provided is a method of blocking activation of a T cell expressing TRDV2, comprising contacting the T cell with an antibody that binds to a TRDV2 provided herein. In another general aspect, provided is a method of modulating the activation of a T cell expressing TRDV2, comprising contacting the T cell with an antibody that binds to a TRDV2 provided herein.

In another aspect, provided herein is a method of directing a T cell expressing TRDV2 to a target cell, the method comprising contacting the T cell with a multispecific TRDV2 antibody provided herein. In another aspect, provided herein is a method of directing a T cell expressing TRDV2 to a target cell, the method comprising contacting the T cell with a pharmaceutical composition comprising a multispecific TRDV2 antibody provided herein. In some embodiments, the contacting directs the T cell to the target cell. Also provided is a method of targeting an antigen on the surface of a target cell, the method comprising exposing the target cell to a TRDV2 multispecific antibody provided herein. Also provided is a method of targeting an antigen on the surface of a target cell, the method comprising exposing the target cell to a pharmaceutical composition comprising a TRDV2 multispecific antibody provided herein. In another general aspect, provided is a method of targeting an antigen on the surface of a target cell, the method comprising exposing the target cell to a TRDV2 multispecific antibody provided herein. In another general aspect, provided is a method of targeting an antigen on the surface of a target cell, the method comprising exposing the target cell to a pharmaceutical composition comprising a TRDV2 multispecific antibody provided herein.

Also provided herein is a method of treating a disease or disorder in a subject, comprising administering to the subject a TRDV2 antibody provided herein. Also provided herein is a method of treating a disease or disorder in a subject, comprising administering to the subject a TRDV2 antigen binding fragment provided herein. Also provided herein is a method of treating a disease or disorder in a subject, comprising administering to the subject a pharmaceutical composition comprising a TRDV2 antibody provided herein. Also provided herein is a method of treating a disease or disorder in a subject, comprising administering to the subject a pharmaceutical composition comprising a TRDV2 antigen binding fragment provided herein. In a specific embodiment, the disease or disorder is caused all or in part by target cells expressing the second target.

In some embodiments, also provided is a method of directing a γδ T cell to a target cell, the method comprising contacting the γδ T cell with a multispecific TRDV2 antibody provided herein. In some embodiments, also provided is a TRDV2 antibody provided herein for use in directing a γδ T cell to a target cell. In some embodiments, also provided is a TRDV2 multispecific antibody provided herein for use in the manufacture of a medicament for directing a γδ T cell to a target cell. In certain embodiments, the target cell expresses the second target. In some embodiments, the contacting directs the γδ T cell to the target cell.

In some embodiments, also provided is a method of inhibiting growth or proliferation of target cells, the method comprising contacting the target cells with a multispecific TRDV2 antibody provided herein. In some embodiments, also provided is a TRDV2 multispecific antibody provided herein for use in inhibiting growth or proliferation of target cells. In some embodiments, also provided is a TRDV2 multispecific antibody provided herein for use in the manufacture of a medicament for inhibiting growth or proliferation of target cells. In certain embodiments, the target cells express the second target on the cell surface. In specific embodiments, the contacting the target cells with the multispecific TRDV2 antibody inhibits growth or proliferation of the target cells. In certain embodiments, the target cells are in the presence of a T cell expressing TRDV2 while in contact with the multispecific antibody. In a specific embodiment, the T cell expressing TRDV2 is a γδ T cell.

In some embodiments, also provided is a method for eliminating target cells in a subject, comprising administering an effective amount of a multispecific TRDV2 antibody provided herein to the subject. In some embodiments, also provided is a multispecific TRDV2 antibody provided herein for use in eliminating target cells in a subject. In some embodiments, also provided is a TRDV2 multispecific antibody provided herein for use in the manufacture of a medicament for the elimination of target cells in a subject. In some embodiments, the target cells express the second target on the cell surface. In certain embodiments, the target cells are in the presence of a T cell expressing TRDV2 in the subject. In a specific embodiment, the T cell expressing TRDV2 is a γδ T cell. In a specific embodiment, the subject is a subject in need thereof.

In some embodiments, also is a method for treating a disease caused all or in part by target cells in a subject, comprising administering an effective amount of a multispecific TRDV2 antibody provided herein to the subject. In some embodiments, also is a TRDV2 multispecific antibody for use in the treatment of a disease caused all or in part by target cells in a subject. In some embodiments, also provided is a TRDV2 multispecific antibody provided herein for use in the manufacture of a medicament for the treatment of a disease caused all or in part by target cells in a subject. In some embodiments, the target cells express the second target on the cell surface. In certain embodiments, the target cells are in the presence of a T cell expressing TRDV2 in the subject. In a specific embodiment, the T cell expressing TRDV2 is a γδ T cell. In a specific embodiment, the subject is a subject in need thereof. In some embodiments, the second target is a cancer antigen. In some embodiments, the second target is a tumor associated antigen.

Also provided is a method of activating a T cell expressing TRGDC, comprising 20 contacting the T cell with a TRGDC antibody provided herein. In some embodiments, the contacting results in an increase in CD69, CD25, and/or Granzyme B expression, as compared to a control T cell expressing TRGDC.

In another general aspect, provided is a method of inactivating a T cell expressing TRGDC, comprising contacting the T cell with an antibody that binds to a TRGDC provided herein. In another general aspect, provided is a method of blocking activation of a T cell expressing TRGDC, comprising contacting the T cell with an antibody that binds to a TRGDC provided herein. In another general aspect, provided is a method of modulating the activation of a T cell expressing TRGDC, comprising contacting the T cell with an antibody that binds to a TRGDC provided herein.

In another aspect, provided herein is a method of directing a T cell expressing TRGDC to a target cell, the method comprising contacting the T cell with a multispecific TRGDC antibody provided herein. In another aspect, provided herein is a method of directing a T cell expressing TRGDC to a target cell, the method comprising contacting the T cell with a pharmaceutical composition comprising a multispecific TRGDC antibody provided herein. In some embodiments, the contacting directs the T cell to the target cell. Also provided is a method of targeting an antigen on the surface of a target cell, the method comprising exposing the target cell to a TRGDC multispecific antibody provided herein. Also provided is a method of targeting an antigen on the surface of a target cell, the method comprising exposing the target cell to a pharmaceutical composition comprising a TRGDC multispecific antibody provided herein. In another general aspect, provided is a method of targeting an antigen on the surface of a target cell, the method comprising exposing the target cell to a TRGDC multispecific antibody provided herein. In another general aspect, provided is a method of targeting an antigen on the surface of a target cell, the method comprising exposing the target cell to a pharmaceutical composition comprising a TRGDC multispecific antibody provided herein.

Also provided herein is a method of treating a disease or disorder in a subject, comprising administering to the subject a TRGDC antibody provided herein. Also provided herein is a method of treating a disease or disorder in a subject, comprising administering to the subject a TRGDC antigen binding fragment provided herein. Also provided herein is a method of treating a disease or disorder in a subject, comprising administering to the subject a pharmaceutical composition comprising a TRGDC antibody provided herein. Also provided herein is a method of treating a disease or disorder in a subject, comprising administering to the subject a pharmaceutical composition comprising a TRGDC antigen binding fragment provided herein. In a specific embodiment, the disease or disorder is caused all or in part by target cells expressing the second target.

In some embodiments, also provided is a method of directing a γδ T cell to a target cell, the method comprising contacting the γδ T cell with a multispecific TRGDC antibody provided herein. In some embodiments, also provided is a TRGDC antibody provided herein for use in directing a γδ T cell to a target cell. In some embodiments, also provided is a TRGDC multispecific antibody provided herein for use in the manufacture of a medicament for directing a γδ T cell to a target cell. In certain embodiments, the target cell expresses the second target. In some embodiments, the contacting directs the γδ T cell to the target cell.

In some embodiments, also provided is a method of inhibiting growth or proliferation of target cells, the method comprising contacting the target cells with a multispecific TRGDC antibody provided herein. In some embodiments, also provided is a TRGDC multispecific antibody provided herein for use in inhibiting growth or proliferation of target cells. In some embodiments, also provided is a TRGDC multispecific antibody provided herein for use in the manufacture of a medicament for inhibiting growth or proliferation of target cells. In certain embodiments, the target cells express the second target on the cell surface. In specific embodiments, the contacting the target cells with the multispecific TRGDC antibody inhibits growth or proliferation of the target cells. In certain embodiments, the target cells are in the presence of a T cell expressing TRGDC while in contact with the multispecific antibody. In a specific embodiment, the T cell expressing TRGDC is a γδ T cell.

In some embodiments, also provided is a method for eliminating target cells in a subject, comprising administering an effective amount of a multispecific TRGDC antibody provided herein to the subject. In some embodiments, also provided is a multispecific TRGDC antibody provided herein for use in eliminating target cells in a subject. In some embodiments, also provided is a TRGDC multispecific antibody provided herein for use in the manufacture of a medicament for the elimination of target cells in a subject. In some embodiments, the target cells express the second target on the cell surface. In certain embodiments, the target cells are in the presence of a T cell expressing TRGDC in the subject. In a specific embodiment, the T cell expressing TRGDC is a γδ T cell. In a specific embodiment, the subject is a subject in need thereof.

In some embodiments, also is a method for treating a disease caused all or in part by target cells in a subject, comprising administering an effective amount of a multispecific TRGDC antibody provided herein to the subject. In some embodiments, also is a TRGDC multispecific antibody for use in the treatment of a disease caused all or in part by target cells in a subject. In some embodiments, also provided is a TRGDC multispecific antibody provided herein for use in the manufacture of a medicament for the treatment of a disease caused all or in part by target cells in a subject. In some embodiments, the target cells express the second target on the cell surface. In certain embodiments, the target cells are in the presence of a T cell expressing TRGDC in the subject. In a specific embodiment, the T cell expressing TRGDC is a γδ T cell. In a specific embodiment, the subject is a subject in need thereof. In some embodiments, the second target is a cancer antigen. In some embodiments, the second target is a tumor associated antigen.

In some embodiments, the subject is a subject in need thereof. In some embodiments, the subject is a human. In specific embodiments, the subject is administered an effective amount.

As used herein, the term “effective amount” refers to an amount of an active ingredient or component that elicits the desired biological or medicinal response in a subject.

According to particular embodiments, an effective amount refers to the amount of therapy which is sufficient to achieve one, two, three, four, or more of the following effects: (i) reduce or ameliorate the severity of the disease, disorder or condition to be treated or a symptom associated therewith; (ii) reduce the duration of the disease, disorder or condition to be treated, or a symptom associated therewith; (iii) prevent the progression of the disease, disorder or condition to be treated, or a symptom associated therewith; (iv) cause regression of the disease, disorder or condition to be treated, or a symptom associated therewith; (v) prevent the development or onset of the disease, disorder or condition to be treated, or a symptom associated therewith; (vi) prevent the recurrence of the disease, disorder or condition to be treated, or a symptom associated therewith; (vii) reduce hospitalization of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith; (viii) reduce hospitalization length of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith; (ix) increase the survival of a subject with the disease, disorder or condition to be treated, or a symptom associated therewith; (xi) inhibit or reduce the disease, disorder or condition to be treated, or a symptom associated therewith in a subject; and/or (xii) enhance or improve the prophylactic or therapeutic effect(s) of another therapy.

The effective amount or dosage can vary according to various factors, such as the disease, disorder or condition to be treated, the means of administration, the target site, the physiological state of the subject (including, e.g., age, body weight, health), whether the subject is a human or an animal, other medications administered, and whether the treatment is prophylactic or therapeutic. Treatment dosages are optimally titrated to optimize safety and efficacy.

According to particular embodiments, the compositions described herein are formulated to be suitable for the intended route of administration to a subject. For example, the compositions described herein can be formulated to be suitable for intravenous, subcutaneous, or intramuscular administration.

As used herein, the terms “treat,” “treating,” and “treatment” are all intended to refer to an amelioration or reversal of at least one measurable physical parameter related to a cancer, which is not necessarily discernible in the subject, but can be discernible in the subject. The terms “treat,” “treating,” and “treatment,” can also refer to causing regression, preventing the progression, or at least slowing down the progression of the disease, disorder, or condition. In a particular embodiment, “treat,” “treating,” and “treatment” refer to an alleviation, prevention of the development or onset, or reduction in the duration of one or more symptoms associated with the disease, disorder, or condition, such as a tumor or more preferably a cancer. In a particular embodiment, “treat,” “treating,” and “treatment” refer to prevention of the recurrence of the disease, disorder, or condition. In a particular embodiment, “treat,” “treating,” and “treatment” refer to an increase in the survival of a subject having the disease, disorder, or condition. In a particular embodiment, “treat,” “treating,” and “treatment” refer to elimination of the disease, disorder, or condition in the subject.

In some embodiments, a TRGV9 antibody provided herein is used in combination with a supplemental therapy. In some embodiments, a TRDV2 antibody provided herein is used in combination with a supplemental therapy.

In some embodiments, a TRGDC antibody provided herein is used in combination with a supplemental therapy.

As used herein, the term “in combination,” in the context of the administration of two or more therapies to a subject, refers to the use of more than one therapy. The use of the term “in combination” does not restrict the order in which therapies are administered to a subject. For example, a first therapy (e.g., a composition described herein) can be administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concomitantly with, or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of a second therapy to a subject.

TRGV9 antibodies provided herein may also be used as agents to detect TRGV9-expressing cells. Thus, in another methods, provided is a method of detecting a cell expressing TRGV9, comprising contacting a cell with a TRGV9 antibody provided herein. In certain embodiments, the detecting is by ELISA. In some embodiments, the detecting is by FACS analysis. Also provided are kits comprising a TRGV9 antibody provided herein, and instructions for use.

TRDV2 antibodies provided herein may also be used as agents to detect TRDV2-expressing cells. Thus, in another methods, provided is a method of detecting a cell expressing TRDV2, comprising contacting a cell with a TRDV2 antibody provided herein. In certain embodiments, the detecting is by ELISA. In some embodiments, the detecting is by FACS analysis. Also provided are kits comprising a TRDV2 antibody provided herein, and instructions for use.

TRGDC antibodies provided herein may also be used as agents to detect TRGDC-expressing cells. Thus, in another methods, provided is a method of detecting a cell expressing TRGDC, comprising contacting a cell with a TRGDC antibody provided herein. In certain embodiments, the detecting is by ELISA. In some embodiments, the detecting is by FACS analysis. Also provided are kits comprising a TRGDC antibody provided herein, and instructions for use.

Enrichment and Detection Methods

In one aspect, the TRGV9 antibodies provided herein are used as agents to detect TRGV9-expressing cells. Thus, in other methods, provided is a method of detecting a cell expressing TRGV9, comprising contacting a cell with a TRGV9 antibody provided herein. In certain embodiments, the detecting is by ELISA. In some embodiments, the detecting is by FACS analysis. Also provided are kits comprising a TRGV9 antibody provided herein, and instructions for use.

Enrichment, isolation, separation, purification, sorting, selecting, capturing or detecting, or any combination thereof can be done using known technologies such as bead, microfluidics, solid support, columns, and the like. For example, TRGV9 cells may be separated or visualized using known methods when bound to the TRGV9 antibodies provided herein.

The TRGV9 antibodies or multispecific TRGV9 antibodies provided herein can be used to selectively enrich, isolate, separate, purify, sort, select, capture or detect TRGV9-expressing cells. The TRGV9 antibodies or multispecific TRGV9 antibodies provided herein may be utilized in a bispecific format, e.g. containing a first antigen binding domain that specifically binds TRGV9 and a second antigen binding domain that specifically binds a second target. In other embodiments, the multispecific TRGV9 antibodies provided herein may be utilized in a format that further incorporates a third antigen binding domain that specifically binds a third antigen (e.g., at a trispecific antibody). In other embodiments, the multispecific TRGV9 antibodies provided herein may be utilized in a format that further incorporates a fourth antigen binding domain that specifically binds a fourth antigen. (e.g., as a quadraspecific antibody).

In one aspect, provided herein is a method of enriching a TRGV9-expressing cell comprising: providing a sample comprising the TRGV9-expressing cell; contacting the sample with a TRGV9 antibody provided herein; and enriching the TRGV9-expressing cell bound to the TRGV9 antibody. In one aspect, provided herein is a method of isolating a TRGV9-expressing cell comprising: providing a sample comprising the TRGV9-expressing cell; contacting the sample with a TRGV9 antibody provided herein; and isolating the TRGV9-expressing cell bound to the TRGV9 antibody. In one aspect, provided herein is a method of separating a TRGV9-expressing cell comprising: providing a sample comprising the TRGV9-expressing cell; contacting the sample with a TRGV9 antibody provided herein; and separating the TRGV9-expressing cell bound to the TRGV9 antibody. In one aspect, 10 provided herein is a method of purifying a TRGV9-expressing cell comprising: providing a sample comprising the TRGV9-expressing cell; contacting the sample with a TRGV9 antibody provided herein; and purifying the TRGV9-expressing cell bound to the TRGV9 antibody. In one aspect, provided herein is a method of sorting a TRGV9-expressing cell comprising: providing a sample comprising the TRGV9-expressing cell; contacting the sample with a TRGV9 antibody provided herein; and sorting the TRGV9-expressing cell bound to the TRGV9 antibody. In one aspect, provided herein is a method of selecting a TRGV9-expressing cell comprising: providing a sample comprising the TRGV9-expressing cell; contacting the sample with a TRGV9 antibody provided herein; and selecting the TRGV9-expressing cell bound to the TRGV9 antibody. In one aspect, provided herein is a method of capturing a TRGV9-expressing cell comprising: providing a sample comprising the TRGV9-expressing cell; contacting the sample with a TRGV9 antibody provided herein; and capturing the TRGV9-expressing cell bound to the TRGV9 antibody. In one aspect, provided herein is a method of detecting a TRGV9-expressing cell comprising: providing a sample comprising the TRGV9-expressing cell; contacting the sample with a TRGV9 antibody provided herein; and detecting the TRGV9-expressing cell bound to the TRGV9 antibody.

In one aspect, provided herein is a method of enriching a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and enriching the TRGV9-expressing cell bound to the TRGV9 antibody. In one aspect, provided herein is a method of isolating a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and isolating the TRGV9-expressing cell bound to the TRGV9 antibody. In one aspect, provided herein is a method of separating a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and separating the TRGV9-expressing cell bound to the TRGV9 antibody. In one aspect, provided herein is a method of purifying a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and purifying the TRGV9-expressing cell bound to the TRGV9 antibody. In one aspect, provided herein is a method of sorting a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and sorting the TRGV9-expressing cell bound to the TRGV9 antibody. In one aspect, provided herein is a method of selecting a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and selecting the TRGV9-expressing cell bound to the TRGV9 antibody. In one aspect, provided herein is a method of capturing a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and capturing the TRGV9-expressing cell bound to the TRGV9 antibody. In one aspect, provided herein is a method of detecting a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and detecting the TRGV9-expressing cell bound to the TRGV9 antibody.

In one aspect, provided herein is a method of enriching a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and enriching the TRGV9-expressing cell based on binding of the TRGV9-expressing cell to the TRGV9 antibody. In one aspect, provided herein is a method of isolating a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and isolating the TRGV9-expressing cell based on binding of the TRGV9-expressing cell to the TRGV9 antibody. In one aspect, provided herein is a method of separating a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and separating the TRGV9-expressing cell based on binding of the TRGV9-expressing cell to the TRGV9 antibody. In one aspect, provided herein is a method of purifying a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and purifying the TRGV9-expressing cell based on binding of the TRGV9-expressing cell to the TRGV9 antibody. In one aspect, provided herein is a method of sorting a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and sorting the TRGV9-expressing cell based on binding of the TRGV9-expressing cell to the TRGV9 antibody. In one aspect, provided herein is a method of selecting a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and selecting the TRGV9-expressing cell based on binding of the TRGV9-expressing cell to the TRGV9 antibody. In one aspect, provided herein is a method of capturing a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and capturing the TRGV9-expressing cell based on binding of the TRGV9-expressing cell to the TRGV9 antibody. In one aspect, provided herein is a method of detecting a TRGV9-expressing cell comprising: contacting a TRGV9-expressing cell with a TRGV9 antibody provided herein; and detecting the TRGV9-expressing cell based on binding of the TRGV9-expressing cell to the TRGV9 antibody.

In certain embodiments of the methods, the TRGV9-expressing cell is a T cell. In some embodiments of the methods, the TRGV9-expressing cell is in a population of cells. In some embodiments of the methods, the TRGV9-expressing cell is in a population of lymphocytes. In some embodiments of the methods, the TRGV9-expressing cell is in a population of T cells. In some embodiments of the methods, the TRGV9-expressing cell is provided as a population of cells. In some embodiments of the methods, the TRGV9-expressing cell is provided as a population of lymphocytes. In some embodiments of the methods, the TRGV9-expressing cell is provided as a population of T cells. In some embodiments of the methods, the TRGV9-expressing cell is provided as a sample comprising a population of cells. In some embodiments of the methods, the TRGV9-expressing cell is provided as a sample comprising a population of lymphocytes. In some embodiments of the methods, the TRGV9-expressing cell is provided as a sample comprising a population of T cells. In some embodiments of the methods, the sample is a blood sample. In some embodiments of the methods, the sample is a tissue sample. In some embodiments of the methods, the sample is a tissue culture sample.

In some embodiments of the methods, the TRGV9 antibody is a multispecific TRGV9 antibody provided herein. In some embodiments of the methods, the TRGV9 antibody is a bispecific TRGV9 antibody provided herein. In some embodiments of the methods, the TRGV9 antibody is a trispecific TRGV9 antibody provided herein. In some embodiments of the methods, the TRGV9 antibody is a quadraspecific TRGV9 antibody provided herein. In certain embodiments, the TRGV9 antibody specifically binds to TRGV9. In one embodiment, the multispecific TRGV9 antibody comprises: (a) a first binding domain that binds TRGV9, and (b) a second binding domain that binds to a second target. In one embodiment, the multispecific TRGV9 antibody comprises: (a) a first binding domain that binds TRGV9, and (b) a second binding domain that binds to a second target, and (c) a third binding domain that binds to a third target. In one embodiment, the multispecific TRGV9 antibody comprises: (a) a first binding domain that binds TRGV9, and (b) a second binding domain that binds to a second target, (c) a third binding domain that binds to a third target, and (d) a fourth binding domain that binds to a fourth target. In one embodiment, the multispecific TRGV9 antibody comprises: (a) a first binding domain that specifically binds TRGV9, and (b) a second binding domain that specifically binds to a second target. In one embodiment, the multispecific TRGV9 antibody comprises: (a) a first binding domain that specifically binds TRGV9, and (b) a second binding domain that specifically binds to a second target, and (c) a third binding domain that specifically binds to a third target. In one embodiment, the multispecific TRGV9 antibody comprises: (a) a first binding domain that specifically binds TRGV9, and (b) a second binding domain that specifically binds to a second target, (c) a third binding domain that specifically binds to a third target, and (d) a fourth binding domain that specifically binds to a fourth target.

In specific embodiments of the methods provided herein, the method uses multi-marker detection. In some embodiments, the multi-marker detection uses a multispecific TRGV9 antibody provided herein. In some embodiments, the multi-marker detection uses a bispecific TRGV9 antibody provided herein. In some embodiments, the multi-marker detection uses a trispecific TRGV9 antibody provided herein. In some embodiments, the multi-marker detection uses a quadraspecific TRGV9 antibody provided herein.

In certain embodiments of the methods provided herein, the methods are included as steps in a T cell manufacturing process. In certain embodiments, the cells are CAR-T cells. In certain embodiments of the methods provided herein, the methods are included as steps in a T cell modification process.

In certain embodiments of the methods provided herein, the methods are included as steps in a diagnostic method. In certain embodiments of the methods provided herein, the methods are included as steps in a method to quantify the TRGV9-expressing T cells.

In certain embodiments of the methods provided herein, the method further comprises expanding the enriched, isolated, separated, purified, sorted, selected, captured or detected TRGV9-expressing cells. In certain embodiments, the expanding is in vitro. In certain embodiments, the expanding is in vivo. In certain embodiments of the methods provided herein, the method further comprises growing the enriched, isolated, separated, purified, sorted, selected, captured or detected TRGV9-expressing cells. In certain embodiments, the growing is in vitro. In certain embodiments, the growing is in vivo. In certain embodiments of the methods provided herein, the method further comprises quantifying the enriched, isolated, separated, purified, sorted, selected, captured or detected TRGV9-expressing cells.

In one aspect, the TRDV2 antibodies provided herein are used as agents to detect TRDV2-expressing cells. Thus, in other methods, provided is a method of detecting a cell expressing TRDV2, comprising contacting a cell with a TRDV2 antibody provided herein. In certain embodiments, the detecting is by ELISA. In some embodiments, the detecting is by FACS analysis. Also provided are kits comprising a TRDV2 antibody provided herein, and instructions for use.

Enrichment, isolation, separation, purification, sorting, selecting, capturing or detecting, or any combination thereof can be done using known technologies such as bead, microfluidics, solid support, columns, and the like. For example, TRDV2 cells may be separated or visualized using known methods when bound to the TRDV2 antibodies provided herein.

The TRDV2 antibodies or multispecific TRDV2 antibodies provided herein can be used to selectively enrich, isolate, separate, purify, sort, select, capture or detect TRDV2-expressing cells. The TRDV2 antibodies or multispecific TRDV2 antibodies provided herein may be utilized in a bispecific format, e.g. containing a first antigen binding domain that specifically binds TRDV2 and a second antigen binding domain that specifically binds a second target. In other embodiments, the multispecific TRDV2 antibodies provided herein may be utilized in a format that further incorporates a third antigen binding domain that specifically binds a third antigen (e.g., at a trispecific antibody). In other embodiments, the multispecific TRDV2 antibodies provided herein may be utilized in a format that further incorporates a fourth antigen binding domain that specifically binds a fourth antigen. (e.g., as a quadraspecific antibody).

In one aspect, provided herein is a method of enriching a TRDV2-expressing cell comprising: providing a sample comprising the TRDV2-expressing cell; contacting the sample with a TRDV2 antibody provided herein; and enriching the TRDV2-expressing cell bound to the TRDV2 antibody. In one aspect, provided herein is a method of isolating a TRDV2-expressing cell comprising: providing a sample comprising the TRDV2-expressing cell; contacting the sample with a TRDV2 antibody provided herein; and isolating the TRDV2-expressing cell bound to the TRDV2 antibody. In one aspect, provided herein is a method of separating a TRDV2-expressing cell comprising: providing a sample comprising the TRDV2-expressing cell; contacting the sample with a TRDV2 antibody provided herein; and separating the TRDV2-expressing cell bound to the TRDV2 antibody. In one aspect, provided herein is a method of purifying a TRDV2-expressing cell comprising: providing a sample comprising the TRDV2-expressing cell; contacting the sample with a TRDV2 antibody provided herein; and purifying the TRDV2-expressing cell bound to the TRDV2 antibody. In one aspect, provided herein is a method of sorting a TRDV2-expressing cell comprising: providing a sample comprising the TRDV2-expressing cell; contacting the sample with a TRDV2 antibody provided herein; and sorting the TRDV2-expressing cell bound to the TRDV2 antibody. In one aspect, provided herein is a method of selecting a TRDV2-expressing cell comprising: providing a sample comprising the TRDV2-expressing cell; contacting the sample with a TRDV2 antibody provided herein; and selecting the TRDV2-expressing cell bound to the TRDV2 antibody. In one aspect, provided herein is a method of capturing a TRDV2-expressing cell comprising: providing a sample comprising the TRDV2-expressing cell; contacting the sample with a TRDV2 antibody provided herein; and capturing the TRDV2-expressing cell bound to the TRDV2 antibody. In one aspect, provided herein is a method of detecting a TRDV2-expressing cell comprising: providing a sample comprising the TRDV2-expressing cell; contacting the sample with a TRDV2 antibody provided herein; and detecting the TRDV2-expressing cell bound to the TRDV2 antibody.

In one aspect, provided herein is a method of enriching a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and enriching the TRDV2-expressing cell bound to the TRDV2 antibody. In one aspect, provided herein is a method of isolating a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and isolating the TRDV2-expressing cell bound to the TRDV2 antibody. In one aspect, provided herein is a method of separating a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and separating the TRDV2-expressing cell bound to the TRDV2 antibody. In one aspect, provided herein is a method of purifying a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and purifying the TRDV2-expressing cell bound to the TRDV2 antibody. In one aspect, provided herein is a method of sorting a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and sorting the TRDV2-expressing cell bound to the TRDV2 antibody. In one aspect, provided herein is a method of selecting a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and selecting the TRDV2-expressing cell bound to the TRDV2 antibody. In one aspect, provided herein is a method of capturing a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and capturing the TRDV2-expressing cell bound to the TRDV2 antibody. In one aspect, provided herein is a method of detecting a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and detecting the TRDV2-expressing cell bound to the TRDV2 antibody.

In one aspect, provided herein is a method of enriching a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and enriching the TRDV2-expressing cell based on binding of the TRDV2-expressing cell to the TRDV2 antibody. In one aspect, provided herein is a method of isolating a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and isolating the TRDV2-expressing cell based on binding of the TRDV2-expressing cell to the TRDV2 antibody. In one aspect, provided herein is a method of separating a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and separating the TRDV2-expressing cell based on binding of the TRDV2-expressing cell to the TRDV2 antibody. In one aspect, provided herein is a method of purifying a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and purifying the TRDV2-expressing cell based on binding of the TRDV2-expressing cell to the TRDV2 antibody. In one aspect, provided herein is a method of sorting a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and sorting the TRDV2-expressing cell based on binding of the TRDV2-expressing cell to the TRDV2 antibody. In one aspect, provided herein is a method of selecting a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and selecting the TRDV2-expressing cell based on binding of the TRDV2-expressing cell to the TRDV2 antibody. In one aspect, provided herein is a method of capturing a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and capturing the TRDV2-expressing cell based on binding of the TRDV2-expressing cell to the TRDV2 antibody. In one aspect, provided herein is a method of detecting a TRDV2-expressing cell comprising: contacting a TRDV2-expressing cell with a TRDV2 antibody provided herein; and detecting the TRDV2-expressing cell based on binding of the TRDV2-expressing cell to the TRDV2 antibody.

In certain embodiments of the methods, the TRDV2-expressing cell is a T cell. In some embodiments of the methods, the TRDV2-expressing cell is in a population of cells. In some embodiments of the methods, the TRDV2-expressing cell is in a population of lymphocytes. In some embodiments of the methods, the TRDV2-expressing cell is in a population of T cells. In some embodiments of the methods, the TRDV2-expressing cell is provided as a population of cells. In some embodiments of the methods, the TRDV2-expressing cell is provided as a population of lymphocytes. In some embodiments of the methods, the TRDV2-expressing cell is provided as a population of T cells. In some embodiments of the methods, the TRDV2-expressing cell is provided as a sample comprising a population of cells. In some embodiments of the methods, the TRDV2-expressing cell is provided as a sample comprising a population of lymphocytes. In some embodiments of the methods, the TRDV2-expressing cell is provided as a sample comprising a population of T cells. In some embodiments of the methods, the sample is a blood sample. In some embodiments of the methods, the sample is a tissue sample. In some embodiments of the methods, the sample is a tissue culture sample.

In some embodiments of the methods, the TRDV2 antibody is a multispecific TRDV2 antibody provided herein. In some embodiments of the methods, the TRDV2 antibody is a bispecific TRDV2 antibody provided herein. In some embodiments of the methods, the TRDV2 antibody is a trispecific TRDV2 antibody provided herein. In some embodiments of the methods, the TRDV2 antibody is a quadraspecific TRDV2 antibody provided herein. In certain embodiments, the TRDV2 antibody specifically binds to TRDV2. In one embodiment, the multispecific TRDV2 antibody comprises: (a) a first binding domain that binds TRDV2, and (b) a second binding domain that binds to a second target. In one embodiment, the multispecific TRDV2 antibody comprises: (a) a first binding domain that binds TRDV2, and (b) a second binding domain that binds to a second target, and (c) a third binding domain that binds to a third target. In one embodiment, the multispecific TRDV2 antibody comprises: (a) a first binding domain that binds TRDV2, and (b) a second binding domain that binds to a second target, (c) a third binding domain that binds to a third target, and (d) a fourth binding domain that binds to a fourth target. In one embodiment, the multispecific TRDV2 antibody comprises: (a) a first binding domain that specifically binds TRDV2, and (b) a second binding domain that specifically binds to a second target. In one embodiment, the multispecific TRDV2 antibody comprises: (a) a first binding domain that specifically binds TRDV2, and (b) a second binding domain that specifically binds to a second target, and (c) a third binding domain that specifically binds to a third target. In one embodiment, the multispecific TRDV2 antibody comprises: (a) a first binding domain that specifically binds TRDV2, and (b) a second binding domain that specifically binds to a second target, (c) a third binding domain that specifically binds to a third target, and (d) a fourth binding domain that specifically binds to a fourth target.

In specific embodiments of the methods provided herein, the method uses multi-marker detection. In some embodiments, the multi-marker detection uses a multispecific TRDV2 antibody provided herein. In some embodiments, the multi-marker detection uses a bispecific TRDV2 antibody provided herein. In some embodiments, the multi-marker detection uses a trispecific TRDV2 antibody provided herein. In some embodiments, the multi-marker detection uses a quadraspecific TRDV2 antibody provided herein.

In certain embodiments of the methods provided herein, the methods are included as steps in a T cell manufacturing process. In certain embodiments, the cells are CAR-T cells. In certain embodiments of the methods provided herein, the methods are included as steps in a T cell modification process.

In certain embodiments of the methods provided herein, the methods are included as steps in a diagnostic method. In certain embodiments of the methods provided herein, the methods are included as steps in a method to quantify the TRDV2-expressing T cells.

In certain embodiments of the methods provided herein, the method further comprises expanding the enriched, isolated, separated, purified, sorted, selected, captured or detected TRDV2-expressing cells. In certain embodiments, the expanding is in vitro. In certain embodiments, the expanding is in vivo. In certain embodiments of the methods provided herein, the method further comprises growing the enriched, isolated, separated, purified, sorted, selected, captured or detected TRDV2-expressing cells. In certain embodiments, the growing is in vitro. In certain embodiments, the growing is in vivo. In certain embodiments of the methods provided herein, the method further comprises quantifying the enriched, isolated, separated, purified, sorted, selected, captured or detected TRDV2-expressing cells.

In one aspect, the TRGDC antibodies provided herein are used as agents to detect TRGDC-expressing cells. Thus, in other methods, provided is a method of detecting a cell expressing TRGDC, comprising contacting a cell with a TRGDC antibody provided herein. In certain embodiments, the detecting is by ELISA. In some embodiments, the detecting is by FACS analysis. Also provided are kits comprising a TRGDC antibody provided herein, and instructions for use.

Enrichment, isolation, separation, purification, sorting, selecting, capturing or detecting, or any combination thereof can be done using known technologies such as bead, microfluidics, solid support, columns, and the like. For example, TRGDC cells may be separated or visualized using known methods when bound to the TRGDC antibodies provided herein.

The TRGDC antibodies or multispecific TRGDC antibodies provided herein can be used to selectively enrich, isolate, separate, purify, sort, select, capture or detect TRGDC-expressing cells. The TRGDC antibodies or multispecific TRGDC antibodies provided herein may be utilized in a bispecific format, e.g. containing a first antigen binding domain that specifically binds TRGDC and a second antigen binding domain that specifically binds a second target. In other embodiments, the multispecific TRGDC antibodies provided herein may be utilized in a format that further incorporates a third antigen binding domain that specifically binds a third antigen (e.g., at a trispecific antibody). In other embodiments, the multispecific TRGDC antibodies provided herein may be utilized in a format that further incorporates a fourth antigen binding domain that specifically binds a fourth antigen. (e.g., as a quadraspecific antibody).

In one aspect, provided herein is a method of enriching a TRGDC-expressing cell comprising: providing a sample comprising the TRGDC-expressing cell; contacting the sample with a TRGDC antibody provided herein; and enriching the TRGDC-expressing cell bound to the TRGDC antibody. In one aspect, provided herein is a method of isolating a TRGDC-expressing cell comprising: providing a sample comprising the TRGDC-expressing cell; contacting the sample with a TRGDC antibody provided herein; and isolating the TRGDC-expressing cell bound to the TRGDC antibody. In one aspect, provided herein is a method of separating a TRGDC-expressing cell comprising: providing a sample comprising the TRGDC-expressing cell; contacting the sample with a TRGDC antibody provided herein; and separating the TRGDC-expressing cell bound to the TRGDC antibody. In one aspect, provided herein is a method of purifying a TRGDC-expressing cell comprising: providing a sample comprising the TRGDC-expressing cell; contacting the sample with a TRGDC antibody provided herein; and purifying the TRGDC-expressing cell bound to the TRGDC antibody. In one aspect, provided herein is a method of sorting a TRGDC-expressing cell comprising: providing a sample comprising the TRGDC-expressing cell; contacting the sample with a TRGDC antibody provided herein; and sorting the TRGDC-expressing cell bound to the TRGDC antibody. In one aspect, provided herein is a method of selecting a TRGDC-expressing cell comprising: providing a sample comprising the TRGDC-expressing cell; contacting the sample with a TRGDC antibody provided herein; and selecting the TRGDC-expressing cell bound to the TRGDC antibody. In one aspect, provided herein is a method of capturing a TRGDC-expressing cell comprising: providing a sample comprising the TRGDC-expressing cell; contacting the sample with a TRGDC antibody provided herein; and capturing the TRGDC-expressing cell bound to the TRGDC antibody. In one aspect, provided herein is a method of detecting a TRGDC-expressing cell comprising: providing a sample comprising the TRGDC-expressing cell; contacting the sample with a TRGDC antibody provided herein; and detecting the TRGDC-expressing cell bound to the TRGDC antibody.

In one aspect, provided herein is a method of enriching a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and enriching the TRGDC-expressing cell bound to the TRGDC antibody. In one aspect, provided herein is a method of isolating a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and isolating the TRGDC-expressing cell bound to the TRGDC antibody. In one aspect, provided herein is a method of separating a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and separating the TRGDC-expressing cell bound to the TRGDC antibody. In one aspect, provided herein is a method of purifying a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and purifying the TRGDC-expressing cell bound to the TRGDC antibody. In one aspect, provided herein is a method of sorting a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and sorting the TRGDC-expressing cell bound to the TRGDC antibody. In one aspect, provided herein is a method of selecting a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and selecting the TRGDC-expressing cell bound to the TRGDC antibody. In one aspect, provided herein is a method of capturing a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and capturing the TRGDC-expressing cell bound to the TRGDC antibody. In one aspect, provided herein is a method of detecting a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and detecting the TRGDC-expressing cell bound to the TRGDC antibody.

In one aspect, provided herein is a method of enriching a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and enriching the TRGDC-expressing cell based on binding of the TRGDC-expressing cell to the TRGDC antibody. In one aspect, provided herein is a method of isolating a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and isolating the TRGDC-expressing cell based on binding of the TRGDC-expressing cell to the TRGDC antibody. In one aspect, provided herein is a method of separating a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and separating the TRGDC-expressing cell based on binding of the TRGDC-expressing cell to the TRGDC antibody. In one aspect, provided herein is a method of purifying a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and purifying the TRGDC-expressing cell based on binding of the TRGDC-expressing cell to the TRGDC antibody. In one aspect, provided herein is a method of sorting a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and sorting the TRGDC-expressing cell based on binding of the TRGDC-expressing cell to the TRGDC antibody. In one aspect, provided herein is a method of selecting a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and selecting the TRGDC-expressing cell based on binding of the TRGDC-expressing cell to the TRGDC antibody. In one aspect, provided herein is a method of capturing a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and capturing the TRGDC-expressing cell based on binding of the TRGDC-expressing cell to the TRGDC antibody. In one aspect, provided herein is a method of detecting a TRGDC-expressing cell comprising: contacting a TRGDC-expressing cell with a TRGDC antibody provided herein; and detecting the TRGDC-expressing cell based on binding of the TRGDC-expressing cell to the TRGDC antibody.

In certain embodiments of the methods, the TRGDC-expressing cell is a T cell. In some embodiments of the methods, the TRGDC-expressing cell is in a population of cells. In some embodiments of the methods, the TRGDC-expressing cell is in a population of lymphocytes. In some embodiments of the methods, the TRGDC-expressing cell is in a population of T cells. In some embodiments of the methods, the TRGDC-expressing cell is provided as a population of cells. In some embodiments of the methods, the TRGDC-expressing cell is provided as a population of lymphocytes. In some embodiments of the methods, the TRGDC-expressing cell is provided as a population of T cells. In some embodiments of the methods, the TRGDC-expressing cell is provided as a sample comprising a population of cells. In some embodiments of the methods, the TRGDC-expressing cell is provided as a sample comprising a population of lymphocytes. In some embodiments of the methods, the TRGDC-expressing cell is provided as a sample comprising a population of T cells. In some embodiments of the methods, the sample is a blood sample. In some embodiments of the methods, the sample is a tissue sample. In some embodiments of the methods, the sample is a tissue culture sample.

In some embodiments of the methods, the TRGDC antibody is a multispecific TRGDC antibody provided herein. In some embodiments of the methods, the TRGDC antibody is a bispecific TRGDC antibody provided herein. In some embodiments of the methods, the TRGDC antibody is a trispecific TRGDC antibody provided herein. In some embodiments of the methods, the TRGDC antibody is a quadraspecific TRGDC antibody provided herein. In certain embodiments, the TRGDC antibody specifically binds to TRGDC. In one embodiment, the multispecific TRGDC antibody comprises: (a) a first binding domain that binds TRGDC, and (b) a second binding domain that binds to a second target. In one embodiment, the multispecific TRGDC antibody comprises: (a) a first binding domain that binds TRGDC, and (b) a second binding domain that binds to a second target, and (c) a third binding domain that binds to a third target. In one embodiment, the multispecific TRGDC antibody comprises: (a) a first binding domain that binds TRGDC, and (b) a second binding domain that binds to a second target, (c) a third binding domain that binds to a third target, and (d) a fourth binding domain that binds to a fourth target. In one embodiment, the multispecific TRGDC antibody comprises: (a) a first binding domain that specifically binds TRGDC, and (b) a second binding domain that specifically binds to a second target. In one embodiment, the multispecific TRGDC antibody comprises: (a) a first binding domain that specifically binds TRGDC, and (b) a second binding domain that specifically binds to a second target, and (c) a third binding domain that specifically binds to a third target. In one embodiment, the multispecific TRGDC antibody comprises: (a) a first binding domain that specifically binds TRGDC, and (b) a second binding domain that specifically binds to a second target, (c) a third binding domain that specifically binds to a third target, and (d) a fourth binding domain that specifically binds to a fourth target.

In specific embodiments of the methods provided herein, the method uses multi-marker detection. In some embodiments, the multi-marker detection uses a multispecific TRGDC antibody provided herein. In some embodiments, the multi-marker detection uses a bispecific TRGDC antibody provided herein. In some embodiments, the multi-marker detection uses a trispecific TRGDC antibody provided herein. In some embodiments, the multi-marker detection uses a quadraspecific TRGDC antibody provided herein.

In certain embodiments of the methods provided herein, the methods are included as steps in a T cell manufacturing process. In certain embodiments, the cells are CAR-T cells. In certain embodiments of the methods provided herein, the methods are included as steps in a T cell modification process.

In certain embodiments of the methods provided herein, the methods are included as steps in a diagnostic method. In certain embodiments of the methods provided herein, the methods are included as steps in a method to quantify the TRGDC-expressing T cells.

In certain embodiments of the methods provided herein, the method further comprises expanding the enriched, isolated, separated, purified, sorted, selected, captured or detected TRGDC-expressing cells. In certain embodiments, the expanding is in vitro. In certain embodiments, the expanding is in vivo. In certain embodiments of the methods provided herein, the method further comprises growing the enriched, isolated, separated, purified, sorted, selected, captured or detected TRGDC-expressing cells. In certain embodiments, the growing is in vitro. In certain embodiments, the growing is in vivo. In certain embodiments of the methods provided herein, the method further comprises quantifying the enriched, isolated, separated, purified, sorted, selected, captured or detected TRGDC-expressing cells.

Embodiments

This invention provides the following non-limiting embodiments.

In one set of embodiments, provided are:

• A1. An antibody that binds T cell receptor (TCR) Vγ9 (TRGV9), comprising:
  • (1) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:31; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:32;
  • (2) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:65; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:66;
  • (3) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:99; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:100;
  • (4) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:133; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:134;
  • (5) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:167; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:168;
  • (6) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:201; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:202;
  • (7) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:235; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:236;
  • (8) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:269; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:270;
  • (9) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:303; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:304;
  • (10) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:337; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:338;
  • (11) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:371; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:372;
  • (12) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:405; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:406;
  • (13) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:439; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:440;
  • (14) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:473; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:474;
  • (15) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:507; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:508;
  • (16) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:541; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:542;
  • (17) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:575; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:576;
  • (18) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:609; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:610;
  • (19) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:643; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:644;
  • (20) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:677; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:678;
  • (21) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:711; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:712;
  • (22) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:745; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:746;
  • (23) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:779; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:780;
  • (24) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:813; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:814;
  • (25) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:847; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:848;
  • (26) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:881; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:882;
  • (27) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:915; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:916;
  • (28) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:949; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:950;
  • (29) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:983; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:984;
  • (30) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1017; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1018;
  • (31) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1051; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1052;
  • (32) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1085; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1086;
  • (33) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1119; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1120;
  • (34) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1153; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1154;
  • (35) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1187; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1188;
  • (36) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1221; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1222;
  • (37) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1255; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1256;
  • (38) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1289; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1290;
  • (39) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1323; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1324;
  • (40) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1357; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1358;
  • (41) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1391; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1392;
  • (42) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1425; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1426;
  • (43) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1459; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1460;
  • (44) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1493; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1494;
  • (45) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1527; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1528;
  • (46) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1561; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1562;
  • (47) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1595; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1596;
  • (48) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1629; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1630;
  • (49) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1663; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1664;
  • (50) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1697; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1698;
  • (51) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1731; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1732;
  • (52) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1765; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1766;
  • (53) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1799; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1800;
  • (54) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1833; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1834;
  • (55) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1867; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1868;
  • (56) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1901; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1902;
  • (57) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1935; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1936;
  • (58) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:1969; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:1970; or
  • (59) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2003; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2004.
• A2. The antibody of embodiment A1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the Kabat numbering system.
• A3. The antibody of embodiment A1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the Chothia numbering system.
• A4. The antibody of embodiment A1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the AbM numbering system.
• A5. The antibody of embodiment A1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the Contact numbering system.
• A6. The antibody of embodiment A1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the IMGT numbering system.
• A7. The antibody of any one of embodiments A1 to A6, wherein the antibody is a humanized antibody.
• A8. The antibody of any one of embodiments A1 to A7, wherein the antibody is an IgG antibody.
• A9. The antibody of embodiment A8, wherein the IgG antibody is an IgG1, IgG2, IgG3, or IgG4 antibody.
• A10. The antibody of any one of embodiments A1 to A9, wherein the antibody comprises a kappa light chain.
• A11. The antibody of any one of embodiments A1 to A9, wherein the antibody comprises a lambda light chain.
• A12. The antibody of any one of embodiments A1 to A11, wherein the antibody is a monoclonal antibody.
• A13. The antibody of any one of embodiments A1 to A12, wherein the antibody binds a TRGV9 antigen.
• A14. The antibody of any one of embodiments A1 to A12, wherein antibody binds a TRGV9 epitope.
• A15. The antibody of any one of embodiments A1 to A14, wherein the antibody specifically binds to TRGV9.
• A16. The antibody of any one of embodiments A1 to A15, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an antigen of the TRGV9.
• A17. The antibody of any one of embodiments A1 to A15, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an epitope of the TRGV9.
• A18. The antibody of any one of embodiments A1 to A17, wherein the TRGV9 is present on the surface of a T cell.
• A19. The antibody of any one of embodiments A1 to A18, wherein the antibody is multivalent.
• A20. The antibody of embodiment A19, wherein the antibody is capable of binding at least three antigens.
• A21. The antibody of embodiment A19, wherein the antibody is capable of binding at least five antigens.
• A22. The antibody of any one of embodiments A1 to A21, wherein the antibody is a multispecific antibody.
• A23. The antibody of embodiment A22, wherein the antibody is a bispecific antibody.
• A24. A nucleic acid sequence encoding the antibody of any one of embodiments A1 to A23.
• A25. A vector comprising the nucleic acid sequence of embodiment A24.
• A26. A host cell comprising the vector of embodiment A25.
• A27. A kit comprising the vector of embodiment A25 and packaging for the same.
• A28. A kit comprising the antibody of any one of embodiments A1 to A23 and packaging for the same.
• A29. A pharmaceutical composition comprising the antibody of any one of embodiments A1 to A23, and a pharmaceutically acceptable carrier.
• A30. A method of producing the pharmaceutical composition of embodiment A29, comprising combining the antibody with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
• A31. A method of activating a T cell expressing TRGV9, comprising contacting the T cell with the antibody of any one of embodiments A1 to A23.
• A32. The method of embodiment A31, wherein the contacting results in an increase in CD69, CD25, and/or Granzyme B expression, as compared to a control T cell expressing TRGV9.
• B1. An antibody that binds TCR V62 (TRDV2), comprising:
  • (1) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2037; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2038;
  • (2) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2071; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2072;
  • (3) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2105; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2106;
  • (4) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2139; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2140;
  • (5) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2173; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2174;
  • (6) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2207; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2208;
  • (7) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2241; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2242;
  • (8) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2275; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2276;
  • (9) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2309; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2310;
  • (10) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2343; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2344;
  • (11) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2377; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2378;
  • (12) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2411; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2412;
  • (13) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2445; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2446;
  • (14) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2479; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2480;
  • (15) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2513; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2514;
  • (16) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2547; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2548;
  • (17) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2581; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2582;
  • (18) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2615; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2616;
  • (19) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2649; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2650;
  • (20) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2683; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2684;
  • (21) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2717; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2718;
  • (22) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2751; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2752;
  • (23) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2785; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2786;
  • (24) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2819; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2820;
  • (25) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2853; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2854;
  • (26) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2887; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2888;
  • (27) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2921; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2922;
  • (28) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2955; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2956;
  • (29) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:2989; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:2990;
  • (30) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3023; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3024;
  • (31) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3057; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3058;
  • (32) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3091; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3092;
  • (33) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3125; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3126;
  • (34) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3159; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3160;
  • (35) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3193; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3194;
  • (36) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3227; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3228;
  • (37) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3261; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3262;
  • (38) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3295; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3296;
  • (39) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3329; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3330;
  • (40) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3363; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3364;
  • (41) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3397; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3398;
  • (42) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3431; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3432;
  • (43) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3465; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3466;
  • (44) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3499; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3500;
  • (45) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3533; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3534;
  • (46) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3567; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3568;
  • (47) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3601; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3602;
  • (48) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3635; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3636;
  • (49) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3669; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3670;
  • (50) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3703; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3704;
  • (51) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3737; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3738;
  • (52) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3771; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3772;
  • (53) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3805; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3806;
  • (54) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3839; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3840;
  • (55) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3873; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3874;
  • (56) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3907; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3908;
  • (57) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3941; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3942;
  • (58) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:3975; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:3976;
  • (59) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4009; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4010;
  • (60) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4043; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4044;
  • (61) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4077; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4078; or
  • (62) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4111; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4112.
• B2. The antibody of embodiment B1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the Kabat numbering system.
• B3. The antibody of embodiment B1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the Chothia numbering system.
• B4. The antibody of embodiment B1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the AbM numbering system.
• B5. The antibody of embodiment B1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the Contact numbering system.
• B6. The antibody of embodiment B1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the IMGT numbering system.
• B7. The antibody of any one of embodiments B1 to B6, wherein the antibody is a humanized antibody.
• B8. The antibody of any one of embodiments B1 to B7, wherein the antibody is an IgG antibody.
• B9. The antibody of embodiment B8, wherein the IgG antibody is an IgG1, IgG2, IgG3, or IgG4 antibody.
• B10. The antibody of any one of embodiments B1 to B9, wherein the antibody comprises a kappa light chain.
• B11. The antibody of any one of embodiments B1 to B9, wherein the antibody comprises a lambda light chain.
• B12. The antibody of any one of embodiments B1 to B11, wherein the antibody is a monoclonal antibody.
• B13. The antibody of any one of embodiments B1 to B12, wherein the antibody binds a TRDV2 antigen.
• B14. The antibody of any one of embodiments B1 to B12, wherein antibody binds a TRDV2 epitope.
• B15. The antibody of any one of embodiments B1 to B14, wherein the antibody specifically binds to TRDV2.
• B16. The antibody of any one of embodiments B1 to B15, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an antigen of the TRDV2.
• B17. The antibody of any one of embodiments B1 to B15, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an epitope of the TRDV2.
• B18. The antibody of any one of embodiments B1 to B17, wherein the TRDV2 is present on the surface of a T cell.
• B19. The antibody of any one of embodiments B1 to B18, wherein the antibody is multivalent.
• B20. The antibody of embodiment B19, wherein the antibody is capable of binding at least three antigens.
• B21. The antibody of embodiment B19, wherein the antibody is capable of binding at least five antigens.
• B22. The antibody of any one of embodiments B1 to B21, wherein the antibody is a multispecific antibody.
• B23. The antibody of embodiment B22, wherein the antibody is a bispecific antibody.
• B24. A nucleic acid sequence encoding the antibody of any one of embodiments B1 to B23.
• B25. A vector comprising the nucleic acid sequence of embodiment B24.
• B26. A host cell comprising the vector of embodiment B25.
• B27. A kit comprising the vector of embodiment B25 and packaging for the same.
• B28. A kit comprising the antibody of any one of embodiments B1 to B23 and packaging for the same.
• B29. A pharmaceutical composition comprising the antibody of any one of embodiments B1 to B23, and a pharmaceutically acceptable carrier.
• B30. A method of producing the pharmaceutical composition of embodiment B29, comprising combining the antibody with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
• B31. A method of activating a T cell expressing TRDV2, comprising contacting the T cell with the antibody of any one of embodiments B1 to B23.
• B32. The method of embodiment B31, wherein the contacting results in an increase in CD69, CD25, and/or Granzyme B expression, as compared to a control T cell expressing TRDV2.
• C1. An antibody that binds TCR gamma delta constant region (TRGDC), comprising:
  • (1) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4145; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4146;
  • (2) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4179; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4180;
  • (3) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4213; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4214;
  • (4) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4247; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4248;
  • (5) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4281; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4282;
  • (6) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4315; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4316;
  • (7) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4349; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4350;
  • (8) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4383; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4384;
  • (9) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4417; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4418;
  • (10) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4451; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4452;
  • (11) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4485; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4486;
  • (12) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4519; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4520;
  • (13) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4553; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4554;
  • (14) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4587; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4588;
  • (15) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4621; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4622; or
  • (16) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having an amino acid sequence of SEQ ID NO:4655; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having an amino acid sequence of SEQ ID NO:4656.
• C2. The antibody of embodiment C1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the Kabat numbering system.
• C3. The antibody of embodiment C1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the Chothia numbering system.
• C4. The antibody of embodiment C1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the AbM numbering system.
• C5. The antibody of embodiment C1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the Contact numbering system.
• C6. The antibody of embodiment C1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to the IMGT numbering system.
• C7. The antibody of any one of embodiments C1 to C6, wherein the antibody is a humanized antibody.
• C8. The antibody of any one of embodiments C1 to C7, wherein the antibody is an IgG antibody.
• C9. The antibody of embodiment C8, wherein the IgG antibody is an IgG1, IgG2, IgG3, or IgG4 antibody.
• C10. The antibody of any one of embodiments C1 to C9, wherein the antibody comprises a kappa light chain.
• C11. The antibody of any one of embodiments C1 to C9, wherein the antibody comprises a lambda light chain.
• C12. The antibody of any one of embodiments C1 to C11, wherein the antibody is a monoclonal antibody.
• C13. The antibody of any one of embodiments C1 to C12, wherein the antibody binds a TRGDC antigen.
• C14. The antibody of any one of embodiments C1 to C12, wherein antibody binds a TRGDC epitope.
• C15. The antibody of any one of embodiments C1 to C14, wherein the antibody specifically binds to TRGDC.
• C16. The antibody of any one of embodiments C1 to C15, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an antigen of the TRGDC.
• C17. The antibody of any one of embodiments C1 to C15, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an epitope of the TRGDC.
• C18. The antibody of any one of embodiments C1 to C17, wherein the TRGDC is present on the surface of a T cell.
• C19. The antibody of any one of embodiments C1 to C18, wherein the antibody is multivalent.
• C20. The antibody of embodiment C19, wherein the antibody is capable of binding at least three antigens.
• C21. The antibody of embodiment C19, wherein the antibody is capable of binding at least five antigens.
• C22. The antibody of any one of embodiments C1 to C21, wherein the antibody is a multispecific antibody.
• C23. The antibody of embodiment C22, wherein the antibody is a bispecific antibody.
• C24. A nucleic acid sequence encoding the antibody of any one of embodiments C1 to C23.
• C25. A vector comprising the nucleic acid sequence of embodiment C24.
• C26. A host cell comprising the vector of embodiment C25.
• C27. A kit comprising the vector of embodiment C25 and packaging for the same.
• C28. A kit comprising the antibody of any one of embodiments C1 to C23 and packaging for the same.
• C29. A pharmaceutical composition comprising the antibody of any one of embodiments C1 to C23, and a pharmaceutically acceptable carrier.
• C30. A method of producing the pharmaceutical composition of embodiment C29, comprising combining the antibody with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
• C31. A method of activating a T cell expressing TRGDC, comprising contacting the T cell with the antibody of any one of embodiments C1 to C23.
• C32. The method of embodiment C31, wherein the contacting results in an increase in CD69, CD25, and/or Granzyme B expression, as compared to a control T cell expressing TRGDC.

Provided in the Examples herein are exemplary antibodies that bind to TRGV9. Also provided in the Examples herein are exemplary antibodies that bind to TRDV2. Also provided in the Examples herein are exemplary antibodies that bind to TRGDC. Exemplary binding agents that bind to TRGV9 are provided herein, for example in the Examples, as well as Tables 2-7. Exemplary binding agents that bind to TRDV2 are provided herein, for example in the Examples, as well as Tables 2-7. Exemplary binding agents that bind to TRGDC are provided herein, for example in the Examples, as well as Tables 2-7.

Particular embodiments of this invention are described herein. Upon reading the foregoing description, variations of the disclosed embodiments may become apparent to individuals working in the art, and it is expected that those skilled artisans may employ such variations as appropriate. Accordingly, it is intended that the invention be practiced otherwise than as specifically described herein, and that the invention includes all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law. Moreover, any combination of the above-described elements in all possible variations thereof is encompassed by the invention unless otherwise indicated herein or otherwise clearly contradicted by context. A number of embodiments of the invention have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, the descriptions in the Examples section are intended to illustrate but not limit the scope of invention described in the claims.

EXAMPLES

Example 1: Production of Antibodies that Bind γδ T Cells

1.1: Production of Mabs that Bind γδ T Cell Antigens

Antigens or portions of antigens specific for γδ T cells are used to immunize an animal (e.g., a mouse or a rabbit). To generate the γδ T cell monoclonal antibodies, peripheral blood mononuclear cells are isolated from the whole blood of the immunized animal, and antigen specific B cells are grown. B cells secreting reactive antibodies for the γδ T cell antigens are identified by an antigen-binding ELISA screening of the B cell culture supernatants. High binding ELISA plates are coated with the γδ T cell antigen overnight. The ELISA plates are blocked, and diluted B cell culture supernatants are added to the plates. The plates are incubated at room temperature and following incubation, a secondary antibody specific for recognizing the γδ T cell antigen antibody is added to the plate to determine if the γδ T cell antigen antibody bound the γδ T cell antigen. Binding of the antibody is determined by reaction of a substrate on the secondary antibody.

After the identification of monoclonal antibodies that are capable of binding γδ T cell antigens, the variable regions of the heavy and light chains of the γδ T cell antibody are sequenced. γδ T cell antibodies that bind to TRGV9, TRDV2 and TRGDC are produced. Constructs are created for the expression of the heavy and light chain of the γδ T cell antibody. The constructs are transfected into a host cell to express the heavy and light chains, and the γδ T cell antibody is isolated from the supernatant.

1.2: Generation of Trgv9 Antibodies, Trdv2 Antibodies, and Trgdc Antibodies

Immunogen. A recombinant human TCR Vγ9×Vδ2 fused to a human Fc was used as an immunogen, and the sequence is listed in Table 1.

TABLE 1
Amino acid sequence of recombinant human TCR Vγ9 × Vδ2
heterodimeric protein fused to human Fc
	Protein		SEQ ID
Name	ID	Sequence	NO:
Recombinant	Vg9	MAWVWTLLFLMAAAQSIQAAGHLEQPQISSTKTLSKTARLECVV	4659
human [TCR	chain	SGITISATSVYWYRERPGEVIQFLVSISYDGTVRKESGIPSGKF
Vg9 × Vd2]-		EVDRIPETSTSTLTIHNVEKQDIATYYCALWEAQQELGKKIKVF
hFc		GPGTKLIITDKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLE
		KFFPDVIKIHWEEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPE
		KSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPKDNEPK
		SCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV
		VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL
		TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYV
		YPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT
		PPVLDSDGSFALVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQ
		KSLSLSPGK
	Vd2	MAWVWTLLFLMAAAQSIQAAIELVPEHQTVPVSIGVPATLRCSM	4660
	chain	KGEAIGNYYINWYRKTQGNTMTFIYREKDIYGPGFKDNFQGDID
		IAKNLAVLKILAPSERDEGSYYCACDTLGMGGEYTDKLIFGKGT
		RVTVEPRSQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSS
		KKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVH
		STDFEVKTDSTDHVKPKETENTKQPSKSEPKSCDKTHTCPPCPA
		PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF
		NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY
		KCKVSNKALPAPIEKTISKAKGQPREPQVYVLPPSREEMTKNQV
		SLLCLVKGFYPSDIAVEWESNGQPENNYLTWPPVLDSDGSFFLY
		SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Protein Production of the Immunogen. Expression plasmids encoding the immunogen (see Table 1) were transfected into CHO cell at a DNA ratio of 1:1. Total amount of DNA for a 750 mL expression scale was 750 μg. Final expression volume was 1 L after two feedings and enhancer additions. Using an ÄKTAPRIME plus instrument (GE Healthcare Life Sciences), supernatant (1 L) after 7 days was applied with a flow-rate of 5 mL/min to a MABSELECT SURE (GE Life Sciences) with a column volume (CV) of 10 mL pre-equilibrated with phosphate buffered saline (PBS), pH 6.8. Non-specific proteins binding to the column material was washed off with PBS supplemented with 500 mM NaCl, pH 6.8 (5 CV). The Fc-containing immunogen was eluted stepwise with 40 mM sodium acetate pH 5.0 (5 CV), pH 4.5 (5 CV), pH 4.0 (10 CV), pH 3.5 (5 CV), and pH 3.0 (5 CV). Fractions were pooled, and applied (5 mL) at a flow-rate of 0.2 mL/min on to a HiLoad 16/600 SUPERDEX (GE Healthcare) column pre-equilibrated with PBS (pH 6.8). Target protein was eluted, pooled, and analyzed by SDS-PAGE, analytic SEC, and intact mass by mass spectrometry. Purity was estimated to >99%.

Antibodies were generated using ALIVAMAB transgenic mice technology (Ablexis). ALIVAMAB mice were immunized with recombinant human Vγ9/Vδ2 TCR protein. Lymphocytes were extracted from secondary lymphoid organs and either fused with FO mouse myeloma cell line for hybridoma generation or subjected to single cell sorting via FACS. Hybridoma supernatants were screened by MSD electrochemiluminescence or by FACS for binding to γδ T cells. Confirmed cell binders were light chain isotyped via ELISA. Single cell sorting supernatants were screened by MSD electrochemiluminescence for binding to recombinant human Vγ9/Vδ2 protein. Several hits with the desired binding profile were selected and sequenced, as provided below.

The VH and VL sequences of certain TRGV9, TRDV2, and TRGDC antibodies are provided in Table 2. The CDRs sequences of certain TRGV9, TRDV2, and TRGDC antibodies are provided in Table 3 (Kabat), Table 4 (Chothia), Table 5 (AbM), Table 6 (Contact), and Table 7 (IMGT).

TABLE 2
VH and VL Amino Acid Sequences
	Protein	HC	LC	VH AA	VL AA
#	Name	Isotype	Isotype	sequence	sequence	Heavy Chain AA sequence	Light Chain AA sequence
1	VG9B54	IgG1	Kappa	EVQLVESGGGL	EIVMTQSPGT	EVQLVESGGGLVKPGGSLRLSCAASGFAFSSYSLTWVR	EIVMTQSPGTLSLSPGERA
				VKPGGSLRLSC	LSLSPGERAT	QAPGKGLEWVSSISSSSSYIFYADSVKGRFTISRDNAK	TLSCRASQSVSSSYLAWFQ
				AASGFAFSSYS	LSCRASQSVS	NSLYLQMNSLRAEDTAVYYCATDGELGPFDYWGQGTTV	QKPGQAPRRLIYGASSRAT
				LTWVRQAPGKG	SSYLAWFQQK	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQAPRRLIY	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	SRLEPEDFAVYYCQQYGRS
				SYIFYADSVKG	GASSRATGIP	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	PLTFGGGTKVEIKRTVAAP
				RFTISRDNAKN	DRFSGSGSGT	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	SVFIFPPSDEQLKSGTASV
				SLYLQMNSLRA	DFTLTISRLE	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	VCLLNNFYPREAKVQWKVD
				EDTAVYYCATD	PEDFAVYYCQ	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	NALQSGNSQESVTEQDSKD
				GELGPFDYWGQ	QYGRSPLTFG	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	STYSLSSTLTLSKADYEKH
				GTTVTVSS	GGTKVEIK	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	KVYACEVTHQGLSSPVTKS
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	FNRGEC
				31	32	33	34
2	VG9B121	IgG1	Kappa	EVQLVESGGGL	DIQMTQSPGT	EVQLVESGGGLVKPGGSLRLSCVASGFTFSDYAMDWVR	DIQMTQSPGTLSSSPGERA
				VKPGGSLRLSC	LSSSPGERAT	QAPGKGLDWISSISSTSNYIFYADSVKGRFTISRDNAK	TLSCRASQSVSSSYFAWYQ
				VASGFTFSDYA	LSCRASQSVS	NSLYLQMNSLRVEDSAVYYCANSYNWNYGGAFDIWGQG	QKPGRAPRLLIYGASSRAT
				MDWVRQAPGKG	SSYFAWYQQK	TMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD	GIPDRFSGSGSGTDFTLTI
				LDWISSISSTS	PGRAPRLLIY	YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV	SRLEPEDFAVYFCQQYGRS
				NYIFYADSVKG	GASSRATGIP	TVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH	PLTFGGGTKVEIKRTVAAP
				RFTISRDNAKN	DRFSGSGSGT	TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV	SVFIFPPSDEQLKSGTASV
				SLYLQMNSLRV	DFTLTISRLE	VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY	VCLLNNFYPREAKVQWKVD
				EDSAVYYCANS	PEDFAVYFCQ	RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK	NALQSGNSQESVTEQDSKD
				YNWNYGGAFDI	QYGRSPLTFG	AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD	STYSLSSTLTLSKADYEKH
				WGQGTMVTVSS	GGTKVEIK	IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK	KVYACEVTHQGLSSPVTKS
						SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	FNRGEC
				65	66	67	68
3	VG9B429	IgG1	Kappa	QVQLVQSGGGL	DIQMTQSPSS	QVQLVQSGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	DIQMTQSPSSVSASVGDRV
				VKPGGSLRLSC	VSASVGDRVT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TITCRASQGINSWLAWYQQ
				SASGFTFSNYD	ITCRASQGIN	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	KPGNAPKLLIYAASSLQSG
				MNWVRQAPGKG	SWLAWYQQKP	GQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	VPSRFSGIGSGTDFIFTIS
				LEWVSSISSSS	GNAPKLLIYA	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SLQPEDFASYYCQQANSFP
				SYIYYADSVKG	ASSLQSGVPS	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	WTFGQGTRLEIKRTVAAPS
				RFTISRDNAKN	RFSGIGSGTD	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	VFIFPPSDEQLKSGTASVV
				SLYLQMNSLRA	FIFTISSLQP	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	CLLNNFYPREAKVQWKVDN
				EDTAVYHCARD	EDFASYYCQQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	ALQSGNSQESVTEQDSKDS
				VGVTTDYYYYG	ANSFPWTFGQ	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	TYSLSSTLTLSKADYEKHK
				MDVWGQGTMVT	GTRLEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	VYACEVTHQGLSSPVTKSF
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				99	100	101	102
4	VG9B370	IgG1	Kappa	EVQLVESGGGL	EIVLTQSPGT	EVQLVESGGGLVKPGGSLRLSCAASRFTLSSYDMNWVR	EIVLTQSPGTLSLSPGERA
				VKPGGSLRLSC	LSLSPGERAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVSSSYLAWYQ
				AASRFTLSSYD	LSCRASQSVS	NSLYLQMNSLRAEDTAVYYCARDRGVGGTDYYYYGLDV	QKPGQAPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQAPRLLIY	LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC	PPYTFGQGTKVEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY	VVCLLNNFYPREAKVQWKV
				EDTAVYYCARD	PEDFAVYYCQ	NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK	DNALQSGNSQESVTEQDSK
				RGVGGTDYYYY	QYGSSPPYTF	TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF	DSTYSLSSTLTLSKADYEK
				GLDVWGQGTTV	GQGTKVEIK	YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL	HKVYACEVTHQGLSSPVTK
				TVSS		TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				133	134	135	136
5	VG9B80	IgG1	Kappa	EVQLVQSGGGL	EIVLTQSPGT	EVQLVQSGGGLVKSGGSLRLSCAASGFTFSTYSMNWVR	EIVLTQSPGTLSLSAGERA
				VKSGGSLRLSC	LSLSAGERAT	QAPGKGLEWVSSISSSSSYIFYADSVKGRIIISRDNAK	TLSCRASQSISSSYLAWYQ
				AASGFTFSTYS	LSCRASQSIS	NSLYLQMNSVRADDTAVYYCAKDGELGVFDYWGQGTLV	QKPGQAPRVLIYGPSGRAT
				MNWVRQAPGKG	SSYLAWYQQK	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	GIPDRFRGSGSGTDFTLTI
				LEWVSSISSSS	PGQAPRVLIY	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	SRLEPEDFAVYYCQQFGRS
				SYIFYADSVKG	GPSGRATGIP	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	PLTFGGGTKVEIKRTVAAP
				RIIISRDNAKN	DRFRGSGSGT	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	SVFIFPPSDEQLKSGTASV
				SLYLQMNSVRA	DFTLTISRLE	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	VCLLNNFYPREAKVQWKVD
				DDTAVYYCAKD	PEDFAVYYCQ	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	NALQSGNSQESVTEQDSKD
				GELGVFDYWGQ	QFGRSPLTFG	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	STYSLSSTLTLSKADYEKH
				GTLVTVSS	GGTKVEIK	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	KVYACEVTHQGLSSPVTKS
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	FNRGEC
				167	168	169	170
6	VG9B414	IgG1	Kappa	EVQLVESGGGL	EIVMTQSPSS	EVQLVESGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	EIVMTQSPSSVSASVGDRV
				VKPGGSLRLSC	VSASVGDRVT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TITCRASQGINSWLAWYQQ
				SASGFTFSNYD	ITCRASQGIN	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	KPGNAPKLLIYAASSLQSG
				MNWVRQAPGKG	SWLAWYQQKP	GQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	VPSRFSGIGSGTDFIFTIS
				LEWVSSISSSS	GNAPKLLIYA	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SLQPEDFASYYCQQANSFP
				SYIYYADSVKG	ASSLQSGVPS	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	WTFGQGTRLEIKRTVAAPS
				RFTISRDNAKN	RFSGIGSGTD	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	VFIFPPSDEQLKSGTASVV
				SLYLQMNSLRA	FIFTISSLQP	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	CLLNNFYPREAKVQWKVDN
				EDTAVYHCARD	EDFASYYCQQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	ALQSGNSQESVTEQDSKDS
				VGVTTDYYYYG	ANSFPWTFGQ	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	TYSLSSTLTLSKADYEKHK
				MDVWGQGTMVT	GTRLEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	VYACEVTHQGLSSPVTKSF
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				201	202	203	204
7	VG9B195	IgG1	Lambda	EVQLVESGGGL	SYELMQPPSV	EVQLVESGGGLVKPGGSLRLSCAASGFTFSPYTMNWVR	SYELMQPPSVSVSPGQTAS
				VKPGGSLRLSC	SVSPGQTASI	QAPGKGLEWVSSISSSSSYMYYADSVKGRFTISRDNAK	ITCSGDKLGDKYACWYQQK
				AASGFTFSPYT	TCSGDKLGDK	NSLYLQMNSLRAEDTAVYYCARDGDLVGPTYYFDYWGQ	PGQSPVLVIYQHNKRPSGI
				MNWVRQAPGKG	YACWYQQKPG	GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK	PERFSGSNSGKTATLTISG
				LEWVSSISSSS	QSPVLVIYQH	DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV	TQAMDEADYYCQAWDSTTV
				SYMYYADSVKG	NKRPSGIPER	VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT	VFGGGTKLTVLGQPKAAPS
				RFTISRDNAKN	FSGSNSGKTA	HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC	VTLFPPSSEELQANKATLV
				SLYLQMNSLRA	TLTISGTQAM	VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST	CLISDFYPGAVTVAWKADS
				EDTAVYYCARD	DEADYYCQAW	YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS	SPVKAGVETTTPSKQSNNK
				GDLVGPTYYFD	DSTTVVFGGG	KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS	YAASSYLSLTPEQWKSHRS
				YWGQGTLVTVS	TKLTVL	DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD	YSCQVTHEGSTVEKTVAPT
				S		KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	ECS
				235	236	237	238
8	VG9B140	IgG1	Kappa	EVQLVESGGGL	EIVMTQSPGT	EVQLVESGGGLVKPGGSLRLSCAGSGFTFRSYDMNWVR	EIVMTQSPGTLSLSPGERA
				VKPGGSLRLSC	LSLSPGERAT	QAPGKGLEWVSSISTSSGYIYYADSVKGRFTISRDNAK	TLSCRASQSVSSSYLAWYQ
				AGSGFTFRSYD	LSCRASQSVS	NSLSLQMNSLRAEDTAVFYCARDRGIAVAGDYYYGMDV	QKPGQAPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	WGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC	GIPDRFSGSGSGTDFTLTI
				LEWVSSISTSS	PGQAPRLLIY	LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL	SRLEAEDFAVYYCQQYGSS
				GYIYYADSVKG	GASSRATGIP	SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC	PPYTFGQGTKVEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE	PSVFIFPPSDEQLKSGTAS
				SLSLQMNSLRA	DFTLTISRLE	VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY	VVCLLNNFYPREAKVQWKV
				EDTAVFYCARD	AEDFAVYYCQ	NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK	DNALQSGNSQESVTEQDSK
				RGIAVAGDYYY	QYGSSPPYTF	TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF	DSTYSLSSTLTLSKADYEK
				GMDVWGQGTMV	GQGTKVEIK	YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL	HKVYACEVTHQGLSSPVTK
				TVSS		TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				269	270	271	272
9	VG9B426	IgG1	Kappa	EVQLVQSGGGL	ETTLTQSPGT	EVQLVQSGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	ETTLTQSPGTLSLSPGDRA
				VKPGGSLRLSC	LSLSPGDRAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVASSYLAWYQ
				SASGFTFSNYD	LSCRASQSVA	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	QKPGQSPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	GQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQSPRLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	PPYTFGQGTKVEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	VVCLLNNFYPREAKVQWKV
				EDTAVYHCARD	PEDFAVYYCQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	DNALQSGNSQESVTEQDSK
				VGVTTDYYYYG	QYGSSPPYTF	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSTYSLSSTLTLSKADYEK
				MDVWGQGTMVT	GQGTKVEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	HKVYACEVTHQGLSSPVTK
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				303	304	305	306
10	VG9B46	IgG1	Kappa	EVQLVESGGGL	EIVLTQSPGT	EVQLVESGGGLVKPGGSLRLSCEASGFTFSINSMNWVR	EIVLTQSPGTLSLSPGERA
				VKPGGSLRLSC	LSLSPGERAT	QAPGKGLEWVSSISSTSDYIFNADSVKGRFTISRDNAK	TLSCRTSQSVSRSYLGWYQ
				EASGFTFSINS	LSCRTSQSVS	NSLYLQMNSLRAEDTAVYYCVRDDVFGAFDIWGQGTMV	QKPGQPPRLLIFGSSSRAT
				MNWVRQAPGKG	RSYLGWYQQK	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSTS	PGQPPRLLIF	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	SRLEPEDFAVYYCQQYSRS
				DYIFNADSVKG	GSSSRATGIP	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	PLTFGGGTKVDIKRTVAAP
				RFTISRDNAKN	DRFSGSGSGT	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	SVFIFPPSDEQLKSGTASV
				SLYLQMNSLRA	DFTLTISRLE	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	VCLLNNFYPREAKVQWKVD
				EDTAVYYCVRD	PEDFAVYYCQ	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	NALQSGNSQESVTEQDSKD
				DVFGAFDIWGQ	QYSRSPLTFG	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	STYSLSSTLTLSKADYEKH
				GTMVTVSS	GGTKVDIK	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	KVYACEVTHQGLSSPVTKS
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	FNRGEC
				337	338	339	340
11	VG9B416	IgG1	Kappa	EVQLVESGGGL	EIVLTQSPGT	EVQLVESGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	EIVLTQSPGTLSLSPGDRA
				VKPGGSLRLSC	LSLSPGDRAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVASSYLAWYQ
				SASGFTFSNYD	LSCRASQSVA	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	QKPGQSPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	GQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQSPRLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	PPYTFGQGTKLEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	VVCLLNNFYPREAKVQWKV
				EDTAVYHCARD	PEDFAVYYCQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	DNALQSGNSQESVTEQDSK
				VGVTTDYYYYG	QYGSSPPYTF	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSTYSLSSTLTLSKADYEK
				MDVWGQGTTVT	GQGTKLEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	HKVYACEVTHQGLSSPVTK
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				371	372	373	374
12	VG9B69	IgG1	Kappa	EVQLVESGGGL	EIVMTQSPGT	EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYDINWVR	EIVMTQSPGTLSLSPGERA
				VKPGGSLRLSC	LSLSPGERAT	QAPGKGLEWVSSITSSSYYIYYADSVKGRFTISRDNAK	TLSCRASQSVSSSYLAWYQ
				AASGFTFSSYD	LSCRASQSVS	NSLYLQMNSLRAEDTAVYYCARDLGVRGVDYYYYGLDV	QKPGQAPRLLIYGASSRAT
				INWVRQAPGKG	SSYLAWYQQK	WGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC	GIPDRFSGSGSGTDFTLTI
				LEWVSSITSSS	PGQAPRLLIY	LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL	SRLEPEDFAVYYCQQYGSS
				YYIYYADSVKG	GASSRATGIP	SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC	PPYTFGQGTKVEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY	VVCLLNNFYPREAKVQWKV
				EDTAVYYCARD	PEDFAVYYCQ	NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK	DNALQSGNSQESVTEQDSK
				LGVRGVDYYYY	QYGSSPPYTF	TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF	DSTYSLSSTLTLSKADYEK
				GLDVWGQGTMV	GQGTKVEIK	YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL	HKVYACEVTHQGLSSPVTK
				TVSS		TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				405	406	407	408
13	VG9B415	IgG1	Kappa	EVQLVESGGGL	ETTLTQSPGT	EVQLVESGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	ETTLTQSPGTLSLSPGDRA
				VKPGGSLRLSC	LSLSPGDRAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVASSYLAWYQ
				SASGFTFSNYD	LSCRASQSVA	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	QKPGQSPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	GQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQSPRLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	PPYTFGQGTKLEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	VVCLLNNFYPREAKVQWKV
				EDTAVYHCARD	PEDFAVYYCQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	DNALQSGNSQESVTEQDSK
				VGVTTDYYYYG	QYGSSPPYTF	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSTYSLSSTLTLSKADYEK
				MDVWGQGTTVT	GQGTKLEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	HKVYACEVTHQGLSSPVTK
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				439	440	441	442
14	VG9B104	IgG1	Kappa	EVQLVESGGGL	EIVLTQSPGT	EVQLVESGGGLVKPGGSLRLSCAASGFTFSVYSMNWVR	EIVLTQSPGTLSLSPGERA
				VKPGGSLRLSC	LSLSPGERAT	QAPGKGLEWVSSIGSSSSYIFYADSVKGRFTISRDNAK	TLSCRASQSVSSSYLAWYQ
				AASGFTFSVYS	LSCRASQSVS	NSLYLQMNSLRAEDTAVYYCGRDHDYGGLDYWGQGTLV	QKPGQAPRLLIYGPSNRAT
				MNWVRQAPGKG	SSYLAWYQQK	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	DIPDRFSGTGSGTDFTLTI
				LEWVSSIGSSS	PGQAPRLLIY	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	SRLEPEDFAVYYCQQYGRS
				SYIFYADSVKG	GPSNRATDIP	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	PLTFGGGTKVEIKRTVAAP
				RFTISRDNAKN	DRFSGTGSGT	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	SVFIFPPSDEQLKSGTASV
				SLYLQMNSLRA	DFTLTISRLE	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	VCLLNNFYPREAKVQWKVD
				EDTAVYYCGRD	PEDFAVYYCQ	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	NALQSGNSQESVTEQDSKD
				HDYGGLDYWGQ	QYGRSPLTFG	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	STYSLSSTLTLSKADYEKH
				GTLVTVSS	GGTKVEIK	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	KVYACEVTHQGLSSPVTKS
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	FNRGEC
				473	474	475	476
15	VG9B198	IgG1	Lambda	QVQLQESGPGL	QSVLTQPPSV	QVQLQESGPGLVKPSETLSLTCTVSGDSISSIYWSWIR	QSVLTQPPSVSGAPGQRVT
				VKPSETLSLTC	SGAPGQRVTI	QSAGKGLEWIGRIYTTDITNYNPSLKSRVTMSADTSKN	ISCTGSSSNIGAGYDVHWY
				TVSGDSISSIY	SCTGSSSNIG	QLSLKLTSVTAADTAVYYCAKNGYSYGGFNYWGQGTLV	QRLPGTAPKLLIYGDSYRP
				WSWIRQSAGKG	AGYDVHWYQR	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVPDRFSGSKSGTSASLA
				LEWIGRIYTTD	LPGTAPKLLI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ITGLQAEDEADYYCQSYDS
				ITNYNPSLKSR	YGDSYRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	SLSVVVFGGGTKLTVLGQP
				VTMSADTSKNQ	PDRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	KAAPSVTLFPPSSEELQAN
				LSLKLTSVTAA	TSASLAITGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	KATLVCLISDFYPGAVTVA
				DTAVYYCAKNG	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	WKADSSPVKAGVETTTPSK
				YSYGGFNYWGQ	QSYDSSLSVV	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	QSNNKYAASSYLSLTPEQW
				GTLVTVSS	VFGGGTKLTV	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	KSHRSYSCQVTHEGSTVEK
					L	QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	TVAPTECS
				507	508	509	510
16	VG9B463	IgG1	Lambda	EVQLVESGGGL	QPVLTQSSSA	EVQLVESGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	QPVLTQSSSASGTPGQRVT
				VKPGGSLRLSC	SGTPGQRVTI	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	ISCSGSSSNIGSNTVNWYQ
				SASGFTFSNYD	SCSGSSSNIG	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	QFPGTAPKLLIYTNTQRPS
				MNWVRQAPGKG	SNTVNWYQQF	GQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GVPDRFSGSKSGTLVSLAI
				LEWVSSISSSS	PGTAPKLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SGLQSEDEADYYCAAWDDS
				SYIYYADSVKG	TNTQRPSGVP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	LNAWVFGGGTKLTVLGQPK
				RFTISRDNAKN	DRFSGSKSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	AAPSVTLFPPSSEELQANK
				SLYLQMNSLRA	LVSLAISGLQ	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	ATLVCLISDFYPGAVTVAW
				EDTAVYHCARD	SEDEADYYCA	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	KADSSPVKAGVETTTPSKQ
				VGVTTDYYYYG	AWDDSLNAWV	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	SNNKYAASSYLSLTPEQWK
				MDVWGQGTTVT	FGGGTKLTVL	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	SHRSYSCQVTHEGSTVEKT
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VAPTECS
				541	542	543	544
17	VG9B469	IgG1	Kappa	EVQLVESGGGL	DIVMTQSPGT	EVQLVESGGGLVKPGGSLRLSCAASGFTFSHYDMNWVR	DIVMTQSPGTLSLSPGERA
				VKPGGSLRLSC	LSLSPGERAT	QAPGKGLEWVSSISSSSSYIFYADSVKGRFTISRDNAK	TLSCRASQNVSSTYLAWYQ
				AASGFTFSHYD	LSCRASQNVS	NSLLLQMNSLRAEDTAVYHCARDRGVGDTSDYYSFGLD	QKPGQAPRLLIYGACSRAT
				MNWVRQAPGKG	STYLAWYQQK	VWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALG	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQAPRLLIY	CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS	SRLEPEDYAVYYCQQYGSS
				SYIFYADSVKG	GACSRATGIP	LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS	PPYTFGRGTKLEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP	PSVFIFPPSDEQLKSGTAS
				SLLLQMNSLRA	DFTLTISRLE	EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ	VVCLLNNFYPREAKVQWKV
				EDTAVYHCARD	PEDYAVYYCQ	YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE	DNALQSGNSQESVTEQDSK
				RGVGDTSDYYS	QYGSSPPYTF	KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG	DSTYSLSSTLTLSKADYEK
				FGLDVWGQGTM	GRGTKLEIK	FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK	HKVYACEVTHQGLSSPVTK
				VTVSS		LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				575	576	577	578
18	VG9B428	IgG1	Kappa	EVQLVESGGGL	EIVMTQSPSS	EVQLVESGGGLVKPGGSLRLSCAASGFTFSNYGMNWVR	EIVMTQSPSSVSASVGDRV
				VKPGGSLRLSC	VSASVGDRVT	QAPGKGLEWVSYISSGSSYKYYADSMKGRFTISRDNAM	TITCRASQGINSWLAWYQQ
				AASGFTFSNYG	ITCRASQGIN	NLLYLQMNSLRPEDSAMYYCARDPVVTEYYYYGMDVWG	KPGNAPKLLIYAASSLQSG
				MNWVRQAPGKG	SWLAWYQQKP	QGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	VPSRFSGIGSGTDFIFTIS
				LEWVSYISSGS	GNAPKLLIYA	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	SLQPEDFASYYCQQANSFP
				SYKYYADSMKG	ASSLQSGVPS	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	WTFGQGTKVEIKRTVAAPS
				RFTISRDNAMN	RFSGIGSGTD	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	VFIFPPSDEQLKSGTASVV
				LLYLQMNSLRP	FIFTISSLQP	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	CLLNNFYPREAKVQWKVDN
				EDSAMYYCARD	EDFASYYCQQ	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	ALQSGNSQESVTEQDSKDS
				PVVTEYYYYGM	ANSFPWTFGQ	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	TYSLSSTLTLSKADYEKHK
				DVWGQGTMVTV	GTKVEIK	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	VYACEVTHQGLSSPVTKSF
				SS		DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				609	610	611	612
19	VG9B430	IgG1	Kappa	EVQLLESGGGL	EIVLTQSPGT	EVQLLESGGGLVKPGGSLRLSCSASGFTFSSYDMNWVR	EIVLTQSPGTLSLSPGDRA
				VKPGGSLRLSC	LSLSPGDRAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVASSYLAWYQ
				SASGFTFSSYD	LSCRASQSVA	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	QKPGQSPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	GQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQSPRLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	PPYTFGQGTKLEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	VVCLLNNFYPREAKVQWKV
				EDTAVYHCARD	PEDFAVYYCQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	DNALQSGNSQESVTEQDSK
				VGVTTDYYYYG	QYGSSPPYTF	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSTYSLSSTLTLSKADYEK
				MDVWGQGTMVT	GQGTKLEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	HKVYACEVTHQGLSSPVTK
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				643	644	645	646
20	VG9B423	IgG1	Kappa	EVQLVESGGGL	ETTLTQSPGT	EVQLVESGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	ETTLTQSPGTLSLSPGDRA
				VKPGGSLRLSC	LSLSPGDRAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVASSYLAWYQ
				SASGFTFSNYD	LSCRASQSVA	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	QKPGQSPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	GQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQSPRLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	PPYTFGQGTKVEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	VVCLLNNFYPREAKVQWKV
				EDTAVYHCARD	PEDFAVYYCQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	DNALQSGNSQESVTEQDSK
				VGVTTDYYYYG	QYGSSPPYTF	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSTYSLSSTLTLSKADYEK
				MDVWGQGTMVT	GQGTKVEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	HKVYACEVTHQGLSSPVTK
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				677	678	679	680
21	VG9B98	IgG1	Kappa	EVQLVQSGGDL	EIVLTQSPGT	EVQLVQSGGDLVKSGGSLRLSCAASGFTFSSYSMYWVR	EIVLTQSPGTLSLSPGERA
				VKSGGSLRLSC	LSLSPGERAT	QAPGKGLEWVSSIGSSSTYIFYADSVKGRFTISRDNAM	TLSCRASQSVSTSYLAWFQ
				AASGFTFSSYS	LSCRASQSVS	TSLYLQMNRLGAEDSAVYYCARDGELGPFEYWGQGTLV	QKPGQAPRLLIFGTSSRAT
				MYWVRQAPGKG	TSYLAWFQQK	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	GIPDRFSGSGSGTDFTLTI
				LEWVSSIGSSS	PGQAPRLLIF	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	SRLEPEDFAVYHCLQYGRS
				TYIFYADSVKG	GTSSRATGIP	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	PLTFGGGTKVDIKRTVAAP
				RFTISRDNAMT	DRFSGSGSGT	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	SVFIFPPSDEQLKSGTASV
				SLYLQMNRLGA	DFTLTISRLE	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	VCLLNNFYPREAKVQWKVD
				EDSAVYYCARD	PEDFAVYHCL	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	NALQSGNSQESVTEQDSKD
				GELGPFEYWGQ	QYGRSPLTFG	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	STYSLSSTLTLSKADYEKH
				GTLVTVSS	GGTKVDIK	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	KVYACEVTHQGLSSPVTKS
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	FNRGEC
				711	712	713	714
22	VG9B73	IgG1	Kappa	EVQLVQSGGGL	EIVMTQSPGT	EVQLVQSGGGLVKPGGSLRLSCAASGFTFSNYDMNWVR	EIVMTQSPGTLSLSPGERA
				VKPGGSLRLSC	LSLSPGERAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAR	TLSCRASQSFSSNYLAWYQ
				AASGFTFSNYD	LSCRASQSFS	NSLFLQMSSLRAEDTAVYYCAREIGVTGTTYYQDYGMD	QKPGQAPRLLIYGASSRAT
				MNWVRQAPGKG	SNYLAWYQQK	VWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALG	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQAPRLLIY	CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS	SRLEPEDFALYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS	PPFTFGQGTKVEIKRTVAA
				RFTISRDNARN	DRFSGSGSGT	CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP	PSVFIFPPSDEQLKSGTAS
				SLFLQMSSLRA	DFTLTISRLE	EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ	VVCLLNNFYPREAKVQWKV
				EDTAVYYCARE	PEDFALYYCQ	YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE	DNALQSGNSQESVTEQDSK
				IGVTGTTYYQD	QYGSSPPFTF	KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG	DSTYSLSSTLTLSKADYEK
				YGMDVWGQGTT	GQGTKVEIK	FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK	HKVYACEVTHQGLSSPVTK
				VTVSS		LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				745	746	747	748
23	VG9B133	IgG1	Kappa	EVQLVESGGGL	EIVMTQSPGT	EVQLVESGGGLVKPGGSLRLSCAAAGFTFSNYDMNWVR	EIVMTQSPGTLSLSPGERA
				VKPGGSLRLSC	LSLSPGERAT	QVPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVSSSYLAWYQ
				AAAGFTFSNYD	LSCRASQSVS	NSLYLQMNTLRAEDTAVYYCARDLGITGTTMDYYYGMD	QKPGQAPRLLIYGASSRAT
				MNWVRQVPGKG	SSYLAWYQQK	VWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALG	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQAPRLLIY	CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS	PPYTFGQGTKVDIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP	PSVFIFPPSDEQLKSGTAS
				SLYLQMNTLRA	DFTLTISRLE	EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ	VVCLLNNFYPREAKVQWKV
				EDTAVYYCARD	PEDFAVYYCQ	YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE	DNALQSGNSQESVTEQDSK
				LGITGTTMDYY	QYGSSPPYTF	KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG	DSTYSLSSTLTLSKADYEK
				YGMDVWGQGTM	GQGTKVDIK	FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK	HKVYACEVTHQGLSSPVTK
				VTVSS		LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				779	780	781	782
24	VG9B368	IgG1	Kappa	EVQLVESGGGL	EIVLTQSPGT	EVQLVESGGGLVKPGGSLRLSCAASGFTFNSYDMNWVR	EIVLTQSPGTLSLSPGERA
				VKPGGSLRLSC	LSLSPGERAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRCTISRDNAR	TLSCRASQSVSSSYLAWYQ
				AASGFTFNSYD	LSCRASQSVS	NSLYLQMNSLRAEDTAIYYCARDRGIGGDYYSYAMDVW	QKPGQAPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	GQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQAPRLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	PPYTFGQGTKLEIKRTVAA
				RCTISRDNARN	DRFSGSGSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	VVCLLNNFYPREAKVQWKV
				EDTAIYYCARD	PEDFAVYYCQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	DNALQSGNSQESVTEQDSK
				RGIGGDYYSYA	QYGSSPPYTF	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSTYSLSSTLTLSKADYEK
				MDVWGQGTMVT	GQGTKLEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	HKVYACEVTHQGLSSPVTK
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				813	814	815	816
25	VG9B424	IgG1	Kappa	EVQLVESGGGL	ETTLTQSPGT	EVQLVESGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	ETTLTQSPGTLSLSPGDRA
				VKPGGSLRLSC	LSLSPGDRAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVASSYLAWYQ
				SASGFTFSNYD	LSCRASQSVA	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	QKPGQSPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	GQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQSPRLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	PPYTFGQGTKLEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	VVCLLNNFYPREAKVQWKV
				EDTAVYHCARD	PEDFAVYYCQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	DNALQSGNSQESVTEQDSK
				VGVTTDYYYYG	QYGSSPPYTF	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSTYSLSSTLTLSKADYEK
				MDVWGQGTMVT	GQGTKLEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	HKVYACEVTHQGLSSPVTK
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				847	848	849	850
26	VG9B427	IgG1	Kappa	QVQLVESGGGL	EIVMTQSPGT	QVQLVESGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	EIVMTQSPGTLSLSPGDRA
				VKPGGSLRLSC	LSLSPGDRAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVASSYLAWYQ
				SASGFTFSNYD	LSCRASQSVA	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	QKPGQSPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	GQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQSPRLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	PPYTFGQGTRLEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	VVCLLNNFYPREAKVQWKV
				EDTAVYHCARD	PEDFAVYYCQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	DNALQSGNSQESVTEQDSK
				VGVTTDYYYYG	QYGSSPPYTF	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSTYSLSSTLTLSKADYEK
				MDVWGQGTTVT	GQGTRLEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	HKVYACEVTHQGLSSPVTK
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				881	882	883	884
27	VG9B417	IgG1	Kappa	EVQLVESGGGL	DIVMTQSPSS	EVQLVESGGGLVKPGGSLRLSCAASGFTFSNYGMNWVR	DIVMTQSPSSVSASVGDRV
				VKPGGSLRLSC	VSASVGDRVT	QAPGKGLEWVSYISSGSSYKYYADSMKGRFTISRDNAM	TITCRASQGINSWLAWYQQ
				AASGFTFSNYG	ITCRASQGIN	NLLYLQMNSLRPEDSAMYYCARDPVVTEYYYYGMDVWG	KPGNAPKLLIYAASSLQSG
				MNWVRQAPGKG	SWLAWYQQKP	QGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	VPSRFSGIGSGTDFIFTIS
				LEWVSYISSGS	GNAPKLLIYA	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	SLQPEDFASYYCQQANSFP
				SYKYYADSMKG	ASSLQSGVPS	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	WTFGQGTKVEIKRTVAAPS
				RFTISRDNAMN	RFSGIGSGTD	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	VFIFPPSDEQLKSGTASVV
				LLYLQMNSLRP	FIFTISSLQP	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	CLLNNFYPREAKVQWKVDN
				EDSAMYYCARD	EDFASYYCQQ	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	ALQSGNSQESVTEQDSKDS
				PVVTEYYYYGM	ANSFPWTFGQ	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	TYSLSSTLTLSKADYEKHK
				DVWGQGTTVTV	GTKVEIK	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	VYACEVTHQGLSSPVTKSF
				SS		DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				915	916	917	918
28	VG9B58	IgG1	Kappa	QVQLQESGPGL	DIQMTQSPSA	QVQLQESGPGLVKPSETLSLTCTVSGGSIKSSYWTWIR	DIQMTQSPSAMSASVGDRV
				VKPSETLSLTC	MSASVGDRVT	QPPGKGLEWIGYMFYLGSTNYNPSLKSRVTMSIDTSRN	TITCRASQDITNYLAWFQQ
				TVSGGSIKSSY	ITCRASQDIT	QFSLKLSSVTAADTAVYYCSRERPVLDAFDIWGQGTMV	KPGKVPKRLIYAASSLQGG
				WTWIRQPPGKG	NYLAWFQQKP	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	VPSRFSGSGSGTEFTLTIS
				LEWIGYMFYLG	GKVPKRLIYA	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	SLQPEDFSTYYCLQHDTYP
				STNYNPSLKSR	ASSLQGGVPS	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	YTFGQGTKVDIKRTVAAPS
				VTMSIDTSRNQ	RFSGSGSGTE	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	VFIFPPSDEQLKSGTASVV
				FSLKLSSVTAA	FTLTISSLQP	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	CLLNNFYPREAKVQWKVDN
				DTAVYYCSRER	EDFSTYYCLQ	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ALQSGNSQESVTEQDSKDS
				PVLDAFDIWGQ	HDTYPYTFGQ	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	TYSLSSTLTLSKADYEKHK
				GTMVTVSS	GTKVDIK	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	VYACEVTHQGLSSPVTKSF
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				949	950	951	952
29	VG9B419	IgG1	Kappa	EVQLVESGGGL	EIVLTQSPGT	EVQLVESGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	EIVLTQSPGTLSLSPGDRA
				VKPGGSLRLSC	LSLSPGDRAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVASSYLAWYQ
				SASGFTFSNYD	LSCRASQSVA	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	QKPGQSPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	GQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQSPRLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	PPYTFGQGTKVEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	VVCLLNNFYPREAKVQWKV
				EDTAVYHCARD	PEDFAVYYCQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	DNALQSGNSQESVTEQDSK
				VGVTTDYYYYG	QYGSSPPYTF	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSTYSLSSTLTLSKADYEK
				MDVWGQGTTVT	GQGTKVEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	HKVYACEVTHQGLSSPVTK
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				983	984	985	986
30	VG9B425	IgG1	Kappa	EVQLLESGGGL	ETTLTQSPGT	EVQLLESGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	ETTLTQSPGTLSLSPGDRA
				VKPGGSLRLSC	LSLSPGDRAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVASSYLAWYQ
				SASGFTFSNYD	LSCRASQSVA	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	QKPGQSPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	GQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQSPRLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	PPYTFGQGTKVEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	VVCLLNNFYPREAKVQWKV
				EDTAVYHCARD	PEDFAVYYCQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	DNALQSGNSQESVTEQDSK
				VGVTTDYYYYG	QYGSSPPYTF	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSTYSLSSTLTLSKADYEK
				MDVWGQGTMVT	GQGTKVEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	HKVYACEVTHQGLSSPVTK
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				1017	1018	1019	1020
31	VG9B143	IgG1	Lambda	EVQLVESGGGL	QSALTQPASV	EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYGMNWVR	QSALTQPASVSGSPGQSIT
				VQPGGSLRLSC	SGSPGQSITI	QAPGKGLEWISYISTSSYTIYYSDSVKGRFTVSRDNAK	ISCTGTSSDVGGYNYVSWY
				AASGFTFSTYG	SCTGTSSDVG	NSLYLQMNSLRDEDTAVYYCAREGDWWYFDLWGRGTTV	QQHPGKAPKLMIYEVSNRP
				MNWVRQAPGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSYRFSGSKSGNTASLT
				LEWISYISTSS	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				YTIYYSDSVKG	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	SSTLVFGGGTKLTVLGQPK
				RFTVSRDNAKN	SYRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	AAPSVTLFPPSSEELQANK
				SLYLQMNSLRD	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	ATLVCLISDFYPGAVTVAW
				EDTAVYYCARE	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	KADSSPVKAGVETTTPSKQ
				GDWWYFDLWGR	SSYTSSSTLV	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	SNNKYAASSYLSLTPEQWK
				GTTVTVSS	FGGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	SHRSYSCQVTHEGSTVEKT
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VAPTECS
				1051	1052	1053	1054
32	VG9B418	IgG1	Kappa	EVQLVQSGGGL	EIVLTQSPGT	EVQLVQSGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	EIVLTQSPGTLSLSPGDRA
				VKPGGSLRLSC	LSLSPGDRAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVASSYLAWYQ
				SASGFTFSNYD	LSCRASQSVA	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	QKPGQSPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	GQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQSPRLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	PPYTFGQGTKLEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	VVCLLNNFYPREAKVQWKV
				EDTAVYHCARD	PEDFAVYYCQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	DNALQSGNSQESVTEQDSK
				VGVTTDYYYYG	QYGSSPPYTF	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSTYSLSSTLTLSKADYEK
				MDVWGQGTMVT	GQGTKLEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	HKVYACEVTHQGLSSPVTK
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				1085	1086	1087	1088
33	VG9B472	IgG1	Kappa	QVQLVESGGGL	EIVLTQSPSS	QVQLVESGGGLVKPGGSLRLSCAASGFTFSHYDMNWVR	EIVLTQSPSSLSASVGDRV
				VKPGGSLRLSC	LSASVGDRVT	QAPGKGLEWVSSISSSSSYIFYADSVKGRFTISRDNAK	TITCRASQGIATYLAWYQQ
				AASGFTFSHYD	ITCRASQGIA	NSLLLQMNSLRAEDTAVYHCARDRGVGDTSDYYSFGLD	KPGKVPNLLIYAASTLQSG
				MNWVRQAPGKG	TYLAWYQQKP	VWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALG	VPSRFSGSGSGTDFTLTIS
				LEWVSSISSSS	GKVPNLLIYA	CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS	SLQPEDVATYYCQKYNSAP
				SYIFYADSVKG	ASTLQSGVPS	LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS	PWTFGQGTKVEIKRTVAAP
				RFTISRDNAKN	RFSGSGSGTD	CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP	SVFIFPPSDEQLKSGTASV
				SLLLQMNSLRA	FTLTISSLQP	EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ	VCLLNNFYPREAKVQWKVD
				EDTAVYHCARD	EDVATYYCQK	YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE	NALQSGNSQESVTEQDSKD
				RGVGDTSDYYS	YNSAPPWTFG	KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG	STYSLSSTLTLSKADYEKH
				FGLDVWGQGTT	QGTKVEIK	FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK	KVYACEVTHQGLSSPVTKS
				VTVSS		LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	FNRGEC
				1119	1120	1121	1122
34	VG9B421	IgG1	Kappa	EVQLVESGGGL	DIQMTQSPSS	EVQLVESGGGLVKPGGSLRLSCAASGFTFSNYGMNWVR	DIQMTQSPSSVSASVGDRV
				VKPGGSLRLSC	VSASVGDRVT	QAPGKGLEWVSYISSGSSYKYYADSMKGRFTISRDNAM	TITCRASQGINSWLAWYQQ
				AASGFTFSNYG	ITCRASQGIN	NLLYLQMNSLRPEDSAMYYCARDPVVTEYYYYGMDVWG	KPGNAPKLLIYAASSLQSG
				MNWVRQAPGKG	SWLAWYQQKP	QGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	VPSRFSGIGSGTDFIFTIS
				LEWVSYISSGS	GNAPKLLIYA	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	SLQPEDFASYYCQQANSFP
				SYKYYADSMKG	ASSLQSGVPS	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	WTFGQGTRLEIKRTVAAPS
				RFTISRDNAMN	RFSGIGSGTD	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	VFIFPPSDEQLKSGTASVV
				LLYLQMNSLRP	FIFTISSLQP	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	CLLNNFYPREAKVQWKVDN
				EDSAMYYCARD	EDFASYYCQQ	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	ALQSGNSQESVTEQDSKDS
				PVVTEYYYYGM	ANSFPWTFGQ	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	TYSLSSTLTLSKADYEKHK
				DVWGQGTMVTV	GTRLEIK	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	VYACEVTHQGLSSPVTKSF
				SS		DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				1153	1154	1155	1156
35	VG9B88	IgG1	Kappa	EVQLVESGGGL	EIVLTQSPLS	EVQLVESGGGLVKPGGSLRLSCAVSGFTFSSYTMNWVR	EIVLTQSPLSLPVTPGEPA
				VKPGGSLRLSC	LPVTPGEPAS	QAPGKGLEWVSSISTSSSYIDYADSVKGRFTISRDNAK	SISCRSSQSLLNSDDGNTY
				AVSGFTFSSYT	ISCRSSQSLL	KSLYLQMNSLRAEDTAVYYCARDGDMVAPIKGSFDYWG	LDWYLQKPGQSPQLLIYTL
				MNWVRQAPGKG	NSDDGNTYLD	QGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	SYRASGVPDRFSGSGSGTD
				LEWVSSISTSS	WYLQKPGQSP	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	FTLKISRVEAEDVGVYYCM
				SYIDYADSVKG	QLLIYTLSYR	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	QRIEFPITFGQGTRLEIKR
				RFTISRDNAKK	ASGVPDRFSG	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	TVAAPSVFIFPPSDEQLKS
				SLYLQMNSLRA	SGSGTDFTLK	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	GTASVVCLLNNFYPREAKV
				EDTAVYYCARD	ISRVEAEDVG	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	QWKVDNALQSGNSQESVTE
				GDMVAPIKGSF	VYYCMQRIEF	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	QDSKDSTYSLSSTLTLSKA
				DYWGQGTLVTV	PITFGQGTRL	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	DYEKHKVYACEVTHQGLSS
				SS	EIK	DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	PVTKSFNRGEC
				1187	1188	1189	1190
36	VG9B384	IgG1	Lambda	QVQLQESGPAL	SYELMQPPSV	QVQLQESGPALVKPTQTLTLTCTFSGFSLSSSGMCVSW	SYELMQPPSVSVSPGQTAS
				VKPTQTLTLTC	SVSPGQTASI	IRQPPGKALEWLTLIDWFDDKYYSTSLKTRLTISKDTS	ITCSGNELGDKYASWYQQQ
				TFSGFSLSSSG	TCSGNELGDK	KNQVVLTMTNMDPVDTATYYCARIRGTGAYYYGLDVWG	PGQSPVLVIYQDNKRPSGI
				MCVSWIRQPPG	YASWYQQQPG	QGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	PERFSGSNSGNTATLTISG
				KALEWLTLIDW	QSPVLVIYQD	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	TQAMDEADYYCQAWDSSKV
				FDDKYYSTSLK	NKRPSGIPER	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	VFGGGTKLTVLGQPKAAPS
				TRLTISKDTSK	FSGSNSGNTA	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	VTLFPPSSEELQANKATLV
				NQVVLTMTNMD	TLTISGTQAM	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	CLISDFYPGAVTVAWKADS
				PVDTATYYCAR	DEADYYCQAW	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	SPVKAGVETTTPSKQSNNK
				IRGTGAYYYGL	DSSKVVFGGG	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	YAASSYLSLTPEQWKSHRS
				DVWGQGTMVTV	TKLTVL	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	YSCQVTHEGSTVEKTVAPT
				SS		DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	ECS
				1221	1222	1223	1224
37	VG9B413	IgG1	Kappa	EVQLVESGGGL	EIVMTQSPGT	EVQLVESGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	EIVMTQSPGTLSLSPGDRA
				VKPGGSLRLSC	LSLSPGDRAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVASSYLAWYQ
				SASGFTFSNYD	LSCRASQSVA	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	QKPGQSPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	GQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQSPRLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	PPYTFGQGTKVEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	VVCLLNNFYPREAKVQWKV
				EDTAVYHCARD	PEDFAVYYCQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	DNALQSGNSQESVTEQDSK
				VGVTTDYYYYG	QYGSSPPYTF	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSTYSLSSTLTLSKADYEK
				MDVWGQGTMVT	GQGTKVEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	HKVYACEVTHQGLSSPVTK
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				1255	1256	1257	1258
38	VG9B36	IgG1	Kappa	QVQLVESGGGL	EIVLTQSPSS	QVQLVESGGGLVKPGGSLRLSCASSGFTFSSYGMYWVR	EIVLTQSPSSLSASVGDRV
				VKPGGSLRLSC	LSASVGDRVT	QAPGKGLEWVSSISTGSSYIYYADSVKGRFTISRDNAK	TITCQASQDISNYLNWYQQ
				ASSGFTFSSYG	ITCQASQDIS	NSLYLQMNSLRAEDTAVYYCARDKGLAVTGYIMDVWGQ	KPGKAPKLLIYDASNLETG
				MYWVRQAPGKG	NYLNWYQQKP	GTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK	VPSRFSGSGSGTDFTFTIS
				LEWVSSISTGS	GKAPKLLIYD	DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV	SLQPEDIAIYYCQQYDNLP
				SYIYYADSVKG	ASNLETGVPS	VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT	MYTFGQGTKVEIKRTVAAP
				RFTISRDNAKN	RFSGSGSGTD	HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC	SVFIFPPSDEQLKSGTASV
				SLYLQMNSLRA	FTFTISSLQP	VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST	VCLLNNFYPREAKVQWKVD
				EDTAVYYCARD	EDIAIYYCQQ	YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS	NALQSGNSQESVTEQDSKD
				KGLAVTGYIMD	YDNLPMYTFG	KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS	STYSLSSTLTLSKADYEKH
				VWGQGTTVTVS	QGTKVEIK	DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD	KVYACEVTHQGLSSPVTKS
				S		KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	FNRGEC
				1289	1290	1291	1292
39	VG9B403	IgG1	Kappa	EVQLVESGGGL	DIVMTQSPGT	EVQLVESGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	DIVMTQSPGTLSLSPGDRA
				VKPGGSLRLSC	LSLSPGDRAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVASSYLAWYQ
				SASGFTFSNYD	LSCRASQSVA	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	QKPGQSPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	GQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQSPRLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	PPYTFGQGTKVEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	VVCLLNNFYPREAKVQWKV
				EDTAVYHCARD	PEDFAVYYCQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	DNALQSGNSQESVTEQDSK
				VGVTTDYYYYG	QYGSSPPYTF	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSTYSLSSTLTLSKADYEK
				MDVWGQGTTVT	GQGTKVEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	HKVYACEVTHQGLSSPVTK
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				1323	1324	1325	1326
40	VG9B191	IgG1	Lambda	EVQLVQSGGGL	QSVLTQPPSV	EVQLVQSGGGLVKPGGSLRLSCAASGFTFSRYSMNWVR	QSVLTQPPSVSAAPGQKVT
				VKPGGSLRLSC	SAAPGQKVTI	QAPGKGLEGVSSISSSSSYIYYADSVKGRFTISRDNAK	ISCSGSSSNIGNNYVSWYQ
				AASGFTFSRYS	SCSGSSSNIG	NSLYLQMNSLRAEDTAVYYCARDGPTVNWDYYFDLWGR	QLPGTAPKLLIYDNNKRPS
				MNWVRQAPGKG	NNYVSWYQQL	GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK	GIPDRFSGSKSGTSATLGI
				LEGVSSISSSS	PGTAPKLLIY	DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV	TGLQTGDEADYYCGTWDSS
				SYIYYADSVKG	DNNKRPSGIP	VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT	LSTSVVFGGGTKLTVLGQP
				RFTISRDNAKN	DRFSGSKSGT	HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC	KAAPSVTLFPPSSEELQAN
				SLYLQMNSLRA	SATLGITGLQ	VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST	KATLVCLISDFYPGAVTVA
				EDTAVYYCARD	TGDEADYYCG	YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS	WKADSSPVKAGVETTTPSK
				GPTVNWDYYFD	TWDSSLSTSV	KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS	QSNNKYAASSYLSLTPEQW
				LWGRGTLVTVS	VFGGGTKLTV	DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD	KSHRSYSCQVTHEGSTVEK
				S	L	KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	TVAPTECS
				1357	1358	1359	1360
41	VG9B44	IgG1	Kappa	QVQLQQSGPGL	DIQMTQSPSF	QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNW	DIQMTQSPSFLSASVGDRV
				VKPSQTLSLTC	LSASVGDRVT	IRQSPSRGLEWLGRTYYRSKWYNDYPISVKSRISINPD	TITCRASQGISSYLAWYQQ
				AISGDSVSSNS	ITCRASQGIS	TSKNQFSLQLNSVTPEDTAVYYCARESGSYYTDGFDIW	KPGKAPKLLIYAASTLQSG
				AAWNWIRQSPS	SYLAWYQQKP	GQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	VPSRFSGSGSGTEFTLTIS
				RGLEWLGRTYY	GKAPKLLIYA	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SLQPEDFATYYCQEFNSYP
				RSKWYNDYPIS	ASTLQSGVPS	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	YTFGQGTKLEIKRTVAAPS
				VKSRISINPDT	RFSGSGSGTE	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	VFIFPPSDEQLKSGTASVV
				SKNQFSLQLNS	FTLTISSLQP	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	CLLNNFYPREAKVQWKVDN
				VTPEDTAVYYC	EDFATYYCQE	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	ALQSGNSQESVTEQDSKDS
				ARESGSYYTDG	FNSYPYTFGQ	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	TYSLSSTLTLSKADYEKHK
				FDIWGQGTMVT	GTKLEIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	VYACEVTHQGLSSPVTKSF
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				1391	1392	1393	1394
42	VG9B67	IgG1	Kappa	EVQLVESGGGL	DIVMTQTPLS	EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYTMNWVR	DIVMTQTPLSLPVTPGEPA
				VKPGGSLRLSC	LPVTPGEPAS	QAPGKGLEWVSSISSSSSYIDYAESVKGRFTISRDNAK	SISCRSSQSLLDSDAGNTY
				AASGFTFSSYT	ISCRSSQSLL	NSLYLQMNSLRAEDTAVYYCARDGDILATIRGSFDYWG	LDWYLQKPGQSPQLLIYTL
				MNWVRQAPGKG	DSDAGNTYLD	QGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	SYRASGVPDRFSGSGSGTD
				LEWVSSISSSS	WYLQKPGQSP	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	FTLKISRVEAEDVAIYYCM
				SYIDYAESVKG	QLLIYTLSYR	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	QRIEFPITFGQGTKVEIKR
				RFTISRDNAKN	ASGVPDRFSG	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	TVAAPSVFIFPPSDEQLKS
				SLYLQMNSLRA	SGSGTDFTLK	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	GTASVVCLLNNFYPREAKV
				EDTAVYYCARD	ISRVEAEDVA	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	QWKVDNALQSGNSQESVTE
				GDILATIRGSF	IYYCMQRIEF	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	QDSKDSTYSLSSTLTLSKA
				DYWGQGTTVTV	PITFGQGTKV	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	DYEKHKVYACEVTHQGLSS
				SS	EIK	DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	PVTKSFNRGEC
				1425	1426	1427	1428
43	VG9B402	IgG1	Kappa	EVQLVQSGGGL	DIQMTQSPSS	EVQLVQSGGGLVKPGGSLRLSCAASGFTFSNYGMNWVR	DIQMTQSPSSVSASVGDRV
				VKPGGSLRLSC	VSASVGDRVT	QAPGKGLEWVSYISSGSSYKYYADSMKGRFTISRDNAM	TITCRASQGINSWLAWYQQ
				AASGFTFSNYG	ITCRASQGIN	NLLYLQMNSLRPEDSAMYYCARDPVVTEYYYYGMDVWG	KPGNAPKLLIYAASSLQSG
				MNWVRQAPGKG	SWLAWYQQKP	QGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	VPSRFSGIGSGTDFIFTIS
				LEWVSYISSGS	GNAPKLLIYA	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	SLQPEDFASYYCQQANSFP
				SYKYYADSMKG	ASSLQSGVPS	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	WTFGQGTKVDIKRTVAAPS
				RFTISRDNAMN	RFSGIGSGTD	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	VFIFPPSDEQLKSGTASVV
				LLYLQMNSLRP	FIFTISSLQP	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	CLLNNFYPREAKVQWKVDN
				EDSAMYYCARD	EDFASYYCQQ	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	ALQSGNSQESVTEQDSKDS
				PVVTEYYYYGM	ANSFPWTFGQ	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	TYSLSSTLTLSKADYEKHK
				DVWGQGTMVTV	GTKVDIK	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	VYACEVTHQGLSSPVTKSF
				SS		DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				1459	1460	1461	1462
44	VG9B127	IgG1	Kappa	QVQLVESGGGL	EIVMTQSPLS	QVQLVESGGGLVKPGGSLRLSCTASGFTFGAYTMNWVR	EIVMTQSPLSLPVTPGEPA
				VKPGGSLRLSC	LPVTPGEPAS	QAPGKGLEWVSSISSSSSYIDFAESVKGRFTISRDNAK	SISCRSSQSLLDSDDGNTY
				TASGFTFGAYT	ISCRSSQSLL	NSLYLQMISLRAEDTAVYYCARDGDIVSTIRGSFDYWG	LDWYLQKPGQSPQLLIYTL
				MNWVRQAPGKG	DSDDGNTYLD	QGALVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	SYRASGVPDRFSGSGSGTD
				LEWVSSISSSS	WYLQKPGQSP	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	FTLKISRVEAEDVGIYYCM
				SYIDFAESVKG	QLLIYTLSYR	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	QRIEFPITFGQGTKVEIKR
				RFTISRDNAKN	ASGVPDRFSG	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	TVAAPSVFIFPPSDEQLKS
				SLYLQMISLRA	SGSGTDFTLK	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	GTASVVCLLNNFYPREAKV
				EDTAVYYCARD	ISRVEAEDVG	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	QWKVDNALQSGNSQESVTE
				GDIVSTIRGSF	IYYCMQRIEF	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	QDSKDSTYSLSSTLTLSKA
				DYWGQGALVTV	PITFGQGTKV	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	DYEKHKVYACEVTHQGLSS
				SS	EIK	DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	PVTKSFNRGEC
				1493	1494	1495	1496
45	VG9B137	IgG1	Kappa	EVQLVESGGGL	EIVMTQSPGT	EVQLVESGGGLVKPGGSLRLSCAAFGITFSSYSMDWVR	EIVMTQSPGTLSLSPGERA
				VKPGGSLRLSC	LSLSPGERAT	QAPGRGLEWVSSIGSSSSYIFYADSVKGRFTISRDNAK	TLSCRASQSVSSSYLAWYQ
				AAFGITFSSYS	LSCRASQSVS	NSLYLQMNSLRAEDTAVYYCATSYSWNYGGAFDIWGQG	QKPGQAPRLLIYGASSRAT
				MDWVRQAPGRG	SSYLAWYQQK	TMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD	GIPDRFSGSGSGTDFTLTI
				LEWVSSIGSSS	PGQAPRLLIY	YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV	SRLEPEDFAVYFCQQYGSS
				SYIFYADSVKG	GASSRATGIP	TVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH	PPYTFGQGTKVEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY	VVCLLNNFYPREAKVQWKV
				EDTAVYYCATS	PEDFAVYFCQ	RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK	DNALQSGNSQESVTEQDSK
				YSWNYGGAFDI	QYGSSPPYTF	AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD	DSTYSLSSTLTLSKADYEK
				WGQGTMVTVSS	GQGTKVEIK	IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK	HKVYACEVTHQGLSSPVTK
						SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				1527	1528	1529	1530
46	VG9B33	IgG1	Kappa	EVQLVESGGGL	DIVMTQSPSS	EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYNMNWVR	DIVMTQSPSSLSASVGDRV
				VKPGGSLRLSC	LSASVGDRVT	QAPGKGLEWVSSISTSSSYIYYADSVKGRFTISRDNAK	TITCRASQDINNYLAWFQQ
				AASGFTFSSYN	ITCRASQDIN	NSLYLQMNGLRAEDTAVYYCARDTSVTKYPDTFDIWGQ	KPGKVPNLLIYGASTLQSG
				MNWVRQAPGKG	NYLAWFQQKP	GTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK	VPSRFTGSGSGTDFTLTIS
				LEWVSSISTSS	GKVPNLLIYG	DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV	SLQPEDVATYYCQKYNSAP
				SYIYYADSVKG	ASTLQSGVPS	VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT	FTFGPGTKVDIKRTVAAPS
				RFTISRDNAKN	RFTGSGSGTD	HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC	VFIFPPSDEQLKSGTASVV
				SLYLQMNGLRA	FTLTISSLQP	VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST	CLLNNFYPREAKVQWKVDN
				EDTAVYYCARD	EDVATYYCQK	YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS	ALQSGNSQESVTEQDSKDS
				TSVTKYPDTFD	YNSAPFTFGP	KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS	TYSLSSTLTLSKADYEKHK
				IWGQGTMVTVS	GTKVDIK	DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD	VYACEVTHQGLSSPVTKSF
				S		KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				1561	1562	1563	1564
47	VG9B162	IgG1	Lambda	QVQLVESGAEV	QLVLTQSSSA	QVQLVESGAEVTKPGASVKVSCKASGYTFTGDYMHWVR	QLVLTQSSSASGSPGQSVT
				TKPGASVKVSC	SGSPGQSVTI	QAPGQGLEWMGWINPNSGYTNYAQKFQGRVTMTRDTSI	ISCTGTSSDVGGYNYVSWY
				KASGYTFTGDY	SCTGTSSDVG	STAYMELSRLRSDDTAVYYCAREGDAFDVWGQGTMVTV	QQHPGKAPKLMIYEVSKRP
				MHWVRQAPGQG	GYNYVSWYQQ	SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP	SGVPDRFSGSKSGNTASLT
				LEWMGWINPNS	HPGKAPKLMI	VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS	VSGLQAEDEADYYCNSYAG
				GYTNYAQKFQG	YEVSKRPSGV	SLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPC	SNNFEVFGGGTKLTVLGQP
				RVTMTRDTSIS	PDRFSGSKSG	PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS	KAAPSVTLFPPSSEELQAN
				TAYMELSRLRS	NTASLTVSGL	HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV	KATLVCLISDFYPGAVTVA
				DDTAVYYCARE	QAEDEADYYC	LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP	WKADSSPVKAGVETTTPSK
				GDAFDVWGQGT	NSYAGSNNFE	REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW	QSNNKYAASSYLSLTPEQW
				MVTVSS	VFGGGTKLTV	ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ	KSHRSYSCQVTHEGSTVEK
					L	GNVFSCSVMHEALHNHYTQKSLSLSPGK	TVAPTECS
				1595	1596	1597	1598
48	VG9B152	IgG1	Lambda	EVQLVESGGGL	SYELMQPPSV	EVQLVESGGGLVRPGGSLRLSCEASGFTFSSYSMIWVR	SYELMQPPSVSVSPGQTAS
				VRPGGSLRLSC	SVSPGQTASI	QAPGKGLEWVSSISSSSDYIYNADSVKGRFTISRDNAK	ITCSGDKLGDKYACWYQQK
				EASGFTFSSYS	TCSGDKLGDK	NSLYLQMNSLRAEDTAVYYCARDWELLGFDCWGQGTTV	PGQSPVLVIYQHNKRPSGI
				MIWVRQAPGKG	YACWYQQKPG	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	PERFSGSNSGKTATLTISG
				LEWVSSISSSS	QSPVLVIYQH	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	TQAMDEADYYCQAWDSTTV
				DYIYNADSVKG	NKRPSGIPER	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	VFGGGTKLTVLGQPKAAPS
				RFTISRDNAKN	FSGSNSGKTA	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	VTLFPPSSEELQANKATLV
				SLYLQMNSLRA	TLTISGTQAM	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	CLISDFYPGAVTVAWKADS
				EDTAVYYCARD	DEADYYCQAW	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	SPVKAGVETTTPSKQSNNK
				WELLGFDCWGQ	DSTTVVFGGG	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	YAASSYLSLTPEQWKSHRS
				GTTVTVSS	TKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	YSCQVTHEGSTVEKTVAPT
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	ECS
				1629	1630	1631	1632
49	VG9B64	IgG1	Kappa	QVQLVESGPTL	DIVMTQTPLS	QVQLVESGPTLVKPTQTLTLTCTFSGFSLSISGVSVGW	DIVMTQTPLSSPVTLGQPA
				VKPTQTLTLTC	SPVTLGQPAS	IRQPPGKALEWLALIYWNDDKRYSPSLQSRVTITKDTS	SISCRSSESLVHSDGNTYL
				TFSGFSLSISG	ISCRSSESLV	KNQVVLTVTNMDSVDTATYYCVHSGQWLEGDAFDIWGQ	SWLQQSPGQPPRLLIYKIS
				VSVGWIRQPPG	HSDGNTYLSW	GTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK	NRFSGVPDRFSGSGAGTDF
				KALEWLALIYW	LQQSPGQPPR	DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV	TLKISRVEAEDVGVYYCMQ
				NDDKRYSPSLQ	LLIYKISNRF	VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT	ATQFPLTFGGGTKLEIKRT
				SRVTITKDTSK	SGVPDRFSGS	HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC	VAAPSVFIFPPSDEQLKSG
				NQVVLTVTNMD	GAGTDFTLKI	VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST	TASVVCLLNNFYPREAKVQ
				SVDTATYYCVH	SRVEAEDVGV	YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS	WKVDNALQSGNSQESVTEQ
				SGQWLEGDAFD	YYCMQATQFP	KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS	DSKDSTYSLSSTLTLSKAD
				IWGQGTMVTVS	LTFGGGTKLE	DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD	YEKHKVYACEVTHQGLSSP
				S	IK	KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VTKSFNRGEC
				1663	1664	1665	1666
50	VG9B21	IgG1	Kappa	EVQLLESGGGL	DIVMTQSPSS	EVQLLESGGGLVKPGGSLRLSCAASGFSFSNYDMNWVR	DIVMTQSPSSLSASVGDRV
				VKPGGSLRLSC	LSASVGDRVT	QAPRKGLEWVSSISSSSHYIYYADSLKGRFTISRDNAK	TITCRASQGIYNYLAWYQQ
				AASGFSFSNYD	ITCRASQGIY	NSLFLQMNSLRAEDTAVYYCARDRGVTTDYYYYALDVW	KPGNVPKLLIYAASTLQSG
				MNWVRQAPRKG	NYLAWYQQKP	GQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	VPSRFSGSGSGTDFSLTIS
				LEWVSSISSSS	GNVPKLLIYA	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SLQPEDFTTYYCQKYNRAP
				HYIYYADSLKG	ASTLQSGVPS	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	FTFGPGTKVDIKRTVAAPS
				RFTISRDNAKN	RFSGSGSGTD	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	VFIFPPSDEQLKSGTASVV
				SLFLQMNSLRA	FSLTISSLQP	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	CLLNNFYPREAKVQWKVDN
				EDTAVYYCARD	EDFTTYYCQK	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	ALQSGNSQESVTEQDSKDS
				RGVTTDYYYYA	YNRAPFTFGP	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	TYSLSSTLTLSKADYEKHK
				LDVWGQGTMVT	GTKVDIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	VYACEVTHQGLSSPVTKSF
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				1697	1698	1699	1700
51	VG9B128	IgG1	Kappa	EVQLVESGGGV	DIVMTQTPAT	EVQLVESGGGVVQPGKSLRLSCTASGFTFGTYGMHWVR	DIVMTQTPATLSLSPGERA
				VQPGKSLRLSC	LSLSPGERAT	QAPGKGLDWVAVIWYNGSNKYYADSVKGRFTISRDNSK	TLSCRASQSVIDYLAWFQQ
				TASGFTFGTYG	LSCRASQSVI	NTLYLQMNSLRTEDTAVYYCARGGFGESFDSWGQGTLV	KPGQAPRLLIYDASNRATG
				MHWVRQAPGKG	DYLAWFQQKP	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	IPARFSGSGSGTDFTLTIS
				LDWVAVIWYNG	GQAPRLLIYD	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	SLEPEDFAVYYCQQRSNWP
				SNKYYADSVKG	ASNRATGIPA	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	LTFGGGTKVEIKRTVAAPS
				RFTISRDNSKN	RFSGSGSGTD	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	VFIFPPSDEQLKSGTASVV
				TLYLQMNSLRT	FTLTISSLEP	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	CLLNNFYPREAKVQWKVDN
				EDTAVYYCARG	EDFAVYYCQQ	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ALQSGNSQESVTEQDSKDS
				GFGESFDSWGQ	RSNWPLTFGG	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	TYSLSSTLTLSKADYEKHK
				GTLVTVSS	GTKVEIK	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	VYACEVTHQGLSSPVTKSF
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				1731	1732	1733	1734
52	VG9B66	IgG1	Kappa	EVQLVESGGGL	EIVLTQSPSS	EVQLVESGGGLVKPGGSLRLSCAASGFTFSTYTMNWVR	EIVLTQSPSSLSTSVGDRV
				VKPGGSLRLSC	LSTSVGDRVT	QAPGKGLEWVSSISSSSFYMDYADSVKGRFTISRDNAK	TITCRASQDITNFLAWYQQ
				AASGFTFSTYT	ITCRASQDIT	NSLSLLMNSLRAEDTAVYYCARDGDIVATIRGSFDYWG	KPGKLPKLLIYTASTLQSG
				MNWVRQAPGKG	NFLAWYQQKP	QGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	VPSRFSGSASGPDFTLTIS
				LEWVSSISSSS	GKLPKLLIYT	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	SLQPEDVATYYCQKYNSAP
				FYMDYADSVKG	ASTLQSGVPS	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	FTFGPGTKVEIKRTVAAPS
				RFTISRDNAKN	RFSGSASGPD	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	VFIFPPSDEQLKSGTASVV
				SLSLLMNSLRA	FTLTISSLQP	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	CLLNNFYPREAKVQWKVDN
				EDTAVYYCARD	EDVATYYCQK	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	ALQSGNSQESVTEQDSKDS
				GDIVATIRGSF	YNSAPFTFGP	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	TYSLSSTLTLSKADYEKHK
				DYWGQGTMVTV	GTKVEIK	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	VYACEVTHQGLSSPVTKSF
				SS		DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				1765	1766	1767	1768
53	VG9B32	IgG1	Kappa	EVQLVQSGGDL	DIVMTQTPLS	EVQLVQSGGDLLQPGGSLRLSCAASGFTFSRYAMNWVR	DIVMTQTPLSSPVTLGQPA
				LQPGGSLRLSC	SPVTLGQPAS	QAPGKGLEWVSFISGTGYTVYYADSVKGRFTISRDNAK	SISCRSGQSLVHSDGNTYL
				AASGFTFSRYA	ISCRSGQSLV	NSLYLQMNSLRDEDTAVYYCARDQEPGFDYWGQGTLVT	SWLQQRPGQPPRLLIYKIS
				MNWVRQAPGKG	HSDGNTYLSW	VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE	NRFSGVPDRFSGSGAGTDF
				LEWVSFISGTG	LQQRPGQPPR	PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS	TLKISRVEAEDVGVYYCMQ
				YTVYYADSVKG	LLIYKISNRF	SSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP	ATHFPFTFGQGTKLEIKRT
				RFTISRDNAKN	SGVPDRFSGS	CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV	VAAPSVFIFPPSDEQLKSG
				SLYLQMNSLRD	GAGTDFTLKI	SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS	TASVVCLLNNFYPREAKVQ
				EDTAVYYCARD	SRVEAEDVGV	VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ	WKVDNALQSGNSQESVTEQ
				QEPGFDYWGQG	YYCMQATHFP	PREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE	DSKDSTYSLSSTLTLSKAD
				TLVTVSS	FTFGQGTKLE	WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ	YEKHKVYACEVTHQGLSSP
					IK	QGNVFSCSVMHEALHNHYTQKSLSLSPGK	VTKSFNRGEC
				1799	1800	1801	1802
54	VG9B57	IgG1	Kappa	EVQLVESGGGL	DIQMTQSPSA	EVQLVESGGGLVKPGGSLRLSCAASGFTFSSHDMNWVR	DIQMTQSPSAMSASVGDRV
				VKPGGSLRLSC	MSASVGDRVT	QAPGKGLGWVSSISSSSSYIFYADSVKGRFTISRDNAK	TITCRASQDITNYLAWFQQ
				AASGFTFSSHD	ITCRASQDIT	NSLYLQMSSLRAEDTAVYYCARDLGVGVRDYYYYGMDV	KPGKVPKRLIYAASSLQGG
				MNWVRQAPGKG	NYLAWFQQKP	WGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC	VPSRFSGSGSGTEFTLTIS
				LGWVSSISSSS	GKVPKRLIYA	LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL	SLQPEDFSTYYCLQHDTYP
				SYIFYADSVKG	ASSLQGGVPS	SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC	YTFGQGTKLEIKRTVAAPS
				RFTISRDNAKN	RFSGSGSGTE	DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE	VFIFPPSDEQLKSGTASVV
				SLYLQMSSLRA	FTLTISSLQP	VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY	CLLNNFYPREAKVQWKVDN
				EDTAVYYCARD	EDFSTYYCLQ	NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK	ALQSGNSQESVTEQDSKDS
				LGVGVRDYYYY	HDTYPYTFGQ	TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF	TYSLSSTLTLSKADYEKHK
				GMDVWGQGTMV	GTKLEIK	YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL	VYACEVTHQGLSSPVTKSF
				TVSS		TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				1833	1834	1835	1836
55	VG9B135	IgG1	Kappa	QVTLKESGPTL	DIVMTQSPGT	QVTLKESGPTLVTPSQTLTLTCTFSGFSLTTYGVGVGW	DIVMTQSPGTLSLSPGERA
				VTPSQTLTLTC	LSLSPGERAT	IRQPPGKALEWLALIYWNDDKRYYPSLNNRLTITKDTS	TLSCRASQSVSSSYLAWYQ
				TFSGFSLTTYG	LSCRASQSVS	KHLVVLTLTNMDPVDTATYYCAHDYDFWSGYFDYWGQG	QKPGQAPRLLIYGASSRAT
				VGVGWIRQPPG	SSYLAWYQQK	TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD	GIPDRFSGSGSGTDFTLTI
				KALEWLALIYW	PGQAPRLLIY	YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSW	SRLEPEDFAVYYCQQYGSS
				NDDKRYYPSLN	GASSRATGIP	TVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH	PLTFGGGTKVEIKRTVAAP
				NRLTITKDTSK	DRFSGSGSGT	TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV	SVFIFPPSDEQLKSGTASV
				HLVVLTLTNMD	DFTLTISRLE	VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY	VCLLNNFYPREAKVQWKVD
				PVDTATYYCAH	PEDFAVYYCQ	RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK	NALQSGNSQESVTEQDSKD
				DYDFWSGYFDY	QYGSSPLTFG	AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD	STYSLSSTLTLSKADYEKH
				WGQGTLVTVSS	GGTKVEIK	IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK	KVYACEVTHQGLSSPVTKS
						SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	FNRGEC
				1867	1868	1869	1870
56	VG9B60	IgG1	Kappa	QVQLVQSGAEV	DIVMTQSPGT	QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVR	DIVMTQSPGTLSLSPGERA
				KKPGASVKVSC	LSLSPGERAT	QAPGQGLEWMGRINPNSGVTHYAQKFQGRVTMTRDTSI	TLSCRASQSFSGSYLAWYQ
				KASGYTFTGYY	LSCRASQSFS	STAYMELSRLRSDDTAVYYCARGGSLVRGVISGLDYWG	QKPGQAPSLLIYGASSRAT
				MHWVRQAPGQG	GSYLAWYQQK	QGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	GIPDRFSGSGSGTDFTLTI
				LEWMGRINPNS	PGQAPSLLIY	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	SRLEPEDFALYYCQQYGSS
				GVTHYAQKFQG	GASSRATGIP	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	PPYTFGQGTKVEIKRTVAA
				RVTMTRDTSIS	DRFSGSGSGT	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	PSVFIFPPSDEQLKSGTAS
				TAYMELSRLRS	DFTLTISRLE	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	VVCLLNNFYPREAKVQWKV
				DDTAVYYCARG	PEDFALYYCQ	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	DNALQSGNSQESVTEQDSK
				GSLVRGVISGL	QYGSSPPYTF	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	DSTYSLSSTLTLSKADYEK
				DYWGQGTTVTV	GQGTKVEIK	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	HKVYACEVTHQGLSSPVTK
				SS		DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				1901	1902	1903	1904
57	VG9B409	IgG1	Kappa	EVQLVESGAEV	EIVLTQSPGT	EVQLVESGAEVKKPGASVKVSCKASGYTLTSYYMHWVR	EIVLTQSPGTLSLSPGERA
				KKPGASVKVSC	LSLSPGERAT	QAPGQGLEWMGIINPSGGSTSYAQKFQGRVTMTRDTST	TLSCRASQSVTSSYLAWYQ
				KASGYTLTSYY	LSCRASQSVT	STVYMELSSLRSEDTAVYYCARGSYGWYFDLWGRGTLV	QKPGQTPRLLIYGASSRAT
				MHWVRQAPGQG	SSYLAWYQQK	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	GIPDRISGSGSGTDFTLTV
				LEWMGIINPSG	PGQTPRLLIY	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	SRLEPEDFAVYYCQQYGSS
				GSTSYAQKFQG	GASSRATGIP	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	PPYTFGQGTKLEIKRTVAA
				RVTMTRDTSTS	DRISGSGSGT	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	PSVFIFPPSDEQLKSGTAS
				TVYMELSSLRS	DFTLTVSRLE	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	VVCLLNNFYPREAKVQWKV
				EDTAVYYCARG	PEDFAVYYCQ	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	DNALQSGNSQESVTEQDSK
				SYGWYFDLWGR	QYGSSPPYTF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	DSTYSLSSTLTLSKADYEK
				GTLVTVSS	GQGTKLEIK	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HKVYACEVTHQGLSSPVTK
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				1935	1936	1937	1938
58	VG9B411	IgG1	Kappa	EVQLVESGGGL	EIVMTQSPSS	EVQLVESGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	EIVMTQSPSSVSASVGDRV
				VKPGGSLRLSC	VSASVGDRVT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TITCRASQGINSWLAWYQQ
				SASGFTFSNYD	ITCRASQGIN	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	DPYKAPKLLIYAASTLQSG
				MNWVRQAPGKG	SWLAWYQQDP	GQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	VPSRFGGRGSGTEFTLTIS
				LEWVSSISSSS	YKAPKLLIYA	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SLQPEDFAVYYCQQYNNWP
				SYIYYADSVKG	ASTLQSGVPS	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	RTFGQGTKVDIKRTVAAPS
				RFTISRDNAKN	RFGGRGSGTE	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	VFIFPPSDEQLKSGTASVV
				SLYLQMNSLRA	FTLTISSLQP	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	CLLNNFYPREAKVQWKVDN
				EDTAVYHCARD	EDFAVYYCQQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	ALQSGNSQESVTEQDSKDS
				VGVTTDYYYYG	YNNWPRTFGQ	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	TYSLSSTLTLSKADYEKHK
				MDVWGQGTTVT	GTKVDIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	VYACEVTHQGLSSPVTKSF
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				1969	1970	1971	1972
59	VG9B129	IgG1	Kappa	EVQLVQSGAEV	EIVLTQSPGT	EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYVISWVR	EIVLTQSPGTLSLSPGERA
				KKPGSSVKVSC	LSLSPGERAT	QAPGQGLEWMGGILPILSTANYAQKFQGRVTITADKST	TLSCRASQSVSNNYLAWYQ
				KASGGTFSSYV	LSCRASQSVS	STAYMELSSLRSEDTAVYYCARAHDYYYGMDVWGQGTT	QKPGQAPRLLIYGASSRAT
				ISWVRQAPGQG	NNYLAWYQQK	VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF	GIPDRFSGSGSGTDFTLTI
				LEWMGGILPIL	PGQAPRLLIY	PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV	SRLEPEDFAVYYCQQYGSS
				STANYAQKFQG	GASSRATGIP	PSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC	PPYTFGQGTKVDIKRTVAA
				RVTITADKSTS	DRFSGSGSGT	PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV	PSVFIFPPSDEQLKSGTAS
				TAYMELSSLRS	DFTLTISRLE	DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV	VVCLLNNFYPREAKVQWKV
				EDTAVYYCARA	PEDFAVYYCQ	VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK	DNALQSGNSQESVTEQDSK
				HDYYYGMDVWG	QYGSSPPYTF	GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA	DSTYSLSSTLTLSKADYEK
				QGTTVTVSS	GQGTKVDIK	VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR	HKVYACEVTHQGLSSPVTK
						WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				2003	2004	2005	2006
60	VG9B396	IgG1	Lambda	EVQLVESGPGL	QSVLTQAPSV	EVQLVESGPGLVQPSETLSLTCTVSGDSIRGYYWNWIR	QSVLTQAPSVSGAPGQRVT
				VQPSETLSLTC	SGAPGQRVTI	QPAGKGLEWIGRIFTTGNTNYNPSLKSRLTMSLDTSKN	ISCTGSSSNIGADYDVKWY
				TVSGDSIRGYY	SCTGSSSNIG	QFSLKLNSVTAADTAVYYCAREKWDSSSSALYFDFWGQ	QQLPGTAPKLLIYGNTDRP
				WNWIRQPAGKG	ADYDVKWYQQ	GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK	SGVPDRFSGSKSGTSASLA
				LEWIGRIFTTG	LPGTAPKLLI	DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV	ITGLQAEDEADYYCQSYDS
				NTNYNPSLKSR	YGNTDRPSGV	VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT	RLTGYVVFGGGTKLTVLGQ
				LTMSLDTSKNQ	PDRFSGSKSG	HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC	PKAAPSVTLFPPSSEELQA
				FSLKLNSVTAA	TSASLAITGL	VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST	NKATLVCLISDFYPGAVTV
				DTAVYYCAREK	QAEDEADYYC	YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS	AWKADSSPVKAGVETTTPS
				WDSSSSALYFD	QSYDSRLTGY	KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS	KQSNNKYAASSYLSLTPEQ
				FWGQGTLVTVS	VVFGGGTKLT	DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD	WKSHRSYSCQVTHEGSTVE
				S	VL	KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	KTVAPTECS
				2037	2038	2039	2040
61	VG9B470	IgG1	Kappa	QVTLKESGPTL	EIVMTQSPSF	QVTLKESGPTLVKPTQTLTLTCTFSGFSLTTSGVGVGW	EIVMTQSPSFLSASVGDRV
				VKPTQTLTLTC	LSASVGDRVT	IRQPPGKALEWLALILWNDHTIYSPSLKSRLTITKDTS	TFTCRASQGISRYLAWYQQ
				TFSGFSLTTSG	FTCRASQGIS	KNQVVLTMTNMDPVDTAAYFCARDKWELRDAFDIWGQG	KPGRAPNLLIYVASTLQSG
				VGVGWIRQPPG	RYLAWYQQKP	TMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD	VPSRFSGSGSGTEFTLTIS
				KALEWLALILW	GRAPNLLIYV	YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV	SLLPEDFATYYCQQLISYP
				NDHTIYSPSLK	ASTLQSGVPS	TVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH	YTFSQGTRLEIKRTVAAPS
				SRLTITKDTSK	RFSGSGSGTE	TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV	VFIFPPSDEQLKSGTASVV
				NQVVLTMTNMD	FTLTISSLLP	VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY	CLLNNFYPREAKVQWKVDN
				PVDTAAYFCAR	EDFATYYCQQ	RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK	ALQSGNSQESVTEQDSKDS
				DKWELRDAFDI	LISYPYTFSQ	AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD	TYSLSSTLTLSKADYEKHK
				WGQGTMVTVSS	GTRLEIK	IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK	VYACEVTHQGLSSPVTKSF
						SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				2071	2072	2073	2074
62	VG9B111	IgG1	Kappa	QVQLLESGGGL	DIVMTQSPSS	QVQLLESGGGLVKPGGSLRLSCAASGFTFSTYSVNWVR	DIVMTQSPSSLSASVGDRV
				VKPGGSLRLSC	LSASVGDRVT	QAPGKGLEWVSSISSDSSYIFYADSMKGRFTISRDNAK	TITCQASQDISHYLNWYQQ
				AASGFTFSTYS	ITCQASQDIS	NSLYLHMNSLRAEDTAVYYCARDSVTGPFDYWGQGTLV	KPGKAPKLLIYDSYILETG
				VNWVRQAPGKG	HYLNWYQQKP	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	VTSRFSGSGSGTDFTFTIN
				LEWVSSISSDS	GKAPKLLIYD	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	SLQPEDIAIYYCQQYDNLP
				SYIFYADSMKG	SYILETGVTS	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	YTFGQGTKVEIKRTVAAPS
				RFTISRDNAKN	RFSGSGSGTD	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	VFIFPPSDEQLKSGTASVV
				SLYLHMNSLRA	FTFTINSLQP	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	CLLNNFYPREAKVQWKVDN
				EDTAVYYCARD	EDIAIYYCQQ	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ALQSGNSQESVTEQDSKDS
				SVTGPFDYWGQ	YDNLPYTFGQ	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	TYSLSSTLTLSKADYEKHK
				GTLVTVSS	GTKVEIK	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	VYACEVTHQGLSSPVTKSF
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				2105	2106	2107	2108
63	VG9B169	IgG1	Lambda	EVQLLESGPGL	QSALTQPPSA	EVQLLESGPGLVKPSETLSLTCSVSGGSITNYFWNWIR	QSALTQPPSASGTPGQRVT
				VKPSETLSLTC	SGTPGQRVTI	QPPGKGLEWIGYIFYSGSTSYNPSLKSRVTISVDTSKN	ISCSGSSSNIGSNTVNWYQ
				SVSGGSITNYF	SCSGSSSNIG	RFSLKLISVTAADTAVYYCARVGRWELRTAFDIWGQGT	QLPGTAPKLLIYSNNQRPS
				WNWIRQPPGKG	SNTVNWYQQL	MVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	GVPDRFSGSKSGTSASLAI
				LEWIGYIFYSG	PGTAPKLLIY	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	SGLQSEDEADYYCAAWDDS
				STSYNPSLKSR	SNNQRPSGVP	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	LNGPGVFGGGTKLTVLGQP
				VTISVDTSKNR	DRFSGSKSGT	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	KAAPSVTLFPPSSEELQAN
				FSLKLISVTAA	SASLAISGLQ	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	KATLVCLISDFYPGAVTVA
				DTAVYYCARVG	SEDEADYYCA	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	WKADSSPVKAGVETTTPSK
				RWELRTAFDIW	AWDDSLNGPG	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	QSNNKYAASSYLSLTPEQW
				GQGTMVTVSS	VFGGGTKLTV	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	KSHRSYSCQVTHEGSTVEK
					L	RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	TVAPTECS
				2139	2140	2141	2142
64	VG9B639	IgG1	Kappa	QVQLVQSGGGL	DIQMTQSPSS	QVQLVQSGGGLVKPGGSLRLSCAASGFTFTTYRMNWVR	DIQMTQSPSSLSASVGDRV
				VKPGGSLRLSC	LSASVGDRVT	QAPGKGLEWVSSISSSSIYIHSADSVKGRFTISRDNAK	TITCQASQDISHYLNWYQQ
				AASGFTFTTYR	ITCQASQDIS	NSLYLQMNSLRAEDSAIYYCARERVYTVSFDYWGQGTL	KPGKAPKLLIYDSYILETG
				MNWVRQAPGKG	HYLNWYQQKP	VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF	VTSRFSGSGSGTDFTFTIN
				LEWVSSISSSS	GKAPKLLIYD	PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV	SLQPEDIAIYYCQQYDNLP
				IYIHSADSVKG	SYILETGVTS	PSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC	YTFGQGTKVEIKRTVAAPS
				RFTISRDNAKN	RFSGSGSGTD	PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV	VFIFPPSDEQLKSGTASVV
				SLYLQMNSLRA	FTFTINSLQP	DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV	CLLNNFYPREAKVQWKVDN
				EDSAIYYCARE	EDIAIYYCQQ	VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK	ALQSGNSQESVTEQDSKDS
				RVYTVSFDYWG	YDNLPYTFGQ	GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA	TYSLSSTLTLSKADYEKHK
				QGTLVTVSS	GTKVEIK	VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR	VYACEVTHQGLSSPVTKSF
						WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				2173	2174	2175	2176
65	VG9B201	IgG1	Lambda	QVTLKESGPTL	QLVLTQPPSV	QVTLKESGPTLVKPTQTLTLTCTFSGFSLTTHGVGVGW	QLVLTQPPSVSAAPGQKVT
				VKPTQTLTLTC	SAAPGQKVTI	IRQPPRKALEWLALIYWNADKHYSPSLKSRLTITKDTS	ISCSGSSSNIGNNDVSWYQ
				TFSGFSLTTHG	SCSGSSSNIG	KNQVVLTMTHMDPVDTATYYCAHEGDWGHYFDFWGQGT	QLPGTAPKLLIYDNNRRPS
				VGVGWIRQPPR	NNDVSWYQQL	LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	GIPDRFSGSKSGTSATLGI
				KALEWLALIYW	PGTAPKLLIY	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	TGLQTGDEADYYCETWDSS
				NADKHYSPSLK	DNNRRPSGIP	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	LSAIWVFGGGTKVTVLGQP
				SRLTITKDTSK	DRFSGSKSGT	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	KAAPSVTLFPPSSEELQAN
				NQVVLTMTHMD	SATLGITGLQ	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	KATLVCLISDFYPGAVTVA
				PVDTATYYCAH	TGDEADYYCE	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	WKADSSPVKAGVETTTPSK
				EGDWGHYFDFW	TWDSSLSAIW	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	QSNNKYAASSYLSLTPEQW
				GQGTLVTVSS	VFGGGTKVTV	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	KSHRSYSCQVTHEGSTVEK
					L	RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	TVAPTECS
				2207	2208	2209	2210
66	VG9B161	IgG1	Lambda	QVQLQESGPGL	QPVLTQSSSA	QVQLQESGPGLVKPSETLSLTCTVSGGSISSYFWSWIR	QPVLTQSSSASGTPGQRVT
				VKPSETLSLTC	SGTPGQRVTI	QPPGKGLEWIGYIFYSGSTNYNPSLKSRVTILVDTSKN	ISCSGSSSNIGSNTVNWYQ
				TVSGGSISSYF	SCSGSSSNIG	HFSLKLSSVTAADTAVYYCARVGRWELRGAFDIWGQGT	QFPGTAPKLLIYSNNQRPS
				WSWIRQPPGKG	SNTVNWYQQF	MVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	GVPDRFSGSKSGTSASLAI
				LEWIGYIFYSG	PGTAPKLLIY	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	SGLQSEDEAEYYCAAWDDS
				STNYNPSLKSR	SNNQRPSGVP	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	LNSPGVFGGGTKLTVLGQP
				VTILVDTSKNH	DRFSGSKSGT	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	KAAPSVTLFPPSSEELQAN
				FSLKLSSVTAA	SASLAISGLQ	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	KATLVCLISDFYPGAVTVA
				DTAVYYCARVG	SEDEAEYYCA	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	WKADSSPVKAGVETTTPSK
				RWELRGAFDIW	AWDDSLNSPG	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	QSNNKYAASSYLSLTPEQW
				GQGTMVTVSS	VFGGGTKLTV	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	KSHRSYSCQVTHEGSTVEK
					L	RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	TVAPTECS
				2241	2242	2243	2244
67	VG9B383	IgG1	Lambda	QVQLQESGPGL	SSELTQPASV	QVQLQESGPGLVKPSETLSLTCTVSSGSISSYYWNWIR	SSELTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLEWVGRIYTIGNTNYNPSLKSRVTMSIDTSKN	ISCTGTSNDVGSYNLVSWY
				TVSSGSISSYY	SCTGTSNDVG	QFSLNLSSVTAADTAVYFCAREGYYDSSGSFFPGAFGI	QQHPGKAPKLMIYAGSKRP
				WNWIRQPAGKG	SYNLVSWYQQ	WGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC	SGISNRFSGSKSGNTASLT
				LEWVGRIYTIG	HPGKAPKLMI	LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL	ISGLQAEDEADYYCCSFAG
				NTNYNPSLKSR	YAGSKRPSGI	SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC	ATNVVFGGGTKLTVLGQPK
				VTMSIDTSKNQ	SNRFSGSKSG	DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE	AAPSVTLFPPSSEELQANK
				FSLNLSSVTAA	NTASLTISGL	VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY	ATLVCLISDFYPGAVTVAW
				DTAVYFCAREG	QAEDEADYYC	NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK	KADSSPVKAGVETTTPSKQ
				YYDSSGSFFPG	CSFAGATNVV	TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF	SNNKYAASSYLSLTPEQWK
				AFGIWGQGTMV	FGGGTKLTVL	YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL	SHRSYSCQVTHEGSTVEKT
				TVSS		TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VAPTECS
				2275	2276	2277	2278
68	VG9B382	IgG1	Lambda	QVQLQESGPGL	QSVLTQPPSV	QVQLQESGPGLVKPSETLSLTCTVSGDSISGYYWNYIR	QSVLTQPPSVSGAPGQRVT
				VKPSETLSLTC	SGAPGQRVTI	QPAGKGLDWIGRIFTTGNTNYNPSLKSRVTMSVDTSKN	ISCTGSSSNIGADYDIKWY
				TVSGDSISGYY	SCTGSSSNIG	QFSLKLTSVTAADTAVYYCARERWDSSSSALYFDYWGQ	QQLPGTAPKLLIYGNSNRP
				WNYIRQPAGKG	ADYDIKWYQQ	GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK	SGVPDRFSGSKSGTSVSLA
				LDWIGRIFTTG	LPGTAPKLLI	DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV	ITGLQAEDEADYYCQSYDS
				NTNYNPSLKSR	YGNSNRPSGV	VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT	SMSGYVVFGGGTKLTVLGQ
				VTMSVDTSKNQ	PDRFSGSKSG	HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC	PKAAPSVTLFPPSSEELQA
				FSLKLTSVTAA	TSVSLAITGL	VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST	NKATLVCLISDFYPGAVTV
				DTAVYYCARER	QAEDEADYYC	YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS	AWKADSSPVKAGVETTTPS
				WDSSSSALYFD	QSYDSSMSGY	KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS	KQSNNKYAASSYLSLTPEQ
				YWGQGTLVTVS	VVFGGGTKLT	DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD	WKSHRSYSCQVTHEGSTVE
				S	VL	KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	KTVAPTECS
				2309	2310	2311	2312
69	VG9B156	IgG1	Lambda	QVQLQESGPGL	QLVLTQPPSA	QVQLQESGPGLMKPSETLSLTCTVSNGSISGYFWNWIR	QLVLTQPPSASGTPGQRVT
				MKPSETLSLTC	SGTPGQRVTI	QPPGKGLEWIGYIFYSGSTNYNPSLKSRVTISVDTSKN	ISCSGSTSNIGSDTVNWYQ
				TVSNGSISGYF	SCSGSTSNIG	LVSLKLNSVTAADTAVYFCAKLGKWELRTAFDIWGQGT	QLPGTAPKLLIYSNNQRPS
				WNWIRQPPGKG	SDTVNWYQQL	MVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	GVPDRFSGSKSGTSASLAI
				LEWIGYIFYSG	PGTAPKLLIY	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	SGLQSEDETDYYCAAWDDS
				STNYNPSLKSR	SNNQRPSGVP	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	LNGPVFGGGTKVTVLGQPK
				VTISVDTSKNL	DRFSGSKSGT	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	AAPSVTLFPPSSEELQANK
				VSLKLNSVTAA	SASLAISGLQ	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	ATLVCLISDFYPGAVTVAW
				DTAVYFCAKLG	SEDETDYYCA	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	KADSSPVKAGVETTTPSKQ
				KWELRTAFDIW	AWDDSLNGPV	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	SNNKYAASSYLSLTPEQWK
				GQGTMVTVSS	FGGGTKVTVL	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	SHRSYSCQVTHEGSTVEKT
						RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VAPTECS
				2343	2344	2345	2346
70	VG9B205	IgG1	Lambda	QVQLVQSGPGL	SSELTQPPSV	QVQLVQSGPGLMKPSETLSLTCTVSNGSISGYFWNWIR	SSELTQPPSVSVSPGQTAS
				MKPSETLSLTC	SVSPGQTASI	QPPGKGLEWIGYIFYSGSTNYNPSLKSRVTISVDTSKN	ITCSGDKLGDKYACWYQQK
				TVSNGSISGYF	TCSGDKLGDK	LVSLKLNSVTAADTAVYFCAKLGKWELRTAFDIWGQGT	PGQSPVLVIYQDSKRPSGI
				WNWIRQPPGKG	YACWYQQKPG	MVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	PERFSGSNSGNTATLTISG
				LEWIGYIFYSG	QSPVLVIYQD	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	TQAMDEADYYCQAWDSSTV
				STNYNPSLKSR	SKRPSGIPER	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	VFGGGTKLTVLGQPKAAPS
				VTISVDTSKNL	FSGSNSGNTA	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	VTLFPPSSEELQANKATLV
				VSLKLNSVTAA	TLTISGTQAM	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	CLISDFYPGAVTVAWKADS
				DTAVYFCAKLG	DEADYYCQAW	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	SPVKAGVETTTPSKQSNNK
				KWELRTAFDIW	DSSTVVFGGG	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	YAASSYLSLTPEQWKSHRS
				GQGTMVTVSS	TKLTVL	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	YSCQVTHEGSTVEKTVAPT
						RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	ECS
				2377	2378	2379	2380
71	VG9B86	IgG1	Kappa	QVQLQESGPGL	EIVLTQSPAT	QVQLQESGPGLVKPSETLSLTCTVSGDSISSSYWSWIR	EIVLTQSPATLSLSPGERA
				VKPSETLSLTC	LSLSPGERAT	QPAGKGLECIGRFYSSGSTSYNPSLKSRVTMAIDTSKN	TLSCRASQSVSSYLAWYQQ
				TVSGDSISSSY	LSCRASQSVS	QFSLKLTSVTAADTAVYYCARYSGSYWYFDLWGRGTTV	RPGQAPRLLIYDTSNRATG
				WSWIRQPAGKG	SYLAWYQQRP	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	IPARFSGSGSGTDFTLTIS
				LECIGRFYSSG	GQAPRLLIYD	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	SLAPEDFAVYYCQQRSDWL
				STSYNPSLKSR	TSNRATGIPA	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	LTFGGGTKVEIKRTVAAPS
				VTMAIDTSKNQ	RFSGSGSGTD	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	VFIFPPSDEQLKSGTASVV
				FSLKLTSVTAA	FTLTISSLAP	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	CLLNNFYPREAKVQWKVDN
				DTAVYYCARYS	EDFAVYYCQQ	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ALQSGNSQESVTEQDSKDS
				GSYWYFDLWGR	RSDWLLTFGG	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	TYSLSSTLTLSKADYEKHK
				GTTVTVSS	GTKVEIK	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	VYACEVTHQGLSSPVTKSF
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				2411	2412	2413	2414
72	VG9B154	IgG1	Lambda	QVQLQESGPGL	QSALTQPPSA	QVQLQESGPGLVKPSETLSLTCTVSGGSISYYFWNWIR	QSALTQPPSASGTPGQRVT
				VKPSETLSLTC	SGTPGQRVTI	QPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISLDTSKN	ISCSGSSSNIGSNTVNWYQ
				TVSGGSISYYF	SCSGSSSNIG	QFSLKLSSVTAADTAVYYCAREGKWELRTTFDIWGQGT	QLPGTAPKLLIYSNNQRPS
				WNWIRQPPGKG	SNTVNWYQQL	MVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	GVPDRFSGSKSGTSASLAI
				LEWIGYIYYSG	PGTAPKLLIY	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	SGLQSEDEADYYCAAWDDS
				STNYNPSLKSR	SNNQRPSGVP	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	LNGPVFGGGTKLTVLGQPK
				VTISLDTSKNQ	DRFSGSKSGT	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	AAPSVTLFPPSSEELQANK
				FSLKLSSVTAA	SASLAISGLQ	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	ATLVCLISDFYPGAVTVAW
				DTAVYYCAREG	SEDEADYYCA	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	KADSSPVKAGVETTTPSKQ
				KWELRTTFDIW	AWDDSLNGPV	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	SNNKYAASSYLSLTPEQWK
				GQGTMVTVSS	FGGGTKLTVL	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	SHRSYSCQVTHEGSTVEKT
						RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VAPTECS
				2445	2446	2447	2448
73	VG9B159	IgG1	Lambda	EVQLVQSGPGL	SYELMQPPSV	EVQLVQSGPGLVKPSETLSLTCTVSGGSISSYYWSWIR	SYELMQPPSVSVAPGQTAR
				VKPSETLSLTC	SVAPGQTARI	QPAGKGLEWIGRFYTGGRNNYNPSFKSRVTMSVDTSQN	ITCGGNNIGSKSVHWYQQK
				TVSGGSISSYY	TCGGNNIGSK	QFSLKLSSVTAADTAVYYCARDMEYYYDRSGYSYWYFD	PGQAPVLVVYDDSDRPSGI
				WSWIRQPAGKG	SVHWYQQKPG	LWGRGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALG	PERFSGSNSGNTATLTISR
				LEWIGRFYTGG	QAPVLVVYDD	CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS	VEAGDEADYYCQVWDSSSD
				RNNYNPSFKSR	SDRPSGIPER	LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS	HVVFGGGTKLTVLGQPKAA
				VTMSVDTSQNQ	FSGSNSGNTA	CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP	PSVTLFPPSSEELQANKAT
				FSLKLSSVTAA	TLTISRVEAG	EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ	LVCLISDFYPGAVTVAWKA
				DTAVYYCARDM	DEADYYCQVW	YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE	DSSPVKAGVETTTPSKQSN
				EYYYDRSGYSY	DSSSDHVVFG	KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG	NKYAASSYLSLTPEQWKSH
				WYFDLWGRGTT	GGTKLTVL	FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK	RSYSCQVTHEGSTVEKTVA
				VTVSS		LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	PTECS
				2479	2480	2481	2482
74	VG9B465	IgG1	Lambda	QVQLQQSGPGL	SSELTQPASV	QVQLQQSGPGLVKPSETLSLTCTVSGGSITSYYWNWIR	SSELTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLEWIGRIYTIGNTNYNPSLKSRVTMSIDTSKH	ISCTGTSNDVGSYNLVSWY
				TVSGGSITSYY	SCTGTSNDVG	QFSLKLSSVTGADTAVYYCAREGYYESDGSFFPGAFNI	QQHPGKAPKLMIYAGSKRP
				WNWIRQPAGKG	SYNLVSWYQQ	WGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC	SGISNRFSGSKSGNTASLT
				LEWIGRIYTIG	HPGKAPKLMI	LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL	ISGLQAEDEADYYCCSYAG
				NTNYNPSLKSR	YAGSKRPSGI	SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC	TTNVVFGGGTKVTVLGQPK
				VTMSIDTSKHQ	SNRFSGSKSG	DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE	AAPSVTLFPPSSEELQANK
				FSLKLSSVTGA	NTASLTISGL	VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY	ATLVCLISDFYPGAVTVAW
				DTAVYYCAREG	QAEDEADYYC	NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK	KADSSPVKAGVETTTPSKQ
				YYESDGSFFPG	CSYAGTTNVV	TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF	SNNKYAASSYLSLTPEQWK
				AFNIWGQGTMV	FGGGTKVTVL	YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL	SHRSYSCQVTHEGSTVEKT
				TVSS		TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VAPTECS
				2513	2514	2515	2516
75	VG9B194	IgG1	Lambda	EVQLLESGAEV	QSVLTQPPSA	EVQLLESGAEVKKPGASVKVSCKASGYTFTGDYMHWVR	QSVLTQPPSASGSPGQSVT
				KKPGASVKVSC	SGSPGQSVTI	QAPGQGLEWMGWINPNSGYTNNAEKFQGRVTMTRDTSI	ISCTGTSSDVGGYNYVSWY
				KASGYTFTGDY	SCTGTSSDVG	STAYMELSRLSSDDTAVYYCTRELDALDVWGQGTMVTV	QQHPGKAPKLMIYEVSKRP
				MHWVRQAPGQG	GYNYVSWYQQ	SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP	SGVPDRFSGSKSGNTASLT
				LEWMGWINPNS	HPGKAPKLMI	VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS	VSGLQAEDEADYYCNSYAG
				GYTNNAEKFQG	YEVSKRPSGV	SLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPC	SNNFEVFGGGTKVTVLGQP
				RVTMTRDTSIS	PDRFSGSKSG	PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS	KAAPSVTLFPPSSEELQAN
				TAYMELSRLSS	NTASLTVSGL	HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV	KATLVCLISDFYPGAVTVA
				DDTAVYYCTRE	QAEDEADYYC	LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP	WKADSSPVKAGVETTTPSK
				LDALDVWGQGT	NSYAGSNNFE	REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW	QSNNKYAASSYLSLTPEQW
				MVTVSS	VFGGGTKVTV	ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ	KSHRSYSCQVTHEGSTVEK
					L	GNVFSCSVMHEALHNHYTQKSLSLSPGK	TVAPTECS
				2547	2548	2549	2550
76	VG9B182	IgG1	Lambda	QVQLVESGPGL	QSALTQPPSA	QVQLVESGPGLVKPSETLSLTCTVSGDSINNHFWSWIR	QSALTQPPSASGTPGQRVT
				VKPSETLSLTC	SGTPGQRVTI	QPPGKGLEWIGFVFYNGNTNYNPSLKSRVTISIDTSKS	ISCSGSSSNIGSNTVNWYQ
				TVSGDSINNHF	SCSGSSSNIG	QFSLKLTSVTAADTAVYYCARVGRWVLRTAFDIWGQGT	QLPGTAPKLLIYSNNQRPS
				WSWIRQPPGKG	SNTVNWYQQL	MVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	GVPARFSGSKSGTSASLAI
				LEWIGFVFYNG	PGTAPKLLIY	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	SGLQSEDEADYYCAAWDDS
				NTNYNPSLKSR	SNNQRPSGVP	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	LNGPGVFGGGTKLTVLGQP
				VTISIDTSKSQ	ARFSGSKSGT	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	KAAPSVTLFPPSSEELQAN
				FSLKLTSVTAA	SASLAISGLQ	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	KATLVCLISDFYPGAVTVA
				DTAVYYCARVG	SEDEADYYCA	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	WKADSSPVKAGVETTTPSK
				RWVLRTAFDIW	AWDDSLNGPG	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	QSNNKYAASSYLSLTPEQW
				GQGTMVTVSS	VFGGGTKLTV	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	KSHRSYSCQVTHEGSTVEK
					L	RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	TVAPTECS
				2581	2582	2583	2584
77	VG9B173	IgG1	Lambda	QVQLQESGPGL	QSVLTQPPSA	QVQLQESGPGLVKPSETLSLTCTVSGGSINNYFWSWIR	QSVLTQPPSASGTPGQRVT
				VKPSETLSLTC	SGTPGQRVTI	QPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVVTSMN	ISCSGSSSNIESNTVNWYQ
				TVSGGSINNYF	SCSGSSSNIE	QFSLKLSSVTAADTAVYYCAREGKWELRSAFDIWGQGT	QLPRTAPKLLIYSNNQRPS
				WSWIRQPPGKG	SNTVNWYQQL	MVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	GVPDRFSGSKSGTSASLAI
				LEWIGYIYYSG	PRTAPKLLIY	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	SGLQSEDEADYYCTAWDDS
				STNYNPSLKSR	SNNQRPSGVP	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	LNGPVFGGGTKVTVLGQPK
				VTISVVTSMNQ	DRFSGSKSGT	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	AAPSVTLFPPSSEELQANK
				FSLKLSSVTAA	SASLAISGLQ	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	ATLVCLISDFYPGAVTVAW
				DTAVYYCAREG	SEDEADYYCT	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	KADSSPVKAGVETTTPSKQ
				KWELRSAFDIW	AWDDSLNGPV	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	SNNKYAASSYLSLTPEQWK
				GQGTMVTVSS	FGGGTKVTVL	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	SHRSYSCQVTHEGSTVEKT
						RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VAPTECS
				2615	2616	2617	2618
78	VG9B87	IgG1	Kappa	QVQLVESGAEV	EIVLTQSPSF	QVQLVESGAEVKKPGASVKVSCKASGYTFTSEYIHWVR	EIVLTQSPSFLSASAGDRV
				KKPGASVKVSC	LSASAGDRVT	QAPGQGLEWMGIINPSGGSTSYAQRFQGRVTMTRDTST	TITCRASQGISSYLAWYQQ
				KASGYTFTSEY	ITCRASQGIS	STVYMEVNSLRSEDTAVYYCARERGYSYGSFDYWGQGT	KPEKAPKLLIYAASTLQSG
				IHWVRQAPGQG	SYLAWYQQKP	LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	VPSRFSGSGSGTEFTLTIS
				LEWMGIINPSG	EKAPKLLIYA	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	SLQPEDFATYYCQQFNSYS
				GSTSYAQRFQG	ASTLQSGVPS	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	LTFGGGTKLEIKRTVAAPS
				RVTMTRDTSTS	RFSGSGSGTE	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	VFIFPPSDEQLKSGTASVV
				TVYMEVNSLRS	FTLTISSLQP	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	CLLNNFYPREAKVQWKVDN
				EDTAVYYCARE	EDFATYYCQQ	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	ALQSGNSQESVTEQDSKDS
				RGYSYGSFDYW	FNSYSLTFGG	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	TYSLSSTLTLSKADYEKHK
				GQGTLVTVSS	GTKLEIK	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	VYACEVTHQGLSSPVTKSF
						RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				2649	2650	2651	2652
79	VG9B208	IgG1	Lambda	QVQLQESGPGL	QSVLTQPPSV	QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIR	QSVLTQPPSVSAAPGQKVT
				VKPSETLSLTC	SAAPGQKVTI	QPPGKGLELIGYIFYSGSINYNPSLKNRVTISLDTSKN	ISCSGSTSNIGNNDVSWYQ
				TVSGGSISGYY	SCSGSTSNIG	QFSLKLTSVTAADTAVYYCARVGKWELRSSFDIWGQGT	QLPGTAPKLLIYDNNKRPS
				WSWIRQPPGKG	NNDVSWYQQL	MVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	GIPDRFSGSKSGTSATLGI
				LELIGYIFYSG	PGTAPKLLIY	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	TGLQTGDEADYYCGTWDSS
				SINYNPSLKNR	DNNKRPSGIP	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	LSVWVFGGGTKLTVLGQPK
				VTISLDTSKNQ	DRFSGSKSGT	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	AAPSVTLFPPSSEELQANK
				FSLKLTSVTAA	SATLGITGLQ	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	ATLVCLISDFYPGAVTVAW
				DTAVYYCARVG	TGDEADYYCG	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	KADSSPVKAGVETTTPSKQ
				KWELRSSFDIW	TWDSSLSVWV	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	SNNKYAASSYLSLTPEQWK
				GQGTMVTVSS	FGGGTKLTVL	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	SHRSYSCQVTHEGSTVEKT
						RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VAPTECS
				2683	2684	2685	2686
80	VG9B372	IgG1	Kappa	QVQLQESGPGL	EIVMTQSPAT	QVQLQESGPGLVKPSQTLSLTCTVSGGSISNGGFYWSW	EIVMTQSPATLSLSPGEGA
				VKPSQTLSLTC	LSLSPGEGAT	IRQHPGKGLEWLGYINYSGSTYYNPSLESRGTISLDTS	TLSCRASQSVSSYLAWYQQ
				TVSGGSISNGG	LSCRASQSVS	KNQFSLKLRSVTAADTAVYYCARDRNYEWNFDLWGRGT	KPGQAPRLLVYDASNRATG
				FYWSWIRQHPG	SYLAWYQQKP	LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	IPARFSGSGSGTAFTLTIT
				KGLEWLGYINY	GQAPRLLVYD	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	SLEPEDFVVYYCQQRSNWP
				SGSTYYNPSLE	ASNRATGIPA	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	LTFGGGTKLEIKRTVAAPS
				SRGTISLDTSK	RFSGSGSGTA	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	VFIFPPSDEQLKSGTASVV
				NQFSLKLRSVT	FTLTITSLEP	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	CLLNNFYPREAKVQWKVDN
				AADTAVYYCAR	EDFVVYYCQQ	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	ALQSGNSQESVTEQDSKDS
				DRNYEWNFDLW	RSNWPLTFGG	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	TYSLSSTLTLSKADYEKHK
				GRGTLVTVSS	GTKLEIK	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	VYACEVTHQGLSSPVTKSF
						RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				2717	2718	2719	2720
81	VG9B186	IgG1	Lambda	QVTLRESGPVL	QSVLTQPPSA	QVTLRESGPVLVKPTETLTLTCTVSGFSLTNIRMSVSW	QSVLTQPPSASGTPGQRVT
				VKPTETLTLTC	SGTPGQRVTI	IRQPPGEALEWLAHIFSNDEKSYNSSLKSRLTISRDTS	ISCSGSTSNIGSNTVNWYQ
				TVSGFSLTNIR	SCSGSTSNIG	KSQVVLTLTNVDPVDTATYYCARMRLPYGMDVWGQGTM	QLPGTAPKLLIYSNNQRPS
				MSVSWIRQPPG	SNTVNWYQQL	VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF	GVPDRFSGSKSGTSASLAI
				EALEWLAHIFS	PGTAPKLLIY	PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV	SGLQSEDEADFYCAAWDDS
				NDEKSYNSSLK	SNNQRPSGVP	PSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC	LNGPVFGGGTKVTVLGQPK
				SRLTISRDTSK	DRFSGSKSGT	PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV	AAPSVTLFPPSSEELQANK
				SQVVLTLTNVD	SASLAISGLQ	DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV	ATLVCLISDFYPGAVTVAW
				PVDTATYYCAR	SEDEADFYCA	VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK	KADSSPVKAGVETTTPSKQ
				MRLPYGMDVWG	AWDDSLNGPV	GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA	SNNKYAASSYLSLTPEQWK
				QGTMVTVSS	FGGGTKVTVL	VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR	SHRSYSCQVTHEGSTVEKT
						WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VAPTECS
				2751	2752	2753	2754
82	VG9B177	IgG1	Lambda	QVQLQESGPGL	QSALTQPASV	QVQLQESGPGLVKPSETLSLTCTVSGGSINNYFWSWIR	QSALTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPPGKGLEWIGYIFYSGSTNYNPSLKSRVTISIDTSKN	ISCTGTSSDVADYNYVSWY
				TVSGGSINNYF	SCTGTSSDVA	QFSLKVNSVTAADTAVYYCARVGKWELRTAFDIWGQGT	QQHPGKAPKLMIYEVSNRP
				WSWIRQPPGKG	DYNYVSWYQQ	MVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	SGVSNRFSGSKSGNTASLT
				LEWIGYIFYSG	HPGKAPKLMI	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	ISGLQAEDEADYYCCSYTS
				STNYNPSLKSR	YEVSNRPSGV	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	SFTVVFGGGTKVTVLGQPK
				VTISIDTSKNQ	SNRFSGSKSG	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	AAPSVTLFPPSSEELQANK
				FSLKVNSVTAA	NTASLTISGL	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	ATLVCLISDFYPGAVTVAW
				DTAVYYCARVG	QAEDEADYYC	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	KADSSPVKAGVETTTPSKQ
				KWELRTAFDIW	CSYTSSFTVV	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	SNNKYAASSYLSLTPEQWK
				GQGTMVTVSS	FGGGTKVTVL	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	SHRSYSCQVTHEGSTVEKT
						RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VAPTECS
				2785	2786	2787	2788
83	VG9B114	IgG1	Kappa	EVQLVESGGDL	DIVMTQSPSF	EVQLVESGGDLVQPGGSLRLSCAASGFTFSRYDMHWVR	DIVMTQSPSFLSASVGDRV
				VQPGGSLRLSC	LSASVGDRVT	QATGKGLEWVSAIGSAGDTYYPGSVKGRFTISRENAKN	TITCRASQGIHSYLAWYQQ
				AASGFTFSRYD	ITCRASQGIH	SLYLQMNSLRAGDTAVYYCARGKWELRDAFDIWGQGTM	KPGKAPKLLIYVASTLQSG
				MHWVRQATGKG	SYLAWYQQKP	VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF	VPSRFSGSRSGTEFTLTIS
				LEWVSAIGSAG	GKAPKLLIYV	PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV	SLQPEDFATYYCQQLNSYP
				DTYYPGSVKGR	ASTLQSGVPS	PSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC	YTFGQGTKLEIKRTVAAPS
				FTISRENAKNS	RFSGSRSGTE	PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV	VFIFPPSDEQLKSGTASVV
				LYLQMNSLRAG	FTLTISSLQP	DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV	CLLNNFYPREAKVQWKVDN
				DTAVYYCARGK	EDFATYYCQQ	VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK	ALQSGNSQESVTEQDSKDS
				WELRDAFDIWG	LNSYPYTFGQ	GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA	TYSLSSTLTLSKADYEKHK
				QGTMVTVSS	GTKLEIK	VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR	VYACEVTHQGLSSPVTKSF
						WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				2819	2820	2821	2822
84	VG9B147	IgG1	Lambda	QVQLQESGPGL	SSELTQDPAV	QVQLQESGPGLVNPSETLSLTCTVSGGSISGYFWNWIR	SSELTQDPAVSVALGQTVR
				VNPSETLSLTC	SVALGQTVRI	QPPGKGLEWIGYIFYSGSTNYNPSLKSRVTISVDTSKN	ITCQGDSLRSYYATWYQQK
				TVSGGSISGYF	TCQGDSLRSY	QFSLKLSSVTAADTAIYYCAREGKWELRSTFDIWGQGT	PGQAPILVIYGENNRPSGI
				WNWIRQPPGKG	YATWYQQKPG	MVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	PDRFSGSRSGNTASLTITG
				LEWIGYIFYSG	QAPILVIYGE	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	AQAEDEADYYCNSRDTGDH
				STNYNPSLKSR	NNRPSGIPDR	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	HLVFGGGTKLTVLGQPKAA
				VTISVDTSKNQ	FSGSRSGNTA	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	PSVTLFPPSSEELQANKAT
				FSLKLSSVTAA	SLTITGAQAE	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	LVCLISDFYPGAVTVAWKA
				DTAIYYCAREG	DEADYYCNSR	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	DSSPVKAGVETTTPSKQSN
				KWELRSTFDIW	DTGDHHLVFG	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	NKYAASSYLSLTPEQWKSH
				GQGTMVTVSS	GGTKLTVL	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	RSYSCQVTHEGSTVEKTVA
						RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	PTECS
				2853	2854	2855	2856
85	VG9B65	IgG1	Kappa	QVQLVQSGAEV	DIVMTQTPLS	QVQLVQSGAEVKKPGSSVKVSCKASGGTFNIYAINWVR	DIVMTQTPLSSPVTLGQPA
				KKPGSSVKVSC	SPVTLGQPAS	QAPGQGLEWMGGIIPFFGTANYAQKFQDRVTITADKST	SISCRSSQSLVHSDGNTYL
				KASGGTFNIYA	ISCRSSQSLV	NTAYMELSSLRSEDTAVFYCARGGDSGYDWGFDYWGQG	SWLQQRPGQPPRLLIYQIS
				INWVRQAPGQG	HSDGNTYLSW	TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD	NRFSGVPDRFSGSGAGTDF
				LEWMGGIIPFF	LQQRPGQPPR	YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV	TLNISRVEADDVGVYYCMQ
				GTANYAQKFQD	LLIYQISNRF	TVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH	ATQFPLTFGGGTKVEIKRT
				RVTITADKSTN	SGVPDRFSGS	TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV	VAAPSVFIFPPSDEQLKSG
				TAYMELSSLRS	GAGTDFTLNI	VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY	TASVVCLLNNFYPREAKVQ
				EDTAVFYCARG	SRVEADDVGV	RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK	WKVDNALQSGNSQESVTEQ
				GDSGYDWGFDY	YYCMQATQFP	AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD	DSKDSTYSLSSTLTLSKAD
				WGQGTLVTVSS	LTFGGGTKVE	IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK	YEKHKVYACEVTHQGLSSP
					IK	SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VTKSFNRGEC
				2887	2888	2889	2890
86	VG9B81	IgG1	Kappa	QVQLQESGPGL	DIQMTQSPSF	QVQLQESGPGLVKPSETLSLTCSVSGGSINTYYWSWFR	DIQMTQSPSFLSASVRDRV
				VKPSETLSLTC	LSASVRDRVN	QPAGKGLELIGRIYTSDNTNYNPSLKSRVTMSVDTSKN	NITCRASQGISSYLAWYQQ
				SVSGGSINTYY	ITCRASQGIS	QFSLKLSSVTAADTAVYYCARYNWNYWYFDLWGRGTLV	KPGKAPKLLIYTASTLQSG
				WSWFRQPAGKG	SYLAWYQQKP	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	VPSRFSGSGSGTEFTLTIS
				LELIGRIYTSD	GKAPKLLIYT	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	SLQPEDFATYYCQHLNSYP
				NTNYNPSLKSR	ASTLQSGVPS	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	YTFGQGTKVEIKRTVAAPS
				VTMSVDTSKNQ	RFSGSGSGTE	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	VFIFPPSDEQLKSGTASVV
				FSLKLSSVTAA	FTLTISSLQP	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	CLLNNFYPREAKVQWKVDN
				DTAVYYCARYN	EDFATYYCQH	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ALQSGNSQESVTEQDSKDS
				WNYWYFDLWGR	LNSYPYTFGQ	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	TYSLSSTLTLSKADYEKHK
				GTLVTVSS	GTKVEIK	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	VYACEVTHQGLSSPVTKSF
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				2921	2922	2923	2924
87	VG9B203	IgG1	Lambda	QVQLVQSGPGL	QSVLTQPPSV	QVQLVQSGPGLVKPSETLSLTCTVSGDSIGHYYWNWIR	QSVLTQPPSVSAAPGQKVT
				VKPSETLSLTC	SAAPGQKVTI	QPAGKGLEWIGRIYTSGSTNYNPSLKSRVTMSVDTSKN	ISCSGSSSNIGNNYVSWYQ
				TVSGDSIGHYY	SCSGSSSNIG	QFSLKLSSVTAADTAVYYCARSGGNFYWYFDLWGRGTL	QVPGTAPKLLIYDNNKRPS
				WNWIRQPAGKG	NNYVSWYQQV	VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF	GIPDRISGSKSGTSATLGI
				LEWIGRIYTSG	PGTAPKLLIY	PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV	TGLQTGDEADYYCGTWDSS
				STNYNPSLKSR	DNNKRPSGIP	PSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC	LSAGVFGGGTKVTVLGQPK
				VTMSVDTSKNQ	DRISGSKSGT	PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV	AAPSVTLFPPSSEELQANK
				FSLKLSSVTAA	SATLGITGLQ	DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV	ATLVCLISDFYPGAVTVAW
				DTAVYYCARSG	TGDEADYYCG	VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK	KADSSPVKAGVETTTPSKQ
				GNFYWYFDLWG	TWDSSLSAGV	GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA	SNNKYAASSYLSLTPEQWK
				RGTLVTVSS	FGGGTKVTVL	VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR	SHRSYSCQVTHEGSTVEKT
						WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VAPTECS
				2955	2956	2957	2958
88	VG9B380	IgG1	Lambda	QVQLQESGPGL	QSALTQPASV	QVQLQESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QSALTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLEWIGRIYPSGITSYDPSLKSRVTMSLDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QFSLKLTSVTAADTAVYYCAGIMGTKGAFDIWGQGTMV	QQHPGKAPKLLIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGSTASLT
				LEWIGRIYPSG	HPGKAPKLLI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITSYDPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSLDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				FSLKLTSVTAA	STASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIM	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GTKGAFDIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				2989	2990	2991	2992
89	VG9B103	IgG1	Kappa	EVQLVQSGAEV	ETTLTQSPLS	EVQLVQSGAEVKKPGSSVKVSCKTSGGTFSSYAISWVR	ETTLTQSPLSSPVTLGQPA
				KKPGSSVKVSC	SPVTLGQPAS	QAPGQGLEWMGGIIPIFGTATYAQKFQDRVTITADKST	SISCRSSQGLVHSDGNTYL
				KTSGGTFSSYA	ISCRSSQGLV	STAYMELSSLRSEDTAVFYCARGVGWGTDYYYGLDVWG	SWLQQRPGQSPRLLIYKIS
				ISWVRQAPGQG	HSDGNTYLSW	QGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	NRFSGVPDRFSGSGAGTDF
				LEWMGGIIPIF	LQQRPGQSPR	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	TLKISRVEAEDVGVYYCMQ
				GTATYAQKFQD	LLIYKISNRF	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	ATHHPLTFGGGTKVEIKRT
				RVTITADKSTS	SGVPDRFSGS	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	VAAPSVFIFPPSDEQLKSG
				TAYMELSSLRS	GAGTDFTLKI	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	TASVVCLLNNFYPREAKVQ
				EDTAVFYCARG	SRVEAEDVGV	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	WKVDNALQSGNSQESVTEQ
				VGWGTDYYYGL	YYCMQATHHP	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	DSKDSTYSLSSTLTLSKAD
				DVWGQGTTVTV	LTFGGGTKVE	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	YEKHKVYACEVTHQGLSSP
				SS	IK	DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VTKSFNRGEC
				3023	3024	3025	3026
90	VG9B462	IgG1	Lambda	QVQLQQSGPGL	QSVLTQPASV	QVQLQQSGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QSVLTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3057	3058	3059	3060
91	VG9B461	IgG1	Lambda	QVTLKESGPGL	QPVLTQSSSV	QVTLKESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QPVLTQSSSVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKVTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKVTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3091	3092	3093	3094
92	VG9B106	IgG1	Kappa	EVQLVQSGAEV	DIVMTQSPDS	EVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYLHWVR	DIVMTQSPDSLAVSLGERA
				KKPGASVKVSC	LAVSLGERAT	QAPGQGLEWVGWINPSSGDTDYAQTFQGRVTMTRDTSI	TINCKSSQSVLYSSNNKNY
				KASGYTFTGYY	INCKSSQSVL	STAYMELSRLRSDDTAVYYCANELGIGVFDYWGQGTLV	LGWYQQKPGQPPKLLIYWA
				LHWVRQAPGQG	YSSNNKNYLG	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	STRESGVPDRFSGSGSGTD
				LEWVGWINPSS	WYQQKPGQPP	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	FTLTISSLQAEDVAVYFCQ
				GDTDYAQTFQG	KLLIYWASTR	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	QYYSIPYTFGQGTKVDIKR
				RVTMTRDTSIS	ESGVPDRFSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	TVAAPSVFIFPPSDEQLKS
				TAYMELSRLRS	SGSGTDFTLT	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	GTASVVCLLNNFYPREAKV
				DDTAVYYCANE	ISSLQAEDVA	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	QWKVDNALQSGNSQESVTE
				LGIGVFDYWGQ	VYFCQQYYSI	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	QDSKDSTYSLSSTLTLSKA
				GTLVTVSS	PYTFGQGTKV	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	DYEKHKVYACEVTHQGLSS
					DIK	QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	PVTKSFNRGEC
				3125	3126	3127	3128
93	VG9B115	IgG1	Kappa	QVTLRESGPTL	EIVLTQSPAT	QVTLRESGPTLVKPTQTLTLTCTFSGFSLSTYGVGVGW	EIVLTQSPATLSLSPGERA
				VKPTQTLTLTC	LSLSPGERAT	IRQPPGKALEWLALIYWNDDKRYNPSLKSRLTITKDTS	TLSCRASQSVSSYLAWYQQ
				TFSGFSLSTYG	LSCRASQSVS	KNQVVLTMTNMDPVGTATYYCSHESDWSYYFDYWGQGT	KPGLAPRLLIYDASNRATG
				VGVGWIRQPPG	SYLAWYQQKP	MVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	IPARFSGSGSGTDFTLTIS
				KALEWLALIYW	GLAPRLLIYD	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	SLEPVDFAVYYCQQRSSWP
				NDDKRYNPSLK	ASNRATGIPA	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	WTFGQGTKVDIKRTVAAPS
				SRLTITKDTSK	RFSGSGSGTD	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	VFIFPPSDEQLKSGTASVV
				NQVVLTMTNMD	FTLTISSLEP	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	CLLNNFYPREAKVQWKVDN
				PVGTATYYCSH	VDFAVYYCQQ	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	ALQSGNSQESVTEQDSKDS
				ESDWSYYFDYW	RSSWPWTFGQ	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	TYSLSSTLTLSKADYEKHK
				GQGTMVTVSS	GTKVDIK	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	VYACEVTHQGLSSPVTKSF
						RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				3159	3160	3161	3162
94	VG9B27	IgG1	Kappa	EVQLVQSGAEV	DIVMTQTPLS	EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYVISWVR	DIVMTQTPLSSPVTLGQPA
				KKPGSSVKVSC	SPVTLGQPAS	QAPGQGLEWMGGILPILSTANYAQKFQGRVTITADKST	SISCRSSQSLVHSDGNTYL
				KASGGTFSSYV	ISCRSSQSLV	STAYMELSSLRSEDTAVYYCARAHDYYYGMDVWGQGTM	SWLQQRPGQPPRLLVYKIS
				ISWVRQAPGQG	HSDGNTYLSW	VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF	NRFSGVPDRFSGSGAGTDF
				LEWMGGILPIL	LQQRPGQPPR	PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV	TLKISRVEAEDVGIYYCMQ
				STANYAQKFQG	LLVYKISNRF	PSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC	ATHHPLTFGGGTKLEIKRT
				RVTITADKSTS	SGVPDRFSGS	PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV	VAAPSVFIFPPSDEQLKSG
				TAYMELSSLRS	GAGTDFTLKI	DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV	TASVVCLLNNFYPREAKVQ
				EDTAVYYCARA	SRVEAEDVGI	VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK	WKVDNALQSGNSQESVTEQ
				HDYYYGMDVWG	YYCMQATHHP	GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA	DSKDSTYSLSSTLTLSKAD
				QGTMVTVSS	LTFGGGTKLE	VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR	YEKHKVYACEVTHQGLSSP
					IK	WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VTKSFNRGEC
				3193	3194	3195	3196
95	VG9B458	IgG1	Lambda	QVQLVQSGPGL	QSVLTQPASV	QVQLVQSGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QSVLTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3227	3228	3229	3230
96	VG9B131	IgG1	Kappa	QVQLVQSGGTL	EIVMTQSPAT	QVQLVQSGGTLVQPGGSLRLSCAVSGFTFSSYDMNWVR	EIVMTQSPATLSLSPGERA
				VQPGGSLRLSC	LSLSPGERAT	QAPGKGLEWVSYISSSSTAKYYADSVKGRFTISRDNAK	TLSCRASQSVSNYLAWYQQ
				AVSGFTFSSYD	LSCRASQSVS	NSLYLQMNSLWDEDTAVYYCAREDIVVVTPILQHWGQG	KSGQAPRLLIYDASNRATG
				MNWVRQAPGKG	NYLAWYQQKS	TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD	IPARFSGSGSGTDFTLTIS
				LEWVSYISSSS	GQAPRLLIYD	YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV	SLEPEDFAVYCCQQRSNWT
				TAKYYADSVKG	ASNRATGIPA	TVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH	FGQGTRLEIKRTVAAPSVF
				RFTISRDNAKN	RFSGSGSGTD	TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV	IFPPSDEQLKSGTASVVCL
				SLYLQMNSLWD	FTLTISSLEP	VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY	LNNFYPREAKVQWKVDNAL
				EDTAVYYCARE	EDFAVYCCQQ	RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK	QSGNSQESVTEQDSKDSTY
				DIVVVTPILQH	RSNWTFGQGT	AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD	SLSSTLTLSKADYEKHKVY
				WGQGTLVTVSS	RLEIK	IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK	ACEVTHQGLSSPVTKSFNR
						SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	GEC
				3261	3262	3263	3264
97	VG9B163	IgG1	Lambda	QVQLVQSGGGL	QLVLTQPPSV	QVQLVQSGGGLVKPGASLKLSCAASGFTFSNHGMSWVR	QLVLTQPPSVSAAPGQKVT
				VKPGASLKLSC	SAAPGQKVTI	QTSDKRLEWVASITRGGDTTYYPDNVKGRFTISRENAK	ISCSGNSSNIGHNYVSWYQ
				AASGFTFSNHG	SCSGNSSNIG	NTLYLQMSSLKSDDTALYYCTRGPLTVGYAMDYWGQGT	QLPGTAPKLLIYDNNQRPS
				MSWVRQTSDKR	HNYVSWYQQL	TVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	GIPDRFSGSKSDTSATLGI
				LEWVASITRGG	PGTAPKLLIY	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	TGLQTGDEADYYCGIWDSS
				DTTYYPDNVKG	DNNQRPSGIP	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	LSIVVFGGGTKVTVLGQPK
				RFTISRENAKN	DRFSGSKSDT	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	AAPSVTLFPPSSEELQANK
				TLYLQMSSLKS	SATLGITGLQ	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	ATLVCLISDFYPGAVTVAW
				DDTALYYCTRG	TGDEADYYCG	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	KADSSPVKAGVETTTPSKQ
				PLTVGYAMDYW	IWDSSLSIVV	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	SNNKYAASSYLSLTPEQWK
				GQGTTVTVSS	FGGGTKVTVL	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	SHRSYSCQVTHEGSTVEKT
						RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VAPTECS
				3295	3296	3297	3298
98	VG9B454	IgG1	Lambda	QVQLQESGPGL	QAVLTQPASV	QVQLQESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QAVLTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3329	3330	3331	3332
99	VG9B439	IgG1	Lambda	QVQLQQSGPGL	QSALTQPASV	QVQLQQSGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QSALTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3363	3364	3365	3366
100	VG9B68	IgG1	Kappa	EVQLVESGAEV	EIVMTQSPLS	EVQLVESGAEVKKPGSSVKVSCKASGGTFSTYAISWVR	EIVMTQSPLSSPVTLGQPA
				KKPGSSVKVSC	SPVTLGQPAS	QAPGQGLEWMGGIIPIFGTATYAQRFQDRVMITADKST	SISCRSSQSLVHSDGNTYL
				KASGGTFSTYA	ISCRSSQSLV	TTAYMELSSLRSEDTAVFYCARGVGWGSDYYYGLDVWG	SWLQQRPGQSPRLLIYKIS
				ISWVRQAPGQG	HSDGNTYLSW	QGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	NRFSGVPDRFSGSGAGTDF
				LEWMGGIIPIF	LQQRPGQSPR	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	TLRITRVEPEDVGVYYCIQ
				GTATYAQRFQD	LLIYKISNRF	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	ATHHPLTFGGGTRLEIKRT
				RVMITADKSTT	SGVPDRFSGS	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	VAAPSVFIFPPSDEQLKSG
				TAYMELSSLRS	GAGTDFTLRI	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	TASVVCLLNNFYPREAKVQ
				EDTAVFYCARG	TRVEPEDVGV	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	WKVDNALQSGNSQESVTEQ
				VGWGSDYYYGL	YYCIQATHHP	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	DSKDSTYSLSSTLTLSKAD
				DVWGQGTMVTV	LTFGGGTRLE	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	YEKHKVYACEVTHQGLSSP
				SS	IK	DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VTKSFNRGEC
				3397	3398	3399	3400
101	VG9B449	IgG1	Lambda	QVQLQESGPGL	QAVLTQPASV	QVQLQESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QAVLTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKVTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKVTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3431	3432	3433	3434
102	VG9B204	IgG1	Lambda	QVQLQESGPGL	SSELTQPPSV	QVQLQESGPGLVKPSETLSLTCTVSYGSFSSFYWSWIR	SSELTQPPSVSVSPGQTAS
				VKPSETLSLTC	SVSPGQTASI	QPAGKGLEWIGRIYTSGGTIYNPSLKSRVTMSVDTSKN	ITCSGDKLGDKYACWYQQK
				TVSYGSFSSFY	TCSGDKLGDK	QFSLKLSSVTAADTAVYYCARWLRAFDYWGQGTLVTVS	PGQSPVLVIYQDSKRPSGI
				WSWIRQPAGKG	YACWYQQKPG	SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV	PERFSGSNSGNTATLTISG
				LEWIGRIYTSG	QSPVLVIYQD	TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS	TQAMDEADYYCQAWDSSTV
				GTIYNPSLKSR	SKRPSGIPER	LGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCP	VFGGGTKLTVLGQPKAAPS
				VTMSVDTSKNQ	FSGSNSGNTA	APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH	VTLFPPSSEELQANKATLV
				FSLKLSSVTAA	TLTISGTQAM	EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL	CLISDFYPGAVTVAWKADS
				DTAVYYCARWL	DEADYYCQAW	TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR	SPVKAGVETTTPSKQSNNK
				RAFDYWGQGTL	DSSTVVFGGG	EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWE	YAASSYLSLTPEQWKSHRS
				VTVSS	TKLTVL	SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG	YSCQVTHEGSTVEKTVAPT
						NVFSCSVMHEALHNHYTQKSLSLSPGK	ECS
				3465	3466	3467	3468
103	VG9B459	IgG1	Lambda	QVQLQESGPGL	QPVLTQPASV	QVQLQESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QPVLTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3499	3500	3501	3502
104	VG9B157	IgG1	Lambda	EVQLLESGGGL	SSELTQDPAV	EVQLLESGGGLVKPGASLKLSCAASGFTFSNHGMSWVR	SSELTQDPAVSVALGQTVR
				VKPGASLKLSC	SVALGQTVRI	QTSDKRLEWVASITRGGDTTYYPDNVKGRFTISRENAK	ITCQGDSLRSYYATWYQQK
				AASGFTFSNHG	TCQGDSLRSY	NTLYLQMSSLKSDDTALYYCTRGPLTVGYAMDYWGQGT	PGQAPILVIYGENNRPSGI
				MSWVRQTSDKR	YATWYQQKPG	TVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	PDRFSGSRSGNTASLTITG
				LEWVASITRGG	QAPILVIYGE	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	AQAEDEADYYCNSRDTGDH
				DTTYYPDNVKG	NNRPSGIPDR	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	HLVFGGGTKLTVLGQPKAA
				RFTISRENAKN	FSGSRSGNTA	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	PSVTLFPPSSEELQANKAT
				TLYLQMSSLKS	SLTITGAQAE	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	LVCLISDFYPGAVTVAWKA
				DDTALYYCTRG	DEADYYCNSR	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	DSSPVKAGVETTTPSKQSN
				PLTVGYAMDYW	DTGDHHLVFG	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	NKYAASSYLSLTPEQWKSH
				GQGTTVTVSS	GGTKLTVL	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	RSYSCQVTHEGSTVEKTVA
						RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	PTECS
				3533	3534	3535	3536
105	VG9B453	IgG1	Lambda	QVQLQQSGPGL	QSALTQPASV	QVQLQQSGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QSALTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKVTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKVTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3567	3568	3569	3570
106	VG9B443	IgG1	Lambda	QVQLQESGPGL	QSALTQPASV	QVQLQESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QSALTQPASVSGSPGQSIT
				TVSGGSISNYY	SCTGTSSDVG	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				WSWIRQPAGKG	GYNYVSWYQQ	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				LGWIGRIYSSG	HPGKAPKLMI	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				ITNYNPSLKSR	YEVSNRPSGV	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				VTMSVDTSKNQ	SNRFSGSKSG	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				LSLKLSSVTAA	NTASLTISGL	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				DTAVYYCAGIV	QAEDEADYYC	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				GVKGAFAIWGQ	SSYTSTSVVF	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GTMVTVSS	GGGTKLTVL	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
						EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3601	3602	3603	3604
107	VG9B455	IgG1	Lambda	QVQLVESGPGL	SYELTQPASV	QVQLVESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	SYELTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3635	3636	3637	3638
108	VG9B466	IgG1	Lambda	QVQLVQSGPGL	SYELTQPASV	QVQLVQSGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	SYELTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3669	3670	3671	3672
109	VG9B450	IgG1	Lambda	EVQLQESGPGL	QSVLTQPASV	EVQLQESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QSVLTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3703	3704	3705	3706
110	VG9B438	IgG1	Lambda	EVQLVESGPGL	SYELTQPASV	EVQLVESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	SYELTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3737	3738	3739	3740
111	VG9B464	IgG1	Lambda	EVQLVQSGPGL	QSALTQPASV	EVQLVQSGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QSALTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTTV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTTVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3771	3772	3773	3774
112	VG9B437	IgG1	Lambda	EVQLQESGPGL	QSALTQPASV	EVQLQESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QSALTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3805	3806	3807	3808
113	VG9B457	IgG1	Lambda	EVQLVESGPGL	QAVLTQPASV	EVQLVESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QAVLTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3839	3840	3841	3842
114	VG9B442	IgG1	Lambda	QVQLVESGPGL	QSALTQPASV	QVQLVESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QSALTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKVTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKVTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3873	3874	3875	3876
115	VG9B436	IgG1	Lambda	EVQLVESGPGL	QSVLTQPASV	EVQLVESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QSVLTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3907	3908	3909	3910
116	VG9B434	IgG1	Lambda	QVQLQESGPGL	QSVLTQPASV	QVQLQESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QSVLTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3941	3942	3943	3944
117	VG9B460	IgG1	Lambda	EVQLVESGPGL	QLVLTQPASV	EVQLVESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QLVLTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				3975	3976	3977	3978
118	VG9B189	IgG1	Lambda	EVQLVQSGGGL	QSVVTQPPSA	EVQLVQSGGGLVKPGASLKLSCAASGFTFSNHGMSWVR	QSVVTQPPSASGSPGQSVT
				VKPGASLKLSC	SGSPGQSVTI	QTSDKRLEWVASITRGGDTTYYPDNVKGRFTISRENAK	ISCTGTSSDVGGYNYVSWY
				AASGFTFSNHG	SCTGTSSDVG	NTLYLQMSSLKSDDTALYYCTRGPLTVGYAMDYWGQGT	QQHPGKAPKLMIYEVSKRP
				MSWVRQTSDKR	GYNYVSWYQQ	TVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	SGVPDRFSGSKSGNTASLT
				LEWVASITRGG	HPGKAPKLMI	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	VSGLQAEDEADYYCNSYAG
				DTTYYPDNVKG	YEVSKRPSGV	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	SNNFEVFGGGTKVTVLGQP
				RFTISRENAKN	PDRFSGSKSG	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	KAAPSVTLFPPSSEELQAN
				TLYLQMSSLKS	NTASLTVSGL	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	KATLVCLISDFYPGAVTVA
				DDTALYYCTRG	QAEDEADYYC	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	WKADSSPVKAGVETTTPSK
				PLTVGYAMDYW	NSYAGSNNFE	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	QSNNKYAASSYLSLTPEQW
				GQGTTVTVSS	VFGGGTKVTV	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	KSHRSYSCQVTHEGSTVEK
					L	RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	TVAPTECS
				4009	4010	4011	4012
119	VG9B452	IgG1	Lambda	QVQLVESGPGL	QSALTQPASV	VQLVESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	QSALTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				4043	4044	4045	4046
120	VG9B53	IgG1	Kappa	QVQLQESGPGL	DIQMTQSPLS	QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIR	DIQMTQSPLSLPVTPGEPA
				VKPSETLSLTC	LPVTPGEPAS	QPAGKGLEWIGRIHTIGSINYNPSLKSRVTMSVDTSKN	SISCRSSQSLLHSNGYNYL
				TVSGGSISSYY	ISCRSSQSLL	QFSLKLSSVTAADTAVYYCAMEGVGATNYYYGMAVWGR	DWYLQKPGQSPQLLIYLGS
				WSWIRQPAGKG	HSNGYNYLDW	GTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK	NRASGVPDRFSGSGSGTDF
				LEWIGRIHTIG	YLQKPGQSPQ	DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV	TLKISRVEAEDVGVYYCMQ
				SINYNPSLKSR	LLIYLGSNRA	VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT	ALQTPYTFGQGTKVEIKRT
				VTMSVDTSKNQ	SGVPDRFSGS	HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC	VAAPSVFIFPPSDEQLKSG
				FSLKLSSVTAA	GSGTDFTLKI	VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST	TASVVCLLNNFYPREAKVQ
				DTAVYYCAMEG	SRVEAEDVGV	YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS	WKVDNALQSGNSQESVTEQ
				VGATNYYYGMA	YYCMQALQTP	KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS	DSKDSTYSLSSTLTLSKAD
				VWGRGTMVTVS	YTFGQGTKVE	DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD	YEKHKVYACEVTHQGLSSP
				S	IK	KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VTKSFNRGEC
				4077	4078	4079	4080
121	VG9B41	IgG1	Kappa	QVQLQESGPQL	EIVLTQTPLS	QVQLQESGPQLVRPGASVKISCKASGYSFTTYWMHWVK	EIVLTQTPLSSPVTLGQPA
				VRPGASVKISC	SPVTLGQPAS	QRPGQGLEWIGLIDPSDSETRLNQKFKDKATLTVDKSS	SISCRSSQSLVHSDGNTYL
				KASGYSFTTYW	ISCRSSQSLV	STAYMRLSSPTSEDSAVYYCASNRWLLGWGQGTMVTVS	SWLHQRPGQPPRLLIYKIS
				MHWVKQRPGQG	HSDGNTYLSW	SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV	NRFSGVPDRFSGSGAGTDF
				LEWIGLIDPSD	LHQRPGQPPR	TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS	TLKISRVETEDVGVYYCVQ
				SETRLNQKFKD	LLIYKISNRF	LGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCP	TREFPLTFGGGTKVEIKRT
				KATLTVDKSSS	SGVPDRFSGS	APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH	VAAPSVFIFPPSDEQLKSG
				TAYMRLSSPTS	GAGTDFTLKI	EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL	TASVVCLLNNFYPREAKVQ
				EDSAVYYCASN	SRVETEDVGV	TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR	WKVDNALQSGNSQESVTEQ
				RWLLGWGQGTM	YYCVQTREFP	EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWE	DSKDSTYSLSSTLTLSKAD
				VTVSS	LTFGGGTKVE	SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG	YEKHKVYACEVTHQGLSSP
					IK	NVFSCSVMHEALHNHYTQKSLSLSPGK	VTKSFNRGEC
				4111	4112	4113	4114
122	VG9B136	IgG1	Kappa	QVQLQQSGPGL	DIVMTQSPSF	QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNRAAWNW	DIVMTQSPSFLSTFVGDRV
				VKPSQTLSLTC	LSTFVGDRVT	IRQSPSKGLEWLGRTYYRSKWYNEYAASVKSRMSINPD	TITCRASQGISSYLAWYQQ
				AISGDSVSSNR	ITCRASQGIS	TSKNQFSLQLNSVTPEDTALYYCARDLWELREACDIWG	KPGKVPKLLIYVASTLQSG
				AAWNWIRQSPS	SYLAWYQQKP	QGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	VPSRFSGSGSGTEFTLTIS
				KGLEWLGRTYY	GKVPKLLIYV	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	SLQPEDFATYYCQQLNSYP
				RSKWYNEYAAS	ASTLQSGVPS	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	FTFGPGTKVDIKRTVAAPS
				VKSRMSINPDT	RFSGSGSGTE	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	VFIFPPSDEQLKSGTASVV
				SKNQFSLQLNS	FTLTISSLQP	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	CLLNNFYPREAKVQWKVDN
				VTPEDTALYYC	EDFATYYCQQ	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	ALQSGNSQESVTEQDSKDS
				ARDLWELREAC	LNSYPFTFGP	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	TYSLSSTLTLSKADYEKHK
				DIWGQGTMVTV	GTKVDIK	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	VYACEVTHQGLSSPVTKSF
				SS		DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				4145	4146	4147	4148
123	VG9B399	IgG1	Kappa	EVQLVESGGGL	ETTLTQSPGT	EVQLVESGGGLVKPGGSLRLSCSASGFTFSNYDMNWVR	ETTLTQSPGTLSLSPGDRA
				VKPGGSLRLSC	LSLSPGDRAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVASSYLAWYQ
				SASGFTFSNYD	LSCRASQSVA	NSLYLQMNSLRAEDTAVYHCARDVGVTTDYYYYGMDVW	QKPGQSPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	GQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQSPRLLIY	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	PPYTFGQGTKVDIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	VVCLLNNFYPREAKVQWKV
				EDTAVYHCARD	PEDFAVYYCQ	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	DNALQSGNSQESVTEQDSK
				VGVTTDYYYYG	QYGSSPPYTF	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSTYSLSSTLTLSKADYEK
				MDVWGQGTMVT	GQGTKVDIK	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	HKVYACEVTHQGLSSPVTK
				VSS		VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				4179	4180	4181	4182
124	VG9B369	IgG1	Kappa	EVQLLESGPTL	DIVMTQSPSS	EVQLLESGPTLVKPTQTLTLTCTFSGFSLSTIGVGVGW	DIVMTQSPSSLSASVGDRV
				VKPTQTLTLTC	LSASVGDRVT	IRQPPGKALEWLSLIYWNDDKRYNPSLKSRLTITKDTS	TITCQASQDISHYLNWYQQ
				TFSGFSLSTIG	ITCQASQDIS	KNQVVLTMTNMDPVDTATYYCAHSHDWVHAFDIWGQGT	KPGKAPKFLIYDASNLDTG
				VGVGWIRQPPG	HYLNWYQQKP	MVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY	VPSRFSGSGSGTDFTFTIS
				KALEWLSLIYW	GKAPKFLIYD	FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT	SLQPEDIATYYCQQYDNFP
				NDDKRYNPSLK	ASNLDTGVPS	VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT	LTFGGGTKVEIKRTVAAPS
				SRLTITKDTSK	RFSGSGSGTD	CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV	VFIFPPSDEQLKSGTASVV
				NQVVLTMTNMD	FTFTISSLQP	VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR	CLLNNFYPREAKVQWKVDN
				PVDTATYYCAH	EDIATYYCQQ	VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA	ALQSGNSQESVTEQDSKDS
				SHDWVHAFDIW	YDNFPLTFGG	KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI	TYSLSSTLTLSKADYEKHK
				GQGTMVTVSS	GTKVEIK	AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS	VYACEVTHQGLSSPVTKSF
						RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				4213	4214	4215	4216
125	VG9B144	IgG1	Lambda	QVQLVQSGAEV	SSELTQDPAV	QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWMR	SSELTQDPAVSVALGQTVR
				KKPGASVKVSC	SVALGQTVRI	QAPGQGLEWMGWINPNSGATNKEQKFQGRVTMTRDTSI	ITCQGDNLRNYYATWFQQK
				KASGYTFTGYY	TCQGDNLRNY	STAYMELSRLRSDDTAVYYCAREDDAFDVWGQGTMVTV	PGQAPVLVFFGKNNRPSGI
				MHWMRQAPGQG	YATWFQQKPG	SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP	PDRFSGSSSGDTASLTITG
				LEWMGWINPNS	QAPVLVFFGK	VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS	AQAEDEADYYCNSRDSSGN
				GATNKEQKFQG	NNRPSGIPDR	SLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPC	HVVFGGGTKLTVLGQPKAA
				RVTMTRDTSIS	FSGSSSGDTA	PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS	PSVTLFPPSSEELQANKAT
				TAYMELSRLRS	SLTITGAQAE	HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV	LVCLISDFYPGAVTVAWKA
				DDTAVYYCARE	DEADYYCNSR	LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP	DSSPVKAGVETTTPSKQSN
				DDAFDVWGQGT	DSSGNHVVFG	REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW	NKYAASSYLSLTPEQWKSH
				MVTVSS	GGTKLTVL	ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ	RSYSCQVTHEGSTVEKTVA
						GNVFSCSVMHEALHNHYTQKSLSLSPGK	PTECS
				4247	4248	4249	4250
126	VG9B410	IgG1	Kappa	EVQLVESGGGL	DIQMTQSPSS	EVQLVESGGGLVKPGGSLRLSCAASGFTFSNYGMNWVR	DIQMTQSPSSVSASVGDRV
				VKPGGSLRLSC	VSASVGDRVT	QAPGKGLEWVSYISSGSSYKYYADSMKGRFTISRDNAM	TITCRASQGINSWLAWYQQ
				AASGFTFSNYG	ITCRASQGIN	NLLYLQMNSLRPEDSAMYYCARDPVVTEYYYYGMDVWG	KPGNAPKLLIYAASSLQSG
				MNWVRQAPGKG	SWLAWYQQKP	QGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	VPSRFSGIGSGTDFIFTIS
				LEWVSYISSGS	GNAPKLLIYA	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	SLQPEDFASYYCQQANSFP
				SYKYYADSMKG	ASSLQSGVPS	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	WTFGQGTKVEIKRTVAAPS
				RFTISRDNAMN	RFSGIGSGTD	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	VFIFPPSDEQLKSGTASVV
				LLYLQMNSLRP	FIFTISSLQP	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	CLLNNFYPREAKVQWKVDN
				EDSAMYYCARD	EDFASYYCQQ	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	ALQSGNSQESVTEQDSKDS
				PVVTEYYYYGM	ANSFPWTFGQ	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	TYSLSSTLTLSKADYEKHK
				DVWGQGTTVTV	GTKVEIK	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	VYACEVTHQGLSSPVTKSF
				SS		DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				4281	4282	4283	4284
127	VG9B386	IgG1	Kappa	EVQLVESGGGL	EIVMTQSPGT	EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMIWVR	EIVMTQSPGTLSLSPGERA
				VKPGGSLRLSC	LSLSPGERAT	QAPGKGLEWVSSIGSSSTYIYYADSVRGRFTISRDNAK	TLSCRASQSISRSYLAWYQ
				AASGFTFSSYS	LSCRASQSIS	TSLYLQMNSLRAEDTAMYFCARDGETGGFDYWGQGILV	QKPGQPPRLLIYGPSNRAT
				MIWVRQAPGKG	RSYLAWYQQK	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	GIPDRFSASGSGTDFTLTN
				LEWVSSIGSSS	PGQPPRLLIY	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	SRLEPEDFAVYYCQQYGSL
				TYIYYADSVRG	GPSNRATGIP	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	PLTFGGGTKVEIKRTVAAP
				RFTISRDNAKT	DRFSASGSGT	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	SVFIFPPSDEQLKSGTASV
				SLYLQMNSLRA	DFTLTNSRLE	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	VCLLNNFYPREAKVQWKVD
				EDTAMYFCARD	PEDFAVYYCQ	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	NALQSGNSQESVTEQDSKD
				GETGGFDYWGQ	QYGSLPLTFG	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	STYSLSSTLTLSKADYEKH
				GILVTVSS	GGTKVEIK	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	KVYACEVTHQGLSSPVTKS
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	FNRGEC
				4315	4316	4317	4318
128	VG9B125	IgG1	Kappa	EVQLVESGGTL	EIVMTQSPAT	EVQLVESGGTLVQPGGSLRLSCAVSGFTFSSYDMNWVR	EIVMTQSPATLSLSPGERA
				VQPGGSLRLSC	LSLSPGERAI	QAPGKGLEWVSYISSSSTAKYYADSVKGRFTISRDNAK	ILSCRASQSVSKDLAWYQQ
				AVSGFTFSSYD	LSCRASQSVS	NSLYLQMNSLWDEDTAVYYCAREDIVVVTPILQHWGQG	KPGQAPRLLIYDASNRATG
				MNWVRQAPGKG	KDLAWYQQKP	TTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD	IPARISGSGSGTDFTLTIS
				LEWVSYISSSS	GQAPRLLIYD	YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSW	SLEPEDFAVYYCQQRINWP
				TAKYYADSVKG	ASNRATGIPA	TVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH	LFTFGPGTKVEIKRTVAAP
				RFTISRDNAKN	RISGSGSGTD	TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV	SVFIFPPSDEQLKSGTASV
				SLYLQMNSLWD	FTLTISSLEP	VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY	VCLLNNFYPREAKVQWKVD
				EDTAVYYCARE	EDFAVYYCQQ	RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK	NALQSGNSQESVTEQDSKD
				DIVVVTPILQH	RINWPLFTFG	AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD	STYSLSSTLTLSKADYEKH
				WGQGTTVTVSS	PGTKVEIK	IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK	KVYACEVTHQGLSSPVTKS
						SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	FNRGEC
				4349	4350	4351	4352
129	VG9B112	IgG1	Kappa	QVQLQQSGPGL	DIQMTQSPSF	QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNW	DIQMTQSPSFLSASVGDRV
				VKPSQTLSLTC	LSASVGDRVI	IRQSPSRGLEWLGGTYYRSKWFNNYAVSVKSRITINPD	IITCRASQGIHSYLAWYQQ
				AISGDSVSSNS	ITCRASQGIH	TSTNQFSLQLNSVTPADTAVYYCARGEWGLRDAFDIWG	KPGKVPKLLIYVASTLQSG
				AAWNWIRQSPS	SYLAWYQQKP	QGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	VPSRFSGSGSGTEFTLTIS
				RGLEWLGGTYY	GKVPKLLIYV	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	SLQPEDFATYYCQQLNSYP
				RSKWFNNYAVS	ASTLQSGVPS	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	WTFGQGTKLEIKRTVAAPS
				VKSRITINPDT	RFSGSGSGTE	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	VFIFPPSDEQLKSGTASVV
				STNQFSLQLNS	FTLTISSLQP	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	CLLNNFYPREAKVQWKVDN
				VTPADTAVYYC	EDFATYYCQQ	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	ALQSGNSQESVTEQDSKDS
				ARGEWGLRDAF	LNSYPWTFGQ	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	TYSLSSTLTLSKADYEKHK
				DIWGQGTMVTV	GTKLEIK	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	VYACEVTHQGLSSPVTKSF
				SS		DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	NRGEC
				4383	4384	4385	4386
130	VG9B371	IgG1	Kappa	EVQLLESGGGL	EIVMTQSPGT	EVQLLESGGGLVKPGGSLRLSCAASRFTLSSYDMNWVR	EIVMTQSPGTLSLSPGERA
				VKPGGSLRLSC	LSLSPGERAT	QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAK	TLSCRASQSVSSSYLAWYQ
				AASRFTLSSYD	LSCRASQSVS	NSLYLQMNSLRAEDTAVYYCARDRGVGGTDYYYYGLDV	QKPGQAPRLLIYGASSRAT
				MNWVRQAPGKG	SSYLAWYQQK	WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC	GIPDRFSGSGSGTDFTLTI
				LEWVSSISSSS	PGQAPRLLIY	LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL	SRLEPEDFAVYYCQQYGSS
				SYIYYADSVKG	GASSRATGIP	SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC	PPYTFGQGTKVEIKRTVAA
				RFTISRDNAKN	DRFSGSGSGT	DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE	PSVFIFPPSDEQLKSGTAS
				SLYLQMNSLRA	DFTLTISRLE	VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY	VVCLLNNFYPREAKVQWKV
				EDTAVYYCARD	PEDFAVYYCQ	NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK	DNALQSGNSQESVTEQDSK
				RGVGGTDYYYY	QYGSSPPYTF	TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF	DSTYSLSSTLTLSKADYEK
				GLDVWGQGTTV	GQGTKVEIK	YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL	HKVYACEVTHQGLSSPVTK
				TVSS		TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	SFNRGEC
				4417	4418	4419	4420
131	VG9B387	IgG1	Lambda	EVQLVESGAEV	SYELTQDPAV	EVQLVESGAEVKKPGASVKVSCKASGFTFTGYYLQWVR	SYELTQDPAVSVALGQTVR
				KKPGASVKVSC	SVALGQTVRI	QAPGQGLEWMGWINPNSGYTDYAQRFQDRVTMTRDTSI	ITCQGDSLRNYYAIWYQQK
				KASGFTFTGYY	TCQGDSLRNY	NTAYMELSRLRSDDTAVYYCARLDDAFDVWGQGTMVTV	PGQAPVLVIFGKNNRPSGI
				LQWVRQAPGQG	YAIWYQQKPG	SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP	PDRFSGSSSGTTASLTITG
				LEWMGWINPNS	QAPVLVIFGK	VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS	TQAEDEADYYCNSRDSSGN
				GYTDYAQRFQD	NNRPSGIPDR	SLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPC	HWVFGGGTKLTVLGQPKAA
				RVTMTRDTSIN	FSGSSSGTTA	PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS	PSVTLFPPSSEELQANKAT
				TAYMELSRLRS	SLTITGTQAE	HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV	LVCLISDFYPGAVTVAWKA
				DDTAVYYCARL	DEADYYCNSR	LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP	DSSPVKAGVETTTPSKQSN
				DDAFDVWGQGT	DSSGNHWVFG	REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW	NKYAASSYLSLTPEQWKSH
				MVTVSS	GGTKLTVL	ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ	RSYSCQVTHEGSTVEKTVA
						GNVFSCSVMHEALHNHYTQKSLSLSPGK	PTECS
				4451	4452	4453	4454
132	VG9B47	IgG1	Kappa	QVQLVQSGAEV	DIVMTQSPLS	QVQLVQSGAEVKKPGSSVKVSCKASGGSFSNYAISWMR	DIVMTQSPLSSPVDLGQPA
				KKPGSSVKVSC	SPVDLGQPAS	QAPGQGLEWMGGIIPFFGTPDYAQKFQGRVTITADKST	SISCRSSQSLVHSDGNTYL
				KASGGSFSNYA	ISCRSSQSLV	STAYMELSSLRSEDTAVYYCSTGGGYGDYDYYYGINVW	SWLQQRPGQPPRLLIYKIS
				ISWMRQAPGQG	HSDGNTYLSW	GQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL	NRFSGVPDRFSGSGAGTDF
				LEWMGGIIPFF	LQQRPGQPPR	VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS	TLKISRVEAEDVGVYYCMQ
				GTPDYAQKFQG	LLIYKISNRF	SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD	AKEFPLTLGGGTKVDIKRT
				RVTITADKSTS	SGVPDRFSGS	KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV	VAAPSVFIFPPSDEQLKSG
				TAYMELSSLRS	GAGTDFTLKI	TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN	TASVVCLLNNFYPREAKVQ
				EDTAVYYCSTG	SRVEAEDVGV	STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT	WKVDNALQSGNSQESVTEQ
				GGYGDYDYYYG	YYCMQAKEFP	ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY	DSKDSTYSLSSTLTLSKAD
				INVWGQGTMVT	LTLGGGTKVD	PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT	YEKHKVYACEVTHQGLSSP
				VSS	IK	VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VTKSFNRGEC
				4485	4486	4487	4488
133	VG9B379	IgG1	Lambda	EVQLVQSGPEV	SSELTQDPAV	EVQLVQSGPEVKKPGASVKVSCKASGYTFTGDYIHWVR	SSELTQDPAVSVALGQTVR
				KKPGASVKVSC	SVALGQTVRI	QVPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSI	ITCQGDSLRSYYARWYQQK
				KASGYTFTGDY	TCQGDSLRSY	STAFMELSRLRSDDTAVYYCAREGGVAPAAPDAFDIWG	PGQAPVVVIYGKNNRPSGI
				IHWVRQVPGQG	YARWYQQKPG	QGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	PDRFSGSSSGNTASLTITG
				LEWMGWINPNS	QAPVVVIYGK	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	AQAEDEADYYCNSRDSSGN
				GGTNYAQKFQG	NNRPSGIPDR	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	HRVFGGGTKLTVLGQPKAA
				RVTMTRDTSIS	FSGSSSGNTA	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	PSVTLFPPSSEELQANKAT
				TAFMELSRLRS	SLTITGAQAE	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	LVCLISDFYPGAVTVAWKA
				DDTAVYYCARE	DEADYYCNSR	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	DSSPVKAGVETTTPSKQSN
				GGVAPAAPDAF	DSSGNHRVFG	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	NKYAASSYLSLTPEQWKSH
				DIWGQGTMVTV	GGTKLTVL	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	RSYSCQVTHEGSTVEKTVA
				SS		DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	PTECS
				4519	4520	4521	4522
134	VG9B447	IgG1	Lambda	QVQLQESGPGL	SYELTQPASV	QVQLQESGPGLVKPSETLSLTCTVSGGSISNYYWSWIR	SYELTQPASVSGSPGQSIT
				VKPSETLSLTC	SGSPGQSITI	QPAGKGLGWIGRIYSSGITNYNPSLKSRVTMSVDTSKN	ISCTGTSSDVGGYNYVSWY
				TVSGGSISNYY	SCTGTSSDVG	QLSLKLSSVTAADTAVYYCAGIVGVKGAFAIWGQGTMV	QQHPGKAPKLMIYEVSNRP
				WSWIRQPAGKG	GYNYVSWYQQ	TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP	SGVSNRFSGSKSGNTASLT
				LGWIGRIYSSG	HPGKAPKLMI	EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP	ISGLQAEDEADYYCSSYTS
				ITNYNPSLKSR	YEVSNRPSGV	SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP	TSVVFGGGTKLTVLGQPKA
				VTMSVDTSKNQ	SNRFSGSKSG	PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD	APSVTLFPPSSEELQANKA
				LSLKLSSVTAA	NTASLTISGL	VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV	TLVCLISDFYPGAVTVAWK
				DTAVYYCAGIV	QAEDEADYYC	SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG	ADSSPVKAGVETTTPSKQS
				GVKGAFAIWGQ	SSYTSTSVVF	QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV	NNKYAASSYLSLTPEQWKS
				GTMVTVSS	GGGTKLTVL	EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW	HRSYSCQVTHEGSTVEKTV
						QQGNVFSCSVMHEALHNHYTQKSLSLSPGK	APTECS
				4553	4554	4555	4556
135	VG9B392	IgG1	Lambda	QVQLVQSGAEV	SSELTQDPAV	QVQLVQSGAEVKRPGASAKVSCKTSGYTFTGYYIHWVR	SSELTQDPAVSVALGQTVR
				KRPGASAKVSC	SVALGQTVRI	QAPGQGLEWMGWINPNSGYTNSAQKFQGRVSMTRDTSI	ITCQGDSLRSYYARWYQQK
				KTSGYTFTGYY	TCQGDSLRSY	STVYMELSRLRSDDTAVYYCAREDDAFDIWGQGTLVTV	PGQAPVLVIYGKNNRPSGI
				IHWVRQAPGQG	YARWYQQKPG	SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP	PDRFSGSSSGDTASLTITG
				LEWMGWINPNS	QAPVLVIYGK	VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS	ALAEDEADYYCNSRDNSGN
				GYTNSAQKFQG	NNRPSGIPDR	SLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPC	HVVFGGGTKVTVLGQPKAA
				RVSMTRDTSIS	FSGSSSGDTA	PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS	PSVTLFPPSSEELQANKAT
				TVYMELSRLRS	SLTITGALAE	HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV	LVCLISDFYPGAVTVAWKA
				DDTAVYYCARE	DEADYYCNSR	LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP	DSSPVKAGVETTTPSKQSN
				DDAFDIWGQGT	DNSGNHVVFG	REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW	NKYAASSYLSLTPEQWKSH
				LVTVSS	GGTKVTVL	ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ	RSYSCQVTHEGSTVEKTVA
						GNVFSCSVMHEALHNHYTQKSLSLSPGK	PTECS
				4587	4588	4589	4590
136	VG9B96	IgG1	Kappa	EVQLVQSGAEV	DIVMTQSPLS	EVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYAISWVR	DIVMTQSPLSSHVTLGQPA
				KKPGSSVKVSC	SHVTLGQPAS	LAPGQGLEWMGGIIPIFSAGTYAQRFQGRVTITADKST	SISCRSSQSLVHSDGNTYL
				KASGGTFSNYA	ISCRSSQSLV	STAYMELNSLRSEDTAVYYCSSNSGTYYDYYYGMDVWG	SWLQQRPGQPPRLLIYKIF
				ISWVRLAPGQG	HSDGNTYLSW	QGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV	NRLSGVPDRFSGSGAGTDF
				LEWMGGIIPIF	LQQRPGQPPR	KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS	TLKISRVEAEDVGVYYCMQ
				SAGTYAQRFQG	LLIYKIFNRL	VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK	AKQFPLTFGGGTKVEIKRT
				RVTITADKSTS	SGVPDRFSGS	THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT	VAAPSVFIFPPSDEQLKSG
				TAYMELNSLRS	GAGTDFTLKI	CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS	TASVVCLLNNFYPREAKVQ
				EDTAVYYCSSN	SRVEAEDVGV	TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI	WKVDNALQSGNSQESVTEQ
				SGTYYDYYYGM	YYCMQAKQFP	SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP	DSKDSTYSLSSTLTLSKAD
				DVWGQGTMVTV	LTFGGGTKVE	SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV	YEKHKVYACEVTHQGLSSP
				SS	IK	DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VTKSFNRGEC
				4621	4622	4623	4624
137	VG9B77	IgG1	Kappa	EVQLVESGAEV	EIVMTQSPLF	EVQLVESGAEVMKPGSSVKVSCKASGGTFSSYAISWVR	EIVMTQSPLFSPVTLGQPA
				MKPGSSVKVSC	SPVTLGQPAS	QAPEQGLEWMGGIIPFFGTADYAQKFQGRVTITADKST	SISCRSSQSLVHSDGNTYL
				KASGGTFSSYA	ISCRSSQSLV	NTAYMELTSLRSEDTAVYYCATATVTTDYYYGMDVWGQ	SWLQQRPGQPPRLLIYEIS
				ISWVRQAPEQG	HSDGNTYLSW	GTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK	NRFTGVPDRFSGSGAGTDF
				LEWMGGIIPFF	LQQRPGQPPR	DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV	TLKISRVEAEDVGVYYCMQ
				GTADYAQKFQG	LLIYEISNRF	VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT	ARQFPLTFGGGTKVEIKRT
				RVTITADKSTN	TGVPDRFSGS	HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC	VAAPSVFIFPPSDEQLKSG
				TAYMELTSLRS	GAGTDFTLKI	VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST	TASVVCLLNNFYPREAKVQ
				EDTAVYYCATA	SRVEAEDVGV	YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS	WKVDNALQSGNSQESVTEQ
				TVTTDYYYGMD	YYCMQARQFP	KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS	DSKDSTYSLSSTLTLSKAD
				VWGQGTMVTVS	LTFGGGTKVE	DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD	YEKHKVYACEVTHQGLSSP
				S	IK	KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK	VTKSFNRGEC
				4655	4656	4657	4658

TABLE 3
Kabat CDR Amino Acid Sequences
	Protein	HC Kabat				LC Kabat	LC Kabat
#	Name	CDR1	HC Kabat CDR2	HC Kabat CDR3	LC Kabat CDR1	CDR2	CDR3
1	VG9B54	SYSLT	SISSSSSYIFYADSVKG	DGELGPFDY	RASQSVSSSYLA	GASSRAT	QQYGRSPLT
		1	2	3	4	5	6
2	VG9B121	DYAMD	SISSTSNYIFYADSVKG	SYNWNYGGAFDI	RASQSVSSSYFA	GASSRAT	QQYGRSPLT
		35	36	37	38	39	40
3	VG9B429	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQGINSWLA	AASSLQS	QQANSFPWT
		69	70	71	72	73	74
4	VG9B370	SYDMN	SISSSSSYIYYADSVKG	DRGVGGTDYYYYGLDV	RASQSVSSSYLA	GASSRAT	QQYGSSPPYT
		103	104	105	106	107	108
5	VG9B80	TYSMN	SISSSSSYIFYADSVKG	DGELGVFDY	RASQSISSSYLA	GPSGRAT	QQFGRSPLT
		137	138	139	140	141	142
6	VG9B414	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQGINSWLA	AASSLQS	QQANSFPWT
		171	172	173	174	175	176
7	VG9B195	PYTMN	SISSSSSYMYYADSVKG	DGDLVGPTYYFDY	SGDKLGDKYAC	QHNKRPS	QAWDSTTVV
		205	206	207	208	209	210
8	VG9B140	SYDMN	SISTSSGYIYYADSVKG	DRGIAVAGDYYYGMDV	RASQSVSSSYLA	GASSRAT	QQYGSSPPYT
		239	240	241	242	243	244
9	VG9B426	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		273	274	275	276	277	278
10	VG9B46	INSMN	SISSTSDYIFNADSVKG	DDVFGAFDI	RTSQSVSRSYLG	GSSSRAT	QQYSRSPLT
		307	308	309	310	311	312
11	VG9B416	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		341	342	343	344	345	346
12	VG9B69	SYDIN	SITSSSYYIYYADSVKG	DLGVRGVDYYYYGLDV	RASQSVSSSYLA	GASSRAT	QQYGSSPPYT
		375	376	377	378	379	380
13	VG9B415	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		409	410	411	412	413	414
14	VG9B104	VYSMN	SIGSSSSYIFYADSVKG	DHDYGGLDY	RASQSVSSSYLA	GPSNRAT	QQYGRSPLT
		443	444	445	446	447	448
15	VG9B198	SIYWS	RIYTTDITNYNPSLKS	NGYSYGGFNY	TGSSSNIGAGYDVH	GDSYRPS	QSYDSSLSVVV
		477	478	479	480	481	482
16	VG9B463	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	SGSSSNIGSNTVN	TNTQRPS	AAWDDSLNAWV
		511	512	513	514	515	516
17	VG9B469	HYDMN	SISSSSSYIFYADSVKG	DRGVGDTSDYYSFGLDV	RASQNVSSTYLA	GACSRAT	QQYGSSPPYT
		545	546	547	548	549	550
18	VG9B428	NYGMN	YISSGSSYKYYADSMKG	DPVVTEYYYYGMDV	RASQGINSWLA	AASSLQS	QQANSFPWT
		579	580	581	582	583	584
19	VG9B430	SYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		613	614	615	616	617	618
20	VG9B423	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		647	648	649	650	651	652
21	VG9B98	SYSMY	SIGSSSTYIFYADSVKG	DGELGPFEY	RASQSVSTSYLA	GTSSRAT	LQYGRSPLT
		681	682	683	684	685	686
22	VG9B73	NYDMN	SISSSSSYIYYADSVKG	EIGVTGTTYYQDYGMDV	RASQSFSSNYLA	GASSRAT	QQYGSSPPFT
		715	716	717	718	719	720
23	VG9B133	NYDMN	SISSSSSYIYYADSVKG	DLGITGTTMDYYYGMDV	RASQSVSSSYLA	GASSRAT	QQYGSSPPYT
		749	750	751	752	753	754
24	VG9B368	SYDMN	SISSSSSYIYYADSVKG	DRGIGGDYYSYAMDV	RASQSVSSSYLA	GASSRAT	QQYGSSPPYT
		783	784	785	786	787	788
25	VG9B424	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		817	818	819	820	821	822
26	VG9B427	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		851	852	853	854	855	856
27	VG9B417	NYGMN	YISSGSSYKYYADSMKG	DPVVTEYYYYGMDV	RASQGINSWLA	AASSLQS	QQANSFPWT
		885	886	887	888	889	890
28	VG9B58	SSYWT	YMFYLGSTNYNPSLKS	ERPVLDAFDI	RASQDITNYLA	AASSLQG	LQHDTYPYT
		919	920	921	922	923	924
29	VG9B419	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		953	954	955	956	957	958
30	VG9B425	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		987	988	989	990	991	992
31	VG9B143	TYGMN	YISTSSYTIYYSDSVKG	EGDWWYFDL	TGTSSDVGGYNYVS	EVSNRPS	SSYTSSSTLV
		1021	1022	1023	1024	1025	1026
32	VG9B418	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		1055	1056	1057	1058	1059	1060
33	VG9B472	HYDMN	SISSSSSYIFYADSVKG	DRGVGDTSDYYSFGLDV	RASQGIATYLA	AASTLQS	QKYNSAPPWT
		1089	1090	1091	1092	1093	1094
34	VG9B421	NYGMN	YISSGSSYKYYADSMKG	DPVVTEYYYYGMDV	RASQGINSWLA	AASSLQS	QQANSFPWT
		1123	1124	1125	1126	1127	1128
35	VG9B88	SYTMN	SISTSSSYIDYADSVKG	DGDMVAPIKGSFDY	RSSQSLLNSDDGNTYLD	TLSYRAS	MQRIEFPIT
		1157	1158	1159	1160	1161	1162
36	VG9B384	SSGMCVS	LIDWFDDKYYSTSLKT	IRGTGAYYYGLDV	SGNELGDKYAS	QDNKRPS	QAWDSSKVV
		1191	1192	1193	1194	1195	1196
37	VG9B413	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		1225	1226	1227	1228	1229	1230
38	VG9B36	SYGMY	SISTGSSYIYYADSVKG	DKGLAVTGYIMDV	QASQDISNYLN	DASNLET	QQYDNLPMYT
		1259	1260	1261	1262	1263	1264
39	VG9B403	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		1293	1294	1295	1296	1297	1298
40	VG9B191	RYSMN	SISSSSSYIYYADSVKG	DGPTVNWDYYFDL	SGSSSNIGNNYVS	DNNKRPS	GTWDSSLSTSVV
		1327	1328	1329	1330	1331	1332
41	VG9B44	SNSAAWN	RTYYRSKWYNDYPISVKS	ESGSYYTDGFDI	RASQGISSYLA	AASTLQS	QEFNSYPYT
		1361	1362	1363	1364	1365	1366
42	VG9B67	SYTMN	SISSSSSYIDYAESVKG	DGDILATIRGSFDY	RSSQSLLDSDAGNTYLD	TLSYRAS	MQRIEFPIT
		1395	1396	1397	1398	1399	1400
43	VG9B402	NYGMN	YISSGSSYKYYADSMKG	DPVVTEYYYYGMDV	RASQGINSWLA	AASSLQS	QQANSFPWT
		1429	1430	1431	1432	1433	1434
44	VG9B127	AYTMN	SISSSSSYIDFAESVKG	DGDIVSTIRGSFDY	RSSQSLLDSDDGNTYLD	TLSYRAS	MQRIEFPIT
		1463	1464	1465	1466	1467	1468
45	VG9B137	SYSMD	SIGSSSSYIFYADSVKG	SYSWNYGGAFDI	RASQSVSSSYLA	GASSRAT	QQYGSSPPYT
		1497	1498	1499	1500	1501	1502
46	VG9B33	SYNMN	SISTSSSYIYYADSVKG	DTSVTKYPDTFDI	RASQDINNYLA	GASTLQS	QKYNSAPFT
		1531	1532	1533	1534	1535	1536
47	VG9B162	GDYMH	WINPNSGYTNYAQKFQG	EGDAFDV	TGTSSDVGGYNYVS	EVSKRPS	NSYAGSNNFEV
		1565	1566	1567	1568	1569	1570
48	VG9B152	SYSMI	SISSSSDYIYNADSVKG	DWELLGFDC	SGDKLGDKYAC	QHNKRPS	QAWDSTTVV
		1599	1600	1601	1602	1603	1604
49	VG9B64	ISGVSVG	LIYWNDDKRYSPSLQS	SGQWLEGDAFDI	RSSESLVHSDGNTYLS	KISNRFS	MQATQFPLT
		1633	1634	1635	1636	1637	1638
50	VG9B21	NYDMN	SISSSSHYIYYADSLKG	DRGVTTDYYYYALDV	RASQGIYNYLA	AASTLQS	QKYNRAPFT
		1667	1668	1669	1670	1671	1672
51	VG9B128	TYGMH	VIWYNGSNKYYADSVKG	GGFGESFDS	RASQSVIDYLA	DASNRAT	QQRSNWPLT
		1701	1702	1703	1704	1705	1706
52	VG9B66	TYTMN	SISSSSFYMDYADSVKG	DGDIVATIRGSFDY	RASQDITNFLA	TASTLQS	QKYNSAPFT
		1735	1736	1737	1738	1739	1740
53	VG9B32	RYAMN	FISGTGYTVYYADSVKG	DQEPGFDY	RSGQSLVHSDGNTYLS	KISSNRFS	MQATHFPFT
		1769	1770	1771	1772	1773	1774
54	VG9B57	SHDMN	SISSSSSYIFYADSVKG	DLGVGVRDYYYYGMDV	RASQDCNYLA	AASSLQG	LQHDTYPYT
		1803	1804	1805	1806	1807	1808
55	VG9B135	TYGVGVG	LIYWNDDKRYYPSLNN	DYDFWSGYFDY	RASQSVSSSYLA	GASSRAT	QQYGSSPLT
		1837	1838	1839	1840	1841	1842
56	VG9B60	GYYMH	RINPNSGVTHYAQKFQG	GGSLVRGVISGLDY	RASQSFSGSYLA	GASSRAT	QQYGSSPPYT
		1871	1872	1873	1874	1875	1876
57	VG9B409	SYYMH	IINPSGGSTSYAQKFQG	GSYGWYFDL	RASQSVTSSYLA	GASSRAT	QQYGSSPPYT
		1905	1906	1907	1908	1909	1910
58	VG9B411	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQGINSWLA	AASTLQS	QQYNNWPRT
		1939	1940	1941	1942	1943	1944
59	VG9B129	SYVIS	GILPILSTANYAQKFQG	AHDYYYGMDV	RASQSVSNNYLA	GASSRAT	QQYGSSPPYT
		1973	1974	1975	1976	1977	1978
60	VG9B396	GYYWN	RIFTTGNTNYNPSLKS	EKWDSSSSALYFDF	TGSSSNIGADYDVK	GNTDRPS	QSYDSRLTGYVV
		2007	2008	2009	2010	2011	2012
61	VG9B470	TSGVGVG	LILWNDHTIYSPSLKS	DKWELRDAFDI	RASQGISRYLA	VASTLQS	QQLISYPYT
		2041	2042	2043	2044	2045	2046
62	VG9B111	TYSVN	SISSDSSYIFYADSMKG	DSVTGPFDY	QASQDISHYLN	DSYILET	QQYDNLPYT
		2075	2076	2077	2078	2079	2080
63	VG9B169	NYFWN	YIFYSGSTSYNPSLKS	VGRWELRTAFDI	SGSSSNIGSNTVN	SNNQRPS	AAWDDSLNGPGV
		2109	2110	2111	2112	2113	2114
64	VG9B639	TYRMN	SISSSSIYIHSADSVKG	ERVYTVSFDY	QASQDISHYLN	DSYILET	QQYDNLPYT
		2143	2144	2145	2146	2147	2148
65	VG9B201	THGVGVG	LIYWNADKHYSPSLKS	EGDWGHYFDF	SGSSSNIGNNDVS	DNNRRPS	ETWDSSLSAIWV
		2177	2178	2179	2180	2181	2182
66	VG9B161	SYFWS	YIFYSGSTNYNPSLKS	VGRWELRGAFDI	SGSSSNIGSNTVN	SNNQRPS	AAWDDSLNSPGV
		2211	2212	2213	2214	2215	2216
67	VG9B383	SYYWN	RIYTIGNTNYNPSLKS	EGYYDSSGSFFPGAFGI	TGTSNDVGSYNLVS	AGSKRPS	CSFAGATNVV
		2245	2246	2247	2248	2249	2250
68	VG9B382	GYYWN	RIFTTGNTNYNPSLKS	ERWDSSSSALYFDY	TGSSSNIGADYDIK	GNSNRPS	QSYDSSMSGYVV
		2279	2280	2281	2282	2283	2284
69	VG9B156	GYFWN	YIFYSGSTNYNPSLKS	LGKWELRTAFDI	SGSTSNIGSDTVN	SNNQRPS	AAWDDSLNGPV
		2313	2314	2315	2316	2317	2318
70	VG9B205	GYFWN	YIFYSGSTNYNPSLKS	LGKWELRTAFDI	SGDKLGDKYAC	QDSKRPS	QAWDSSTVV
		2347	2348	2349	2350	2351	2352
71	VG9B86	SSYWS	RFYSSGSTSYNPSLKS	YSGSYWYFDL	RASQSVSSYLA	DTSNRAT	QQRSDWLLT
		2381	2382	2383	2384	2385	2386
72	VG9B154	YYFWN	YIYYSGSTNYNPSLKS	EGKWELRTTFDI	SGSSSNIGSNTVN	SNNQRPS	AAWDDSLNGPV
		2415	2416	2417	2418	2419	2420
73	VG9B159	SYYWS	RFYTGGRNNYNPSFKS	DMEYYYDRSGYSYWYFDL	GGNNIGSKSVH	DDSDRPS	QVWDSSSDHVV
		2449	2450	2451	2452	2453	2454
74	VG9B465	SYYWN	RIYTIGNTNYNPSLKS	EGYYESDGSFFPGAFNI	TGTSNDVGSYNLVS	AGSKRPS	CSYAGTTNVV
		2483	2484	2485	2486	2487	2488
75	VG9B194	GDYMH	WINPNSGYTNNAEKFQG	ELDALDV	TGTSSDVGGYNYVS	EVSKRPS	NSYAGSNNFEV
		2517	2518	2519	2520	2521	2522
76	VG9B182	NHFWS	FVFYNGNTNYNPSLKS	VGRWVLRTAFDI	SGSSSNIGSNTVN	SNNQRPS	AAWDDSLNGPGV
		2551	2552	2553	2554	2555	2556
77	VG9B173	NYFWS	YIYYSGSTNYNPSLKS	EGKWELRSAFDI	SGSSSNIESNTVN	SNNQRPS	TAWDDSLNGPV
		2585	2586	2587	2588	2589	2590
78	VG9B87	SEYIH	IINPSGGSTSYAQRFQG	ERGYSYGSFDY	RASQGISSYLA	AASTLQS	QQFNSYSLT
		2619	2620	2621	2622	2623	2624
79	VG9B208	GYYWS	YIFYSGSINYNPSLKN	VGKWELRSSFDI	SGSTSNIGNNDVS	DNNKRPS	GTWDSSLSVWV
		2653	2654	2655	2656	2657	2658
80	VG9B372	NGGFYWS	YINYSGSTYYNPSLES	DRNYEWNFDL	RASQSVSSYLA	DASNRAT	QQRSNWPLT
		2687	2688	2689	2690	2691	2692
81	VG9B186	NIRMSVS	HIFSNDEKSYNSSLKS	MRLPYGMDV	SGSTSNIGSNTVN	SNNQRPS	AAWDDSLNGPV
		2721	2722	2723	2724	2725	2726
82	VG9B177	NYFWS	YIFYSGSTNYNPSLKS	VGKWELRTAFDI	TGTSSDVADYNYVS	EVSNRPS	CSYTSSFTVV
		2755	2756	2757	2758	2759	2760
83	VG9B114	RYDMH	AIGSAGDTYYPGSVKG	GKWELRDAFDI	RASQGIHSYLA	VASTLQS	QQLNSYPYT
		2789	2790	2791	2792	2793	2794
84	VG9B147	GYFWN	YIFYSGSTNYNPSLKS	EGKWELRSTFDI	QGDSLRSYYAT	GENNRPS	NSRDTGDHHLV
		2823	2824	2825	2826	2827	2828
85	VG9B65	IYAIN	GIIPFFGTANYAQKFQD	GGDSGYDWGFDY	RSSQSLVHSDGNTYLS	QISNRFS	MQATQFPLT
		2857	2858	2859	2860	2861	2862
86	VG9B81	TYYWS	RIYTSDNTNYNPSLKS	YNWNYWYFDL	RASQGISSYLA	TASTLQS	QHLNSYPYT
		2891	2892	2893	2894	2895	2896
87	VG9B203	FTYYWN	RIYTSGSTNYNPSLKS	SGGNFYWYFDL	SGSSSNIGNNYVS	DNNKRPS	GTWDSSLSAGV
		2925	2926	2927	2928	2929	2930
88	VG9B380	NYYWS	RIYPSGITSYDPSLKS	IMGTKGAFDI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		2959	2960	2961	2962	2963	2964
89	VG9B103	SYAIS	GIIPIFGTATYAQKFQD	GVGWGTDYYYGLDV	RSSQGLVHSDGNTYLS	KISNRFS	MQATHHPLT
		2993	2994	2995	2996	2997	2998
90	VG9B462	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3027	3028	3029	3030	3031	3032
91	VG9B461	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3061	3062	3063	3064	3065	3066
92	VG9B106	GYYLH	WINPSSGDTDYAQTFQG	ELGIGVFDY	KSSQSVLYSSNNKNYLG	WASTRES	QQYYSIPYT
		3095	3096	3097	3098	3099	3100
93	VG9B115	TYGVGVG	LIYWNDDKRYNPSLKS	ESDWSYYFDY	RASQSVSSYLA	DASNRAT	QQRSSWPWT
		3129	3130	3131	3132	3133	3134
94	VG9B27	SYVIS	GILPILSTANYAQKFQG	AHDYYYGMDV	RSSQSLVHSDGNTYLS	KISNRFS	MQATHHPLT
		3163	3164	3165	3166	3167	3168
95	VG9B458	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3197	3198	3199	3200	3201	3202
96	VG9B131	SYDMN	YISSSSTAKYYADSVKG	EDIVVVTPILQH	RASQSVSNYLA	DASNRAT	QQRSNWT
		3231	3232	3233	3234	3235	3236
97	VG9B163	NHGMS	SITRGGDTTYYPDNVKG	GPLTVGYAMDY	SGNSSNIGHNYVS	DNNQRPS	GIWDSSLSIVV
		3265	3266	3267	3268	3269	3270
98	VG9B454	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3299	3300	3301	3302	3303	3304
99	VG9B439	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3333	3334	3335	3336	3337	3338
100	VG9B68	TYAIS	GIIPIFGTATYAQRFQD	GVGWGSDYYYGLDV	RSSQSLVHSDGNTYLS	KISNRFS	IQATHHPLT
		3367	3368	3369	3370	3371	3372
101	VG9B449	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3401	3402	3403	3404	3405	3406
102	VG9B204	SFYWS	RIYTSGGTIYNPSLKS	WLRAFDY	SGDKLGDKYAC	QDSKRPS	QAWDSSTVV
		3435	3436	3437	3438	3439	3440
103	VG9B459	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3469	3470	3471	3472	3473	3474
104	VG9B157	NHGMS	SITRGGDTTYYPDNVKG	GPLTVGYAMDY	QGDSLRSYYAT	GENNRPS	NSRDTGDHHLV
		3503	3504	3505	3506	3507	3508
105	VG9B453	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3537	3538	3539	3540	3541	3542
106	VG9B443	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3571	3572	3573	3574	3575	3576
107	VG9B455	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3605	3606	3607	3608	3609	3610
108	VG9B466	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3639	3640	3641	3642	3643	3644
109	VG9B450	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3673	3674	3675	3676	3677	3678
110	VG9B438	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3707	3708	3709	3710	3711	3712
111	VG9B464	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3741	3742	3743	3744	3745	3746
112	VG9B437	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3775	3776	3777	3778	3779	3780
113	VG9B457	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3809	3810	3811	3812	3813	3814
114	VG9B442	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3843	3844	3845	3846	3847	3848
115	VG9B436	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3877	3878	3879	3880	3881	3882
116	VG9B434	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3911	3912	3913	3914	3915	3916
117	VG9B460	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3945	3946	3947	3948	3949	3950
118	VG9B189	NHGMS	SITRGGDTTYYPDNVKG	GPLTVGYAMDY	TGTSSDVGGYNYVS	EVSKRPS	NSYAGSNNFEV
		3979	3980	3981	3982	3983	3984
119	VG9B452	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		4013	4014	4015	4016	4017	4018
120	VG9B53	SYYWS	RIHTIGSINYNPSLKS	EGVGATNYYYGMAV	RSSQSLLHSNGYNYLD	LGSNRAS	MQALQTPYT
		4047	4048	4049	4050	4051	4052
121	VG9B41	TYWMH	LIDPSDSETRLNQKFKD	NRWLLG	RSSQSLVHSDGNTYLS	KISNRFS	VQTREFPLT
		4081	4082	4083	4084	4085	4086
122	VG9B136	SNRAAWN	RTYYRSKWYNEYAASVKS	DLWELREACDI	RASQGISSYLA	VASTLQS	QQLNSYPFT
		4115	4116	4117	4118	4119	4120
123	VG9B399	NYDMN	SISSSSSYIYYADSVKG	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		4149	4150	4151	4152	4153	4154
124	VG9B369	TIGVGVG	LIYWNDDKRYNPSLKS	SHDWVHAFDI	QASQDISHYLN	DASNLDT	QQYDNFPLT
		4183	4184	4185	4186	4187	4188
125	VG9B144	GYYMH	WINPNSGATNKEQKFQG	EDDAFDV	QGDNLRNYYAT	GKNNRPS	NSRDSSGNHVV
		4217	4218	4219	4220	4221	4222
126	VG9B410	NYGMN	YISSGSSYKYYADSMKG	DPVVTEYYYYGMDV	RASQGINSWLA	AASSLQS	QQANSFPWT
		4251	4252	4253	4254	4255	4256
127	VG9B386	SYSMI	SIGSSSTYIYYADSVRG	DGETGGFDY	RASQSISRSYLA	GPSNRAT	QQYGSLPLT
		4285	4286	4287	4288	4289	4290
128	VG9B125	SYDMN	YISSSSTAKYYADSVKG	EDIVVVTPILQH	RASQSVSKDLA	DASNRAT	QQRINWPLFT
		4319	4320	4321	4322	4323	4324
129	VG9B112	SNSAAWN	GTYYRSKWFNNYAVSVKS	GEWGLRDAFDI	RASQGIHSYLA	VASTLQS	QQLNSYPWT
		4353	4354	4355	4356	4357	4358
130	VG9B371	SYDMN	SISSSSSYIYYADSVKG	DRGVGGTDYYYYGLDV	RASQSVSSSYLA	GASSRAT	QQYGSSPPYT
		4387	4388	4389	4390	4391	4392
131	VG9B387	GYYLQ	WINPNSGYTDYAQRFQD	LDDAFDV	QGDSLRNYYAI	GKNNRPS	NSRDSSGNHWV
		4421	4422	4423	4424	4425	4426
132	VG9B47	NYAIS	GIIPFFGTPDYAQKFQG	GGGYGDYDYYYGINV	RSSQSLVHSDGNTYLS	KISNRFS	MQAKEFPLT
		4455	4456	4457	4458	4459	4460
133	VG9B379	GDYIH	WINPNSGGTNYAQKFQG	EGGVAPAAPDAFDI	QGDSLRSYYAR	GKNNRPS	NSRDSSGNHRV
		4489	4490	4491	4492	4493	4494
134	VG9B447	NYYWS	RIYSSGITNYNPSLKS	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		4523	4524	4525	4526	4527	4528
135	VG9B392	GYYIH	WINPNSGYTNSAQKFQG	EDDAFDI	QGDSLRSYYAR	GKNNRPS	NSRDNSGNHVV
		4557	4558	4559	4560	4561	4562
136	VG9B96	NYAIS	GIIPIFSAGTYAQRFQG	NSGTYYDYYYGMDV	RSSQSLVHSDGNTYLS	KIFNRLS	MQAKQFPLT
		4591	4592	4593	4594	4595	4596
137	VG9B77	SYAIS	GIIPFFGTADYAQKFQG	ATVTTDYYYGMDV	RSSQSLVHSDGNTYLS	EISNRFT	MQARQFPLT
		4625	4626	4627	4628	4629	4630

TABLE 4
Chothia CDR Amino Acid Sequences
(SEQ ID NO disclosed in the cell under each respective sequence)
		HC	HC			LC	LC
	Protein	Chothia	Chothia	HC Chothia	LC Chothia	Chothia	Chothia
#	Name	CDR1	CDR2	CDR3	CDR1	CDR2	CDR3
1	VG9B54	GFAFSSY	SSSSSY	DGELGPFD	SQSVSSSY	GAS	YGRSPL
		7	8	9	10		12
2	VG9B121	GFTFSDY	SSTSNY	SYNWNYGGAFD	SQSVSSSY	GAS	YGRSPL
		41	42	43	44		46
3	VG9B429	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQGINSW	AAS	ANSFPW
		75	76	77	78		80
4	VG9B370	RFTLSSY	SSSSSY	DRGVGGTDYYYYGLD	SQSVSSSY	GAS	YGSSPPY
		109	110	111	112		114
5	VG9B80	GFTFSTY	SSSSSY	DGELGVFD	SQSISSSY	GPS	FGRSPL
		143	144	145	146		148
6	VG9B414	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQGINSW	AAS	ANSFPW
		177	178	179	180		182
7	VG9B195	GFTFSPY	SSSSSY	DGDLVGPTYYFD	DKLGDKY	QHN	WDSTTV
		211	212	213	214		216
8	VG9B140	GFTFRSY	STSSGY	DRGIAVAGDYYYGMD	SQSVSSSY	GAS	YGSSPPY
		245	246	247	248		250
9	VG9B426	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQSVASSY	GAS	YGSSPPY
		279	280	281	282		284
10	VG9B46	GFTFSIN	SSTSDY	DDVFGAFD	SQSVSRSY	GSS	YSRSPL
		313	314	315	316		318
11	VG9B416	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQSVASSY	GAS	YGSSPPY
		347	348	349	350		352
12	VG9B69	GFTFSSY	TSSSYY	DLGVRGVDYYYYGLD	SQSVSSSY	GAS	YGSSPPY
		381	382	383	384		386
13	VG9B415	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQSVASSY	GAS	YGSSPPY
		415	416	417	418		420
14	VG9B104	GFTFSVY	GSSSSY	DHDYGGLD	SQSVSSSY	GPS	YGRSPL
		449	450	451	452		454
15	VG9B198	GDSISSI	YTTDI	NGYSYGGFN	SSSNIGAGYD	GDS	YDSSLSVV
		483	484	485	486		488
16	VG9B463	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SSSNIGSNT	TNT	WDDSLNAW
		517	518	519	520		522
17	VG9B469	GFTFSHY	SSSSSY	DRGVGDTSDYYSFGLD	SQNVSSTY	GAC	YGSSPPY
		551	552	553	554		556
18	VG9B428	GFTFSNY	SSGSSY	DPVVTEYYYYGMD	SQGINSW	AAS	ANSFPW
		585	586	587	588		590
19	VG9B430	GFTFSSY	SSSSSY	DVGVTTDYYYYGMD	SQSVASSY	GAS	YGSSPPY
		619	620	621	622		624
20	VG9B423	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQSVASSY	GAS	YGSSPPY
		653	654	655	656		658
21	VG9B98	GFTFSSY	GSSSTY	DGELGPFE	SQSVSTSY	GTS	YGRSPL
		687	688	689	690		692
22	VG9B73	GFTFSNY	SSSSSY	EIGVTGTTYYQDYGMD	SQSFSSNY	GAS	YGSSPPF
		721	722	723	724		726
23	VG9B133	GFTFSNY	SSSSSY	DLGITGTTMDYYYGMD	SQSVSSSY	GAS	YGSSPPY
		755	756	757	758		760
24	VG9B368	GFTFNSY	SSSSSY	DRGIGGDYYSYAMD	SQSVSSSY	GAS	YGSSPPY
		789	790	791	792		794
25	VG9B424	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQSVASSY	GAS	YGSSPPY
		823	824	825	826		828
26	VG9B427	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQSVASSY	GAS	YGSSPPY
		857	858	859	860		862
27	VG9B417	GFTFSNY	SSGSSY	DPVVTEYYYYGMD	SQGINSW	AAS	ANSFPW
		891	892	893	894		896
28	VG9B58	GGSIKSS	FYLGS	ERPVLDAFD	SQDITNY	AAS	HDTYPY
		925	926	927	928		930
29	VG9B419	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQSVASSY	GAS	YGSSPPY
		959	960	961	962		964
30	VG9B425	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQSVASSY	GAS	YGSSPPY
		993	994	995	996		998
31	VG9B143	GFTFSTY	STSSYT	EGDWWYFD	TSSDVGGYNY	EVS	YTSSSTL
		1027	1028	1029	1030		1032
32	VG9B418	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQSVASSY	GAS	YGSSPPY
		1061	1062	1063	1064		1066
33	VG9B472	GFTFSHY	SSSSSY	DRGVGDTSDYYSFGLD	SQGIATY	AAS	YNSAPPW
		1095	1096	1097	1098		1100
34	VG9B421	GFTFSNY	SSGSSY	DPVVTEYYYYGMD	SQGINSW	AAS	ANSFPW
		1129	1130	1131	1132		1134
35	VG9B88	GFTFSSY	STSSSY	DGDMVAPIKGSFD	SQSLLNSDDGNTY	TLS	RIEFPI
		1163	1164	1165	1166		1168
36	VG9B384	GFSLSSSGM	DWFDD	IRGTGAYYYGLD	NELGDKY	QDN	WDSSKV
		1197	1198	1199	1200		1202
37	VG9B413	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQSVASSY	GAS	YGSSPPY
		1231	1232	1233	1234		1236
38	VG9B36	GFTFSSY	STGSSY	DKGLAVTGYIMD	SQDISNY	DAS	YDNLPMY
		1265	1266	1267	1268		1270
39	VG9B403	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQSVASSY	GAS	YGSSPPY
		1299	1300	1301	1302		1304
40	VG9B191	GFTFSRY	SSSSSY	DGPTVNWDYYFD	SSSNIGNNY	DNN	WDSSLSTSV
		1333	1334	1335	1336		1338
41	VG9B44	GDSVSSNSA	YYRSKWY	ESGSYYTDGFD	SQGISSY	AAS	FNSYPY
		1367	1368	1369	1370		1372
42	VG9B67	GFTFSSY	SSSSSY	DGDILATIRGSFD	SQSLLDSDAGNTY	TLS	RIEFPI
		1401	1402	1403	1404		1406
43	VG9B402	GFTFSNY	SSGSSY	DPVVTEYYYYGMD	SQGINSW	AAS	ANSFPW
		1435	1436	1437	1438		1440
44	VG9B127	GFTFGAY	SSSSSY	DGDIVSTIRGSFD	SQSLLDSDDGNTY	TLS	RIEFPI
		1469	1470	1471	1472		1474
45	VG9B137	GITFSSY	GSSSSY	SYSWNYGGAFD	SQSVSSSY	GAS	YGSSPPY
		1503	1504	1505	1506		1508
46	VG9B33	GFTFSSY	STSSSY	DTSVTKYPDTFD	SQDINNY	GAS	YNSAPF
		1537	1538	1539	1540		1542
47	VG9B162	GYTFTGD	NPNSGY	EGDAFD	TSSDVGGYNY	EVS	YAGSNNFE
		1571	1572	1573	1574		1576
48	VG9B152	GFTFSSY	SSSSDY	DWELLGFD	DKLGDKY	QHN	WDSTTV
		1605	1606	1607	1608		1610
49	VG9B64	GFSLSISGV	YWNDD	SGQWLEGDAFD	SESLVHSDGNTY	KIS	ATQFPL
		1639	1640	1641	1642		1644
50	VG9B21	GFSFSNY	SSSSHY	DRGVTTDYYYYALD	SQGIYNY	AAS	YNRAPF
		1673	1674	1675	1676		1678
51	VG9B128	GFTFGTY	WYNGSN	GGFGESFD	SQSVIDY	DAS	RSNWPL
		1707	1708	1709	1710		1712
52	VG9B66	GFTFSTY	SSSSFY	DGDIVATIRGSFD	SQDITNF	TAS	YNSAPF
		1741	1742	1743	1744		1746
53	VG9B32	GFTFSRY	SGTGYT	DQEPGFD	GQSLVHSDGNTY	KIS	ATHFPF
		1775	1776	1777	1778		1780
54	VG9B57	GFTFSSH	SSSSSY	DLGVGVRDYYYYGMD	SQDITNY	AAS	HDTYPY
		1809	1810	1811	1812		1814
55	VG9B135	GFSLTTYGV	YWNDD	DYDFWSGYFD	SQSVSSSY	GAS	YGSSPL
		1843	1844	1845	1846		1848
56	VG9B60	GYTFTGY	NPNSGV	GGSLVRGVISGLD	SQSFSGSY	GAS	YGSSPPY
		1877	1878	1879	1880		1882
57	VG9B409	GYTLTSY	NPSGGS	GSYGWYFD	SQSVTSSY	GAS	YGSSPPY
		1911	1912	1913	1914		1916
58	VG9B411	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQGINSW	AAS	YNNWPR
		1945	1946	1947	1948		1950
59	VG9B129	GGTFSSY	LPILST	AHDYYYGMD	SQSVSNNY	GAS	YGSSPPY
		1979	1980	1981	1982		1984
60	VG9B396	GDSIRGY	FTTGN	EKWDSSSSALYFD	SSSNIGADYD	GNT	YDSRLTGYV
		2013	2014	2015	2016		2018
61	VG9B470	GFSLTTSGV	LWNDH	DKWELRDAFD	SQGISRY	VAS	LISYPY
		2047	2048	2049	2050		2052
62	VG9B111	GFTFSTY	SSDSSY	DSVTGPFD	SQDISHY	DSY	YDNLPY
		2081	2082	2083	2084		2086
63	VG9B169	GGSITNY	FYSGS	VGRWELRTAFD	SSSNIGSNT	SNN	WDDSLNGPG
		2115	2116	2117	2118		2120
64	VG9B639	GFTFTTY	SSSSIY	ERVYTVSFD	SQDISHY	DSY	YDNLPY
		2149	2150	2151	2152		2154
65	VG9B201	GFSLTTHGV	YWNAD	EGDWGHYFD	SSSNIGNND	DNN	WDSSLSAIW
		2183	2184	2185	2186		2188
66	VG9B161	GGSISSY	FYSGS	VGRWELRGAFD	SSSNIGSNT	SNN	WDDSLNSPG
		2217	2218	2219	2220		2222
67	VG9B383	SGSISSY	YTIGN	EGYYDSSGSFFPGAFG	TSNDVGSYNL	AGS	FAGATNV
		2251	2252	2253	2254		2256
68	VG9B382	GDSISGY	FTTGN	ERWDSSSSALYFD	SSSNIGADYD	GNS	YDSSMSGYV
		2285	2286	2287	2288		2290
69	VG9B156	NGSISGY	FYSGS	LGKWELRTAFD	STSNIGSDT	SNN	WDDSLNGP
		2319	2320	2321	2322		2324
70	VG9B205	NGSISGY	FYSGS	LGKWELRTAFD	DKLGDKY	QDS	WDSSTV
		2353	2354	2355	2356		2358
71	VG9B86	GDSISSS	YSSGS	YSGSYWYFD	SQSVSSY	DTS	RSDWLL
		2387	2388	2389	2390		2392
72	VG9B154	GGSISYY	YYSGS	EGKWELRTTFD	SSSNIGSNT	SNN	WDDSLNGP
		2421	2422	2423	2424		2426
73	VG9B159	GGSISSY	YTGGR	DMEYYYDRSGYSYWYFD	NNIGSKS	DDS	WDSSSDHV
		2455	2456	2457	2458		2460
74	VG9B465	GGSITSY	YTIGN	EGYYESDGSFFPGAFN	TSNDVGSYNL	AGS	YAGTTNV
		2489	2490	2491	2492		2494
75	VG9B194	GYTFTGD	NPNSGY	ELDALD	TSSDVGGYNY	EVS	YAGSNNFE
		2523	2524	2525	2526		2528
76	VG9B182	GDSINNH	FYNGN	VGRWVLRTAFD	SSSNIGSNT	SNN	WDDSLNGPG
		2557	2558	2559	2560		2562
77	VG9B173	GGSINNY	YYSGS	EGKWELRSAFD	SSSNIESNT	SNN	WDDSLNGP
		2591	2592	2593	2594		2596
78	VG9B87	GYTFTSE	NPSGGS	ERGYSYGSFD	SQGISSY	AAS	FNSYSL
		2625	2626	2627	2628		2630
79	VG9B208	GGSISGY	FYSGS	VGKWELRSSFD	STSNIGNND	DNN	WDSSLSVW
		2659	2660	2661	2662		2664
80	VG9B372	GGSISNGGF	NYSGS	DRNYEWNFD	SQSVSSY	DAS	RSNWPL
		2693	2694	2695	2696		2698
81	VG9B186	GFSLTNIRM	FSNDE	MRLPYGMD	STSNIGSNT	SNN	WDDSLNGP
		2727	2728	2729	2730		2732
82	VG9B177	GGSINNY	FYSGS	VGKWELRTAFD	TSSDVADYNY	EVS	YTSSFTV
		2761	2762	2763	2764		2766
83	VG9B114	GFTFSRY	GSAGD	GKWELRDAFD	SQGIHSY	VAS	LNSYPY
		2795	2796	2797	2798		2800
84	VG9B147	GGSISGY	FYSGS	EGKWELRSTFD	DSLRSYY	GEN	RDTGDHHL
		2829	2830	2831	2832		2834
85	VG9B65	GGTFNIY	IPFFGT	GGDSGYDWGFD	SQSLVHSDGNTY	QIS	ATQFPL
		2863	2864	2865	2866		2868
86	VG9B81	GGSINTY	YTSDN	YNWNYWYFD	SQGISSY	TAS	LNSYPY
		2897	2898	2899	2900		2902
87	VG9B203	GDSIGHY	YTSGS	SGGNFYWYFD	SSSNIGNNY	DNN	WDSSLSAG
		2931	2932	2933	2934		2936
88	VG9B380	GGSISNY	YPSGI	IMGTKGAFD	TSSDVGGYNY	EVS	YTSTSV
		2965	2966	2967	2968		2970
89	VG9B103	GGTFSSY	IPIFGT	GVGWGTDYYYGLD	SQGLVHSDGNTY	KIS	ATHHPL
		2999	3000	3001	3002		3004
90	VG9B462	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3033	3034	3035	3036		3038
91	VG9B461	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3067	3068	3069	3070		3072
92	VG9B106	GYTFTGY	NPSSGD	ELGIGVFD	SQSVLYSSNNKNY	WAS	YYSIPY
		3101	3102	3103	3104		3106
93	VG9B115	GFSLSTYGV	YWNDD	ESDWSYYFD	SQSVSSY	DAS	RSSWPW
		3135	3136	3137	3138		3140
94	VG9B27	GGTFSSY	LPILST	AHDYYYGMD	SQSLVHSDGNTY	KIS	ATHHPL
		3169	3170	3171	3172		3174
95	VG9B458	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3203	3204	3205	3206		3208
96	VG9B131	GFTFSSY	SSSSTA	EDIVVVTPILQ	SQSVSNY	DAS	RSNW
		3237	3238	3239	3240		3242
97	VG9B163	GFTFSNH	TRGGDT	GPLTVGYAMD	NSSNIGHNY	DNN	WDSSLSIV
		3271	3272	3273	3274		3276
98	VG9B454	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3305	3306	3307	3308		3310
99	VG9B439	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3339	3340	3341	3342		3344
100	VG9B68	GGTFSTY	IPIFGT	GVGWGSDYYYGLD	SQSLVHSDGNTY	KIS	ATHHPL
		3373	3374	3375	3376		3378
101	VG9B449	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3407	3408	3409	3410		3412
102	VG9B204	YGSFSSF	YTSGG	WLRAFD	DKLGDKY	QDS	WDSSTV
		3441	3442	3443	3444		3446
103	VG9B459	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3475	3476	3477	3478		3480
104	VG9B157	GFTFSNH	TRGGDT	GPLTVGYAMD	DSLRSYY	GEN	RDTGDHHL
		3509	3510	3511	3512		3514
105	VG9B453	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3543	3544	3545	3546		3548
106	VG9B443	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3577	3578	3579	3580		3582
107	VG9B455	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3611	3612	3613	3614		3616
108	VG9B466	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3645	3646	3647	3648		3650
109	VG9B450	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3679	3680	3681	3682		3684
110	VG9B438	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3713	3714	3715	3716		3718
111	VG9B464	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3747	3748	3749	3750		3752
112	VG9B437	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3781	3782	3783	3784		3786
113	VG9B457	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3815	3816	3817	3818		3820
114	VG9B442	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3849	3850	3851	3852		3854
115	VG9B436	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3883	3884	3885	3886		3888
116	VG9B434	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3917	3918	3919	3920		3922
117	VG9B460	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		3951	3952	3953	3954		3956
118	VG9B189	GFTFSNH	TRGGDT	GPLTVGYAMD	TSSDVGGYNY	EVS	YAGSNNFE
		3985	3986	3987	3988		3990
119	VG9B452	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		4019	4020	4021	4022		4024
120	VG9B53	GGSISSY	HTIGS	EGVGATNYYYGMA	SQSLLHSNGYNY	LGS	ALQTPY
		4053	4054	4055	4056		4058
121	VG9B41	GYSFTTY	DPSDSE	NRWLL	SQSLVHSDGNTY	KIS	TREFPL
		4087	4088	4089	4090		4092
122	VG9B136	GDSVSSNRA	YYRSKWY	DLWELREACD	SQGISSY	VAS	LNSYPF
		4121	4122	4123	4124		4126
123	VG9B399	GFTFSNY	SSSSSY	DVGVTTDYYYYGMD	SQSVASSY	GAS	YGSSPPY
		4155	4156	4157	4158		4160
124	VG9B369	GFSLSTIGV	YWNDD	SHDWVHAFD	SQDISHY	DAS	YDNFPL
		4189	4190	4191	4192		4194
125	VG9B144	GYTFTGY	NPNSGA	EDDAFD	DNLRNYY	GKN	RDSSGNHV
		4223	4224	4225	4226		4228
126	VG9B410	GFTFSNY	SSGSSY	DPVVTEYYYYGMD	SQGINSW	AAS	ANSFPW
		4257	4258	4259	4260		4262
127	VG9B386	GFTFSSY	GSSSTY	DGETGGFD	SQSISRSY	GPS	YGSLPL
		4291	4292	4293	4294		4296
128	VG9B125	GFTFSSY	SSSSTA	EDIVVVTPILQ	SQSVSKD	DAS	RINWPLF
		4325	4326	4327	4328		4330
129	VG9B112	GDSVSSNSA	YYRSKWF	GEWGLRDAFD	SQGIHSY	VAS	LNSYPW
		4359	4360	4361	4362		4364
130	VG9B371	RFTLSSY	SSSSSY	DRGVGGTDYYYYGLD	SQSVSSSY	GAS	YGSSPPY
		4393	4394	4395	4396		4398
131	VG9B387	GFTFTGY	NPNSGY	LDDAFD	DSLRNYY	GKN	RDSSGNHW
		4427	4428	4429	4430		4432
132	VG9B47	GGSFSNY	IPFFGT	GGGYGDYDYYYGIN	SQSLVHSDGNTY	KIS	AKEFPL
		4461	4462	4463	4464		4466
133	VG9B379	GYTFTGD	NPNSGG	EGGVAPAAPDAFD	DSLRSYY	GKN	RDSSGNHR
		4495	4496	4497	4498		4500
134	VG9B447	GGSISNY	YSSGI	IVGVKGAFA	TSSDVGGYNY	EVS	YTSTSV
		4529	4530	4531	4532		4534
135	VG9B392	GYTFTGY	NPNSGY	EDDAFD	DSLRSYY	GKN	RDNSGNHV
		4563	4564	4565	4566		4568
136	VG9B96	GGTFSNY	IPIFSA	NSGTYYDYYYGMD	SQSLVHSDGNTY	KIF	AKQFPL
		4597	4598	4599	4600		4602
137	VG9B77	GGTFSSY	IPFFGT	ATVTTDYYYGMD	SQSLVHSDGNTY	EIS	ARQFPL
		4631	4632	4633	4634		4636

TABLE 5
AbM CDR Amino Acid Sequences
(SEQ ID NO disclosed in the cell under each respective sequence)
	Protein	HC AbM	HC AbM			LC AbM	LC AbM
#	Name	CDR1	CDR2	HC AbM CDR3	LC AbM CDR1	CDR2	CDR3
1	VG9B54	GFAFSSYSLT	SISSSSSYIF	DGELGPFDY	RASQSVSSSYLA	GASSRAT	QQYGRSPLT
		13	14	15	16	17	18
2	VG9B121	GFTFSDYAMD	SISSTSNYIF	SYNWNYGGAFDI	RASQSVSSSYFA	GASSRAT	QQYGRSPLT
		47	48	49	50	51	52
3	VG9B429	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQGINSWLA	AASSLQS	QQANSFPWT
		81	82	83	84	85	86
4	VG9B370	RFTLSSYDMN	SISSSSSYIY	DRGVGGTDYYYYGLDV	RASQSVSSSYLA	GASSRAT	QQYGSSPPYT
		115	116	117	118	119	120
5	VG9B80	GFTFSTYSMN	SISSSSSYIF	DGELGVFDY	RASQSISSSYLA	GPSGRAT	QQFGRSPLT
		149	150	151	152	153	154
6	VG9B414	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQGINSWLA	AASSLQS	QQANSFPWT
		183	184	185	186	187	188
7	VG9B195	GFTFSPYTMN	SISSSSSYMY	DGDLVGPTYYFDY	SGDKLGDKYAC	QHNKRPS	QAWDSTTVV
		217	218	219	220	221	222
8	VG9B140	GFTFRSYDMN	SISTSSGYIY	DRGIAVAGDYYYGMDV	RASQSVSSSYLA	GASSRAT	QQYGSSPPYT
		251	252	253	254	255	256
9	VG9B426	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		285	286	287	288	289	290
10	VG9B46	GFTFSINSMN	SISSTSDYIF	DDVFGAFDI	RTSQSVSRSYLG	GSSSRAT	QQYSRSPLT
		319	320	321	322	323	324
11	VG9B416	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		353	354	355	356	357	358
12	VG9B69	GFTFSSYDIN	SITSSSYYIY	DLGVRGVDYYYYGLDV	RASQSVSSSYLA	GASSRAT	QQYGSSPPYT
		387	388	389	390	391	392
13	VG9B415	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		421	422	423	424	425	426
14	VG9B104	GFTFSVYSMN	SIGSSSSYIF	DHDYGGLDY	RASQSVSSSYLA	GPSNRAT	QQYGRSPLT
		455	456	457	458	459	460
15	VG9B198	GDSISSIYWS	RIYTTDITN	NGYSYGGFNY	TGSSSNIGAGYDVH	GDSYRPS	QSYDSSLSVVV
		489	490	491	492	493	494
16	VG9B463	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	SGSSSNIGSNTVN	TNTQRPS	AAWDDSLNAWV
		523	524	525	526	527	528
17	VG9B469	GFTFSHYDMN	SISSSSSYIF	DRGVGDTSDYYSFGLDV	RASQNVSSTYLA	GACSRAT	QQYGSSPPYT
		557	558	559	560	561	562
18	VG9B428	GFTFSNYGMN	YISSGSSYKY	DPVVTEYYYYGMDV	RASQGINSWLA	AASSLQS	QQANSFPWT
		591	592	593	594	595	596
19	VG9B430	GFTFSSYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		625	626	627	628	629	630
20	VG9B423	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		659	660	661	662	663	664
21	VG9B98	GFTFSSYSMY	SIGSSSTYIF	DGELGPFEY	RASQSVSTSYLA	GTSSRAT	LQYGRSPLT
		693	694	695	696	697	698
22	VG9B73	GFTFSNYDMN	SISSSSSYIY	EIGVTGTTYYQDYGMDV	RASQSFSSNYLA	GASSRAT	QQYGSSPPFT
		727	728	729	730	731	732
23	VG9B133	GFTFSNYDMN	SISSSSSYIY	DLGITGTTMDYYYGMDV	RASQSVSSSYLA	GASSRAT	QQYGSSPPYT
		761	762	763	764	765	766
24	VG9B368	GFTFNSYDMN	SISSSSSYIY	DRGIGGDYYSYAMDV	RASQSVSSSYLA	GASSRAT	QQYGSSPPYT
		795	796	797	798	799	800
25	VG9B424	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		829	830	831	832	833	834
26	VG9B427	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		863	864	865	866	867	868
27	VG9B417	GFTFSNYGMN	YISSGSSYKY	DPVVTEYYYYGMDV	RASQGINSWLA	AASSLQS	QQANSFPWT
		897	898	899	900	901	902
28	VG9B58	GGSIKSSYWT	YMFYLGSTN	ERPVLDAFDI	RASQDITNYLA	AASSLQG	LQHDTYPYT
		931	932	933	934	935	936
29	VG9B419	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		965	966	967	968	969	970
30	VG9B425	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		999	1000	1001	1002	1003	1004
31	VG9B143	GFTFSTYGMN	YISTSSYTIY	EGDWWYFDL	TGTSSDVGGYNYVS	EVSNRPS	SSYTSSSTLV
		1033	1034	1035	1036	1037	1038
32	VG9B418	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		1067	1068	1069	1070	1071	1072
33	VG9B472	GFTFSHYDMN	SISSSSSYIF	DRGVGDTSDYYSFGLDV	RASQGIATYLA	AASTLQS	QKYNSAPPWT
		1101	1102	1103	1104	1105	1106
34	VG9B421	GFTFSNYGMN	YISSGSSYKY	DPVVTEYYYYGMDV	RASQGINSWLA	AASSLQS	QQANSFPWT
		1135	1136	1137	1138	1139	1140
35	VG9B88	GFTFSSYTMN	SISTSSSYID	DGDMVAPIKGSFDY	RSSQSLLNSDDGNTYLD	TLSYRAS	MQRIEFPIT
		1169	1170	1171	1172	1173	1174
36	VG9B384	GFSLSSSGMCVS	LIDWFDDKY	IRGTGAYYYGLDV	SGNELGDKYAS	QDNKRPS	QAWDSSKVV
		1203	1204	1205	1206	1207	1208
37	VG9B413	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		1237	1238	1239	1240	1241	1242
38	VG9B36	GFTFSSYGMY	SISTGSSYIY	DKGLAVTGYIMDV	QASQDISNYLN	DASNLET	QQYDNLPMYT
		1271	1272	1273	1274	1275	1276
39	VG9B403	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		1305	1306	1307	1308	1309	1310
40	VG9B191	GFTFSRYSMN	SISSSSSYIY	DGPTVNWDYYFDL	SGSSSNIGNNYVS	DNNKRPS	GTWDSSLSTSVV
		1339	1340	1341	1342	1343	1344
41	VG9B44	GDSVSSNSAAWN	RTYYRSKWYND	ESGSYYTDGFDI	RASQGISSYLA	AASTLQS	QEFNSYPYT
		1373	1374	1375	1376	1377	1378
42	VG9B67	GFTFSSYTMN	SISSSSSYID	DGDILATIRGSFDY	RSSQSLLDSDAGNTYLD	TLSYRAS	MQRIEFPIT
		1407	1408	1409	1410	1411	1412
43	VG9B402	GFTFSNYGMN	YISSGSSYKY	DPVVTEYYYYGMDV	RASQGINSWLA	AASSLQS	QQANSFPWT
		1441	1442	1443	1444	1445	1446
44	VG9B127	GFTFGAYTMN	SISSSSSYID	DGDIVSTIRGSFDY	RSSQSLLDSDDGNTYLD	TLSYRAS	MQRIEFPIT
		1475	1476	1477	1478	1479	1480
45	VG9B137	GITFSSYSMD	SIGSSSSYIF	SYSWNYGGAFDI	RASQSVSSSYLA	GASSRAT	QQYGSSPPYT
		1509	1510	1511	1512	1513	1514
46	VG9B33	GFTFSSYNMN	SISTSSSYIY	DTSVTKYPDTFDI	RASQDINNYLA	GASTLQS	QKYNSAPFT
		1543	1544	1545	1546	1547	1548
47	VG9B162	GYTFTGDYMH	WINPNSGYTN	EGDAFDV	TGTSSDVGGYNYVS	EVSKRPS	NSYAGSNNFEV
		1577	1578	1579	1580	1581	1582
48	VG9B152	GFTFSSYSMI	SISSSSDYIY	DWELLGFDC	SGDKLGDKYAC	QHNKRPS	QAWDSTTVV
		1611	1612	1613	1614	1615	1616
49	VG9B64	GFSLSISGVSVG	LIYWNDDKR	SGQWLEGDAFDI	RSSESLVHSDGNTYLS	KISNRFS	MQATQFPLT
		1645	1646	1647	1648	1649	1650
50	VG9B21	GFSFSNYDMN	SISSSSHYIY	DRGVTTDYYYYALDV	RASQGIYNYLA	AASTLQS	QKYNRAPFT
		1679	1680	1681	1682	1683	1684
51	VG9B128	GFTFGTYGMH	VIWYNGSNKY	GGFGESFDS	RASQSVIDYLA	DASNRAT	QQRSNWPLT
		1713	1714	1715	1716	1717	1718
52	VG9B66	GFTFSTYTMN	SISSSSFYMD	DGDIVATIRGSFDY	RASQDITNFLA	TASTLQS	QKYNSAPFT
		1747	1748	1749	1750	1751	1752
53	VG9B32	GFTFSRYAMN	FISGTGYTVY	DQEPGFDY	RSGQSLVHSDGNTYLS	KISNRFS	MQATHFPFT
		1781	1782	1783	1784	1785	1786
54	VG9B57	GFTFSSHDMN	SISSSSSYIF	DLGVGVRDYYYYGMDV	RASQDITNYLA	AASSLQG	LQHDTYPYT
		1815	1816	1817	1818	1819	1820
55	VG9B135	GFSLTTYGVGVG	LIYWNDDKR	DYDFWSGYFDY	RASQSVSSSYLA	GASSRAT	QQYGSSPLT
		1849	1850	1851	1852	1853	1854
56	VG9B60	GYTFTGYYMH	RINPNSGVTH	GGSLVRGVISGLDY	RASQSFSGSYLA	GASSRAT	QQYGSSPPYT
		1883	1884	1885	1886	1887	1888
57	VG9B409	GYTLTSYYMH	IINPSGGSTS	GSYGWYFDL	RASQSVTSSYLA	GASSRAT	QQYGSSPPYT
		1917	1918	1919	1920	1921	1922
58	VG9B411	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQGINSWLA	AASTLQS	QQYNNWPRT
		1951	1952	1953	1954	1955	1956
59	VG9B129	GGTFSSYVIS	GILPILSTAN	AHDYYYGMDV	RASQSVSNNYLA	GASSRAT	QQYGSSPPYT
		1985	1986	1987	1988	1989	1990
60	VG9B396	GDSIRGYYWN	RIFTTGNTN	EKWDSSSSALYFDF	TGSSSNIGADYDVK	GNTDRPS	QSYDSRLTGYVV
		2019	2020	2021	2022	2023	2024
61	VG9B470	GFSLTTSGVGVG	LILWNDHTI	DKWELRDAFDI	RASQGISRYLA	VASTLQS	QQLISYPYT
		2053	2054	2055	2056	2057	2058
62	VG9B111	GFTFSTYSVN	SISSDSSYIF	DSVTGPFDY	QASQDISHYLN	DSYILET	QQYDNLPYT
		2087	2088	2089	2090	2091	2092
63	VG9B169	GGSITNYFWN	YIFYSGSTS	VGRWELRTAFDI	SGSSSNIGSNTVN	SNNQRPS	AAWDDSLNGPGV
		2121	2122	2123	2124	2125	2126
64	VG9B639	GFTFTTYRMN	SISSSSIYIH	ERVYTVSFDY	QASQDISHYLN	DSYILET	QQYDNLPYT
		2155	2156	2157	2158	2159	2160
65	VG9B201	GFSLTTHGVGVG	LIYWNADKH	EGDWGHYFDF	SGSSSNIGNNDVS	DNNRRPS	ETWDSSLSAIWV
		2189	2190	2191	2192	2193	2194
66	VG9B161	GGSISSYFWS	YIFYSGSTN	VGRWELRGAFDI	SGSSSNIGSNTVN	SNNQRPS	AAWDDSLNSPGV
		2223	2224	2225	2226	2227	2228
67	VG9B383	SGSISSYYWN	RIYTIGNTN	EGYYDSSGSFFPGAFGI	TGTSNDVGSYNLVS	AGSKRPS	CSFAGATNVV
		2257	2258	2259	2260	2261	2262
68	VG9B382	GDSISGYYWN	RIFTTGNTN	ERWDSSSSALYFDY	TGSSSNIGADYDIK	GNSNRPS	QSYDSSMSGYVV
		2291	2292	2293	2294	2295	2296
69	VG9B156	NGSISGYFWN	YIFYSGSTN	LGKWELRTAFDI	SGSTSNIGSDTVN	SNNQRPS	AAWDDSLNGPV
		2325	2326	2327	2328	2329	2330
70	VG9B205	NGSISGYFWN	YIFYSGSTN	LGKWELRTAFDI	SGDKLGDKYAC	QDSKRPS	QAWDSSTVV
		2359	2360	2361	2362	2363	2364
71	VG9B86	GDSISSSYWS	RFYSSGSTS	YSGSYWYFDL	RASQSVSSYLA	DTSNRAT	QQRSDWLLT
		2393	2394	2395	2396	2397	2398
72	VG9B154	GGSISYYFWN	YIYYSGSTN	EGKWELRTTFDI	SGSSSNIGSNTVN	SNNQRPS	AAWDDSLNGPV
		2427	2428	2429	2430	2431	2432
73	VG9B159	GGSISSYYWS	RFYTGGRNN	DMEYYYDRSGYSYWYFDL	GGNNIGSKSVH	DDSDRPS	QVWDSSSDHVV
		2461	2462	2463	2464	2465	2466
74	VG9B465	GGSITSYYWN	RIYTIGNTN	EGYYESDGSFFPGAFNI	TGTSNDVGSYNLVS	AGSKRPS	CSYAGTTNVV
		2495	2496	2497	2498	2499	2500
75	VG9B194	GYTFTGDYMH	WINPNSGYTN	ELDALDV	TGTSSDVGGYNYVS	EVSKRPS	NSYAGSNNFEV
		2529	2530	2531	2532	2533	2534
76	VG9B182	GDSINNHFWS	FVFYNGNTN	VGRWVLRTAFDI	SGSSSNIGSNTVN	SNNQRPS	AAWDDSLNGPGV
		2563	2564	2565	2566	2567	2568
77	VG9B173	GGSINNYFWS	YIYYSGSTN	EGKWELRSAFDI	SGSSSNIESNTVN	SNNQRPS	TAWDDSLNGPV
		2597	2598	2599	2600	2601	2602
78	VG9B87	GYTFTSEYIH	IINPSGGSTS	ERGYSYGSFDY	RASQGISSYLA	AASTLQS	QQFNSYSLT
		2631	2632	2633	2634	2635	2636
79	VG9B208	GGSISGYYWS	YIFYSGSIN	VGKWELRSSFDI	SGSTSNIGNNDVS	DNNKRPS	GTWDSSLSVWV
		2665	2666	2667	2668	2669	2670
80	VG9B372	GGSISNGGFYWS	YINYSGSTY	DRNYEWNFDL	RASQSVSSYLA	DASNRAT	QQRSNWPLT
		2699	2700	2701	2702	2703	2704
81	VG9B186	GFSLTNIRMSVS	HIFSNDEKS	MRLPYGMDV	SGSTSNIGSNTVN	SNNQRPS	AAWDDSLNGPV
		2733	2734	2735	2736	2737	2738
82	VG9B177	GGSINNYFWS	YIFYSGSTN	VGKWELRTAFDI	TGTSSDVADYNYVS	EVSNRPS	CSYTSSFTVV
		2767	2768	2769	2770	2771	2772
83	VG9B114	GFTFSRYDMH	AIGSAGDTY	GKWELRDAFDI	RASQGIHSYLA	VASTLQS	QQLNSYPYT
		2801	2802	2803	2804	2805	2806
84	VG9B147	GGSISGYFWN	YIFYSGSTN	EGKWELRSTFDI	QGDSLRSYYAT	GENNRPS	NSRDTGDHHLV
		2835	2836	2837	2838	2839	2840
85	VG9B65	GGTFNIYAIN	GIIPFFGTAN	GGDSGYDWGFDY	RSSQSLVHSDGNTYLS	QISNRFS	MQATQFPLT
		2869	2870	2871	2872	2873	2874
86	VG9B81	GGSINTYYWS	RIYTSDNTN	YNWNYWYFDL	RASQGISSYLA	TASTLQS	QHLNSYPYT
		2903	2904	2905	2906	2907	2908
87	VG9B203	GDSIGHYYWN	RIYTSGSTN	SGGNFYWYFDL	SGSSSNIGNNYVS	DNNKRPS	GTWDSSLSAGV
		2937	2938	2939	2940	2941	2942
88	VG9B380	GGSISNYYWS	RIYPSGITS	IMGTKGAFDI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		2971	2972	2973	2974	2975	2976
89	VG9B103	GGTFSSYAIS	GIIPIFGTAT	GVGWGTDYYYGLDV	RSSQGLVHSDGNTYLS	KISNRFS	MQATHHPLT
		3005	3006	3007	3008	3009	3010
90	VG9B462	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3039	3040	3041	3042	3043	3044
91	VG9B461	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3073	3074	3075	3076	3077	3078
92	VG9B106	GYTFTGYYLH	WINPSSGDTD	ELGIGVFDY	KSSQSVLYSSNNKNYLG	WASTRES	QQYYSIPYT
		3107	3108	3109	3110	3111	3112
93	VG9B115	GFSLSTYGVGVG	LIYWNDDKR	ESDWSYYFDY	RASQSVSSYLA	DASNRAT	QQRSSWPWT
		3141	3142	3143	3144	3145	3146
94	VG9B27	GGTFSSYVIS	GILPILSTAN	AHDYYYGMDV	RSSQSLVHSDGNTYLS	KISNRFS	MQATHHPLT
		3175	3176	3177	3178	3179	3180
95	VG9B458	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3209	3210	3211	3212	3213	3214
96	VG9B131	GFTFSSYDMN	YISSSSTAKY	EDIVVVTPILQH	RASQSVSNYLA	DASNRAT	QQRSNWT
		3243	3244	3245	3246	3247	3248
97	VG9B163	GFTFSNHGMS	SITRGGDTTY	GPLTVGYAMDY	SGNSSNIGHNYVS	DNNQRPS	GIWDSSLSIVV
		3277	3278	3279	3280	3281	3282
98	VG9B454	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3311	3312	3313	3314	3315	3316
99	VG9B439	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3345	3346	3347	3348	3349	3350
100	VG9B68	GGTFSTYAIS	GIIPIFGTAT	GVGWGSDYYYGLDV	RSSQSLVHSDGNTYLS	KISNRFS	IQATHHPLT
		3379	3380	3381	3382	3383	3384
101	VG9B449	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3413	3414	3415	3416	3417	3418
102	VG9B204	YGSFSSFYWS	RIYTSGGTI	WLRAFDY	SGDKLGDKYAC	QDSKRPS	QAWDSSTVV
		3447	3448	3449	3450	3451	3452
103	VG9B459	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3481	3482	3483	3484	3485	3486
104	VG9B157	GFTFSNHGMS	SITRGGDTTY	GPLTVGYAMDY	QGDSLRSYYAT	GENNRPS	NSRDTGDHHLV
		3515	3516	3517	3518	3519	3520
105	VG9B453	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3549	3550	3551	3552	3553	3554
106	VG9B443	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3583	3584	3585	3586	3587	3588
107	VG9B455	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3617	3618	3619	3620	3621	3622
108	VG9B466	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3651	3652	3653	3654	3655	3656
109	VG9B450	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3685	3686	3687	3688	3689	3690
110	VG9B438	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3719	3720	3721	3722	3723	3724
111	VG9B464	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3753	3754	3755	3756	3757	3758
112	VG9B437	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3787	3788	3789	3790	3791	3792
113	VG9B457	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3821	3822	3823	3824	3825	3826
114	VG9B442	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3855	3856	3857	3858	3859	3860
115	VG9B436	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3889	3890	3891	3892	3893	3894
116	VG9B434	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3923	3924	3925	3926	3927	3928
117	VG9B460	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		3957	3958	3959	3960	3961	3962
118	VG9B189	GFTFSNHGMS	SITRGGDTTY	GPLTVGYAMDY	TGTSSDVGGYNYVS	EVSKRPS	NSYAGSNNFEV
		3991	3992	3993	3994	3995	3996
119	VG9B452	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		4025	4026	4027	4028	4029	4030
120	VG9B53	GGSISSYYWS	RIHTIGSIN	EGVGATNYYYGMAV	RSSQSLLHSNGYNYLD	LGSNRAS	MQALQTPYT
		4059	4060	4061	4062	4063	4064
121	VG9B41	GYSFTTYWMH	LIDPSDSETR	NRWLLG	RSSQSLVHSDGNTYLS	KISNRFS	VQTREFPLT
		4093	4094	4095	4096	4097	4098
122	VG9B136	GDSVSSNRAAWN	RTYYRSKWYNE	DLWELREACDI	RASQGISSYLA	VASTLQS	QQLNSYPFT
		4127	4128	4129	4130	4131	4132
123	VG9B399	GFTFSNYDMN	SISSSSSYIY	DVGVTTDYYYYGMDV	RASQSVASSYLA	GASSRAT	QQYGSSPPYT
		4161	4162	4163	4164	4165	4166
124	VG9B369	GFSLSTIGVGVG	LIYWNDDKR	SHDWVHAFDI	QASQDISHYLN	DASNLDT	QQYDNFPLT
		4195	4196	4197	4198	4199	4200
125	VG9B144	GYTFTGYYMH	WINPNSGATN	EDDAFDV	QGDNLRNYYAT	GKNNRPS	NSRDSSGNHVV
		4229	4230	4231	4232	4233	4234
126	VG9B410	GFTFSNYGMN	YISSGSSYKY	DPVVTEYYYYGMDV	RASQGINSWLA	AASSLQS	QQANSFPWT
		4263	4264	4265	4266	4267	4268
127	VG9B386	GFTFSSYSMI	SIGSSSTYIY	DGETGGFDY	RASQSISRSYLA	GPSNRAT	QQYGSLPLT
		4297	4298	4299	4300	4301	4302
128	VG9B125	GFTFSSYDMN	YISSSSTAKY	EDIVVVTPILQH	RASQSVSKDLA	DASNRAT	QQRINWPLFT
		4331	4332	4333	4334	4335	4336
129	VG9B112	GDSVSSNSAAWN	GTYYRSKWFNN	GEWGLRDAFDI	RASQGIHSYLA	VASTLQS	QQLNSYPWT
		4365	4366	4367	4368	4369	4370
130	VG9B371	RFTLSSYDMN	SISSSSSYIY	DRGVGGTDYYYYGLDV	RASQSVSSSYLA	GASSRAT	QQYGSSPPYT
		4399	4400	4401	4402	4403	4404
131	VG9B387	GFTFTGYYLQ	WINPNSGYTD	LDDAFDV	QGDSLRNYYAI	GKNNRPS	NSRDSSGNHWV
		4433	4434	4435	4436	4437	4438
132	VG9B47	GGSFSNYAIS	GIIPFFGTPD	GGGYGDYDYYYGINV	RSSQSLVHSDGNTYLS	KISNRFS	MQAKEFPLT
		4467	4468	4469	4470	4471	4472
133	VG9B379	GYTFTGDYIH	WINPNSGGTN	EGGVAPAAPDAFDI	QGDSLRSYYAR	GKNNRPS	NSRDSSGNHRV
		4501	4502	4503	4504	4505	4506
134	VG9B447	GGSISNYYWS	RIYSSGITN	IVGVKGAFAI	TGTSSDVGGYNYVS	EVSNRPS	SSYTSTSVV
		4535	4536	4537	4538	4539	4540
135	VG9B392	GYTFTGYYIH	WINPNSGYTN	EDDAFDI	QGDSLRSYYAR	GKNNRPS	NSRDNSGNHVV
		4569	4570	4571	4572	4573	4574
136	VG9B96	GGTFSNYAIS	GIIPIFSAGT	NSGTYYDYYYGMDV	RSSQSLVHSDGNTYLS	KIFNRLS	MQAKQFPLT
		4603	4604	4605	4606	4607	4608
137	VG9B77	GGTFSSYAIS	GIIPFFGTAD	ATVTTDYYYGMDV	RSSQSLVHSDGNTYLS	EISNRFT	MQARQFPLT
		4637	4638	4639	4640	4641	4642

TABLE 6
Contact CDR Amino Acid Sequences
(SEQ ID NO disclosed in the cell under each respective sequence)
	Protein	HC Contact	HC Contact	HC Contact	LC Contact	LC Contact	LC Contact
#	Name	CDR1	CDR2	CDR3	CDR1	CDR2	CDR3
1	VG9B54	SSYSLT	WVSSISSSSSYIF	ATDGELGPFD	SSSYLAWF	RLIYGASSRA	QQYGRSPL
		19	20	21	22	23	24
2	VG9B121	SDYAMD	WISSISSTSNYIF	ANSYNWNYGGAFD	SSSYFAWY	LLIYGASSRA	QQYGRSPL
		53	54	55	56	57	58
3	VG9B429	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	NSWLAWY	LLIYAASSLQ	QQANSFPW
		87	88	89	90	91	92
4	VG9B370	SSYDMN	WVSSISSSSSYIY	ARDRGVGGTDYYYYGLD	SSSYLAWY	LLIYGASSRA	QQYGSSPPY
		121	122	123	124	125	126
5	VG9B80	STYSMN	WVSSISSSSSYIF	AKDGELGVFD	SSSYLAWY	VLIYGPSGRA	QQFGRSPL
		155	156	157	158	159	160
6	VG9B414	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	NSWLAWY	LLIYAASSLQ	QQANSFPW
		189	190	191	192	193	194
7	VG9B195	SPYTMN	WVSSISSSSSYMY	ARDGDLVGPTYYFD	DKYACWY	LVIYQHNKRP	QAWDSTTV
		223	224	225	226	227	228
8	VG9B140	RSYDMN	WVSSISTSSGYIY	ARDRGIAVAGDYYYGMD	SSSYLAWY	LLIYGASSRA	QQYGSSPPY
		257	258	259	260	261	262
9	VG9B426	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	ASSYLAWY	LLIYGASSRA	QQYGSSPPY
		291	292	293	294	295	296
10	VG9B46	SINSMN	WVSSISSTSDYIF	VRDDVFGAFD	SRSYLGWY	LLIFGSSSRA	QQYSRSPL
		325	326	327	328	329	330
11	VG9B416	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	ASSYLAWY	LLIYGASSRA	QQYGSSPPY
		359	360	361	362	363	364
12	VG9B69	SSYDIN	WVSSITSSSYYIY	ARDLGVRGVDYYYYGLD	SSSYLAWY	LLIYGASSRA	QQYGSSPPY
		393	394	395	396	397	398
13	VG9B415	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	ASSYLAWY	LLIYGASSRA	QQYGSSPPY
		427	428	429	430	431	432
14	VG9B104	SVYSMN	WVSSIGSSSSYIF	GRDHDYGGLD	SSSYLAWY	LLIYGPSNRA	QQYGRSPL
		461	462	463	464	465	466
15	VG9B198	SSIYWS	WIGRIYTTDITN	AKNGYSYGGFN	IGAGYDVHWY	LLIYGDSYRP	QSYDSSLSVV
		495	496	497	498	499	500
16	VG9B463	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	IGSNTVNWY	LLIYTNTQRP	AAWDDSLNAW
		529	530	531	532	533	534
17	VG9B469	SHYDMN	WVSSISSSSSYIF	ARDRGVGDTSDYYSFGLD	SSTYLAWY	LLIYGACSRA	QQYGSSPPY
		563	564	565	566	567	568
18	VG9B428	SNYGMN	WVSYISSGSSYKY	ARDPVVTEYYYYGMD	NSWLAWY	LLIYAASSLQ	QQANSFPW
		597	598	599	600	601	602
19	VG9B430	SSYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	ASSYLAWY	LLIYGASSRA	QQYGSSPPY
		631	632	633	634	635	636
20	VG9B423	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	ASSYLAWY	LLIYGASSRA	QQYGSSPPY
		665	666	667	668	669	670
21	VG9B98	SSYSMY	WVSSIGSSSTYIF	ARDGELGPFE	STSYLAWF	LLIFGTSSRA	LQYGRSPL
		699	700	701	702	703	704
22	VG9B73	SNYDMN	WVSSISSSSSYIY	AREIGVTGITYYQDYGMD	SSNYLAWY	LLIYGASSRA	QQYGSSPPF
		733	734	735	736	737	738
23	VG9B133	SNYDMN	WVSSISSSSSYIY	ARDLGITGTTMDYYYGMD	SSSYLAWY	LLIYGASSRA	QQYGSSPPY
		767	768	769	770	771	772
24	VG9B368	NSYDMN	WVSSISSSSSYIY	ARDRGIGGDYYSYAMD	SSSYLAWY	LLIYGASSRA	QQYGSSPPY
		801	802	803	804	805	806
25	VG9B424	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	ASSYLAWY	LLIYGASSRA	QQYGSSPPY
		835	836	837	838	839	840
26	VG9B427	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	ASSYLAWY	LLIYGASSRA	QQYGSSPPY
		869	870	871	872	873	874
27	VG9B417	SNYGMN	WVSYISSGSSYKY	ARDPVVTEYYYYGMD	NSWLAWY	LLIYAASSLQ	QQANSFPW
		903	904	905	906	907	908
28	VG9B58	KSSYWT	WIGYMFYLGSTN	SRERPVLDAFD	TNYLAWF	RLIYAASSLQ	LQHDTYPY
		937	938	939	940	941	942
29	VG9B419	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	ASSYLAWY	LLIYGASSRA	QQYGSSPPY
		971	972	973	974	975	976
30	VG9B425	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	ASSYLAWY	LLIYGASSRA	QQYGSSPPY
		1005	1006	1007	1008	1009	1010
31	VG9B143	STYGMN	WISYISTSSYTIY	AREGDWWYFD	VGGYNYVSWY	LMIYEVSNRP	SSYTSSSTL
		1039	1040	1041	1042	1043	1044
32	VG9B418	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	ASSYLAWY	LLIYGASSRA	QQYGSSPPY
		1073	1074	1075	1076	1077	1078
33	VG9B472	SHYDMN	WVSSISSSSSYIF	ARDRGVGDTSDYYSFGLD	ATYLAWY	LLIYAASTLQ	QKYNSAPPW
		1107	1108	1109	1110	1111	1112
34	VG9B421	SNYGMN	WVSYISSGSSYKY	ARDPVVTEYYYYGMD	NSWLAWY	LLIYAASSLQ	QQANSFPW
		1141	1142	1143	1144	1145	1146
35	VG9B88	SSYTMN	WVSSISTSSSYID	ARDGDMVAPIKGSFD	LNSDDGNTYLDWY	LLIYTLSYRA	MQRIEFPI
		1175	1176	1177	1178	1179	1180
36	VG9B384	SSSGMCVS	WLTLIDWFDDKY	ARIRGTGAYYYGLD	DKYASWY	LVIYQDNKRP	QAWDSSKV
		1209	1210	1211	1212	1213	1214
37	VG9B413	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	ASSYLAWY	LLIYGASSRA	QQYGSSPPY
		1243	1244	1245	1246	1247	1248
38	VG9B36	SSYGMY	WVSSISTGSSYIY	ARDKGLAVTGYIMD	SNYLNWY	LLIYDASNLE	QQYDNLPMY
		1277	1278	1279	1280	1281	1282
39	VG9B403	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	ASSYLAWY	LLIYGASSRA	QQYGSSPPY
		1311	1312	1313	1314	1315	1316
40	VG9B191	SRYSMN	GVSSISSSSSYIY	ARDGPTVNWDYYFD	IGNNYVSWY	LLIYDNNKRP	GTWDSSLSTSV
		1345	1346	1347	1348	1349	1350
41	VG9B44	SSNSAAWN	WLGRTYYRSKWYND	ARESGSYYTDGFD	SSYLAWY	LLIYAASTLQ	QEFNSYPY
		1379	1380	1381	1382	1383	1384
42	VG9B67	SSYTMN	WVSSISSSSSYID	ARDGDILATIRGSFD	LDSDAGNTYLDWY	LLIYTLSYRA	MQRIEFPI
		1413	1414	1415	1416	1417	1418
43	VG9B402	SNYGMN	WVSYISSGSSYKY	ARDPVVTEYYYYGMD	NSWLAWY	LLIYAASSLQ	QQANSFPW
		1447	1448	1449	1450	1451	1452
44	VG9B127	GAYTMN	WVSSISSSSSYID	ARDGDIVSTIRGSFD	LDSDDGNTYLDWY	LLIYTLSYRA	MQRIEFPI
		1481	1482	1483	1484	1485	1486
45	VG9B137	SSYSMD	WVSSIGSSSSYIF	ATSYSWNYGGAFD	SSSYLAWY	LLIYGASSRA	QQYGSSPPY
		1515	1516	1517	1518	1519	1520
46	VG9B33	SSYNMN	WVSSISTSSSYIY	ARDTSVTKYPDTFD	NNYLAWF	LLIYGASTLQ	QKYNSAPF
		1549	1550	1551	1552	1553	1554
47	VG9B162	TGDYMH	WMGWINPNSGYTN	AREGDAFD	VGGYNYVSWY	LMIYEVSKRP	NSYAGSNNFE
		1583	1584	1585	1586	1587	1588
48	VG9B152	SSYSMI	WVSSISSSSDYIY	ARDWELLGFD	DKYACWY	LVIYQHNKRP	QAWDSTTV
		1617	1618	1619	1620	1621	1622
49	VG9B64	SISGVSVG	WLALIYWNDDKR	VHSGQWLEGDAFD	VHSDGNTYLSWL	LLIYKISNRF	MQATQFPL
		1651	1652	1653	1654	1655	1656
50	VG9B21	SNYDMN	WVSSISSSSHYIY	ARDRGVTTDYYYYALD	YNYLAWY	LLIYAASTLQ	QKYNRAPF
		1685	1686	1687	1688	1689	1690
51	VG9B128	GTYGMH	WVAVIWYNGSNKY	ARGGFGESFD	IDYLAWF	LLIYDASNRA	QQRSNWPL
		1719	1720	1721	1722	1723	1724
52	VG9B66	STYTMN	WVSSISSSSFYMD	ARDGDIVATIRGSFD	TNFLAWY	LLIYTASTLQ	QKYNSAPF
		1753	1754	1755	1756	1757	1758
53	VG9B32	SRYAMN	WVSFISGTGYTVY	ARDQEPGFD	VHSDGNTYLSWL	LLIYKISNRF	MQATHFPF
		1787	1788	1789	1790	1791	1792
54	VG9B57	SSHDMN	WVSSISSSSSYIF	ARDLGVGVRDYYYYGMD	TNYLAWF	RLIYAASSLQ	LQHDTYPY
		1821	1822	1823	1824	1825	1826
55	VG9B135	TTYGVGVG	WLALIYWNDDKR	AHDYDFWSGYFD	SSSYLAWY	LLIYGASSRA	QQYGSSPL
		1855	1856	1857	1858	1859	1860
56	VG9B60	TGYYMH	WMGRINPNSGVTH	ARGGSLVRGVISGLD	SGSYLAWY	LLIYGASSRA	QQYGSSPPY
		1889	1890	1891	1892	1893	1894
57	VG9B409	TSYYMH	WMGIINPSGGSTS	ARGSYGWYFD	TSSYLAWY	LLIYGASSRA	QQYGSSPPY
		1923	1924	1925	1926	1927	1928
58	VG9B411	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	NSWLAWY	LLIYAASTLQ	QQYNNWPR
		1957	1958	1959	1960	1961	1962
59	VG9B129	SSYCIS	WMGGILPILSTAN	ARAHDYYYGMD	SNNYLAWY	LLIYGASSRA	QQYGSSPPY
		1991	1992	1993	1994	1995	1996
60	VG9B396	RGYYWN	WIGRIFTTGNTN	AREKWDSSSSALYFD	IGADYDVKWY	LLIYGNTDRP	QSYDSRLTGYV
		2025	2026	2027	2028	2029	2030
61	VG9B470	TTSGVGVG	WLALILWNDHTI	ARDKWELRDAFD	SRYLAWY	LLIYVASTLQ	QQLISYPY
		2059	2060	2061	2062	2063	2064
62	VG9B111	STYSVN	WVSSISSDSSYIF	ARDSVTGPFD	SHYLNWY	LLIYDSYILE	QQYDNLPY
		2093	2094	2095	2096	2097	2098
63	VG9B169	TNYFWN	WIGYIFYSGSTS	ARVGRWELRTAFD	IGSNTVNWY	LLIYSNNQRP	AAWDDSLNGPG
		2127	2128	2129	2130	2131	2132
64	VG9B639	TTYRMN	WVSSISSSSIYIH	ARERVYTVSFD	SHYLNWY	LLIYDSYILE	QQYDNLPY
		2161	2162	2163	2164	2165	2166
65	VG9B201	TTHGVGVG	WLALIYWNADKH	AHEGDWGHYFD	IGNNDVSWY	LLIYDNNRRP	ETWDSSLSAIW
		2195	2196	2197	2198	2199	2200
66	VG9B161	SSYFWS	WIGYIFYSGSTN	ARVGRWELRGAFD	IGSNTVNWY	LLIYSNNQRP	AAWDDSLNSPG
		2229	2230	2231	2232	2233	2234
67	VG9B383	SSYYWN	WVGRIYTIGNTN	AREGYYDSSGSFFPGAFG	VGSYNLVSWY	LMIYAGSKRP	CSFAGATNV
		2263	2264	2265	2266	2267	2268
68	VG9B382	SGYYWN	WIGRIFTTGNTN	ARERWDSSSSALYFD	IGADYDIKWY	LLIYGNSNRP	QSYDSSMSGYV
		2297	2298	2299	2300	2301	2302
69	VG9B156	SGYFWN	WIGYIFYSGSTN	AKLGKWELRTAFD	IGSDTVNWY	LLIYSNNQRP	AAWDDSLNGP
		2331	2332	2333	2334	2335	2336
70	VG9B205	SGYFWN	WIGYIFYSGSTN	AKLGKWELRTAFD	DKYACWY	LVIYQDSKRP	QAWDSSTV
		2365	2366	2367	2368	2369	2370
71	VG9B86	SSSYWS	CIGRFYSSGSTS	ARYSGSYWYFD	SSYLAWY	LLIYDTSNRA	QQRSDWLL
		2399	2400	2401	2402	2403	2404
72	VG9B154	SYYFWN	WIGYIYYSGSTN	AREGKWELRTTFD	IGSNTVNWY	LLIYSNNQRP	AAWDDSLNGP
		2433	2434	2435	2436	2437	2438
73	VG9B159	SSYYWS	WIGRFYTGGRNN	ARDMEYYYDRSGYSYWYFD	SKSVHWY	LVVYDDSDRP	QVWDSSSDHV
		2467	2468	2469	2470	2471	2472
74	VG9B465	TSYYWN	WIGRIYTIGNTN	AREGYYESDGSFFPGAFN	VGSYNLVSWY	LMIYAGSKRP	CSYAGTTNV
		2501	2502	2503	2504	2505	2506
75	VG9B194	TGDYMH	WMGWINPNSGYTN	TRELDALD	VGGYNYVSWY	LMIYEVSKRP	NSYAGSNNFE
		2535	2536	2537	2538	2539	2540
76	VG9B182	NNHFWS	WIGFVFYNGNTN	ARVGRWVLRTAFD	IGSNTVNWY	LLIYSNNQRP	AAWDDSLNGPG
		2569	2570	2571	2572	2573	2574
77	VG9B173	NNYFWS	WIGYIYYSGSTN	AREGKWELRSAFD	IESNTVNWY	LLIYSNNQRP	TAWDDSLNGP
		2603	2604	2605	2606	2607	2608
78	VG9B87	TSEYIH	WMGIINPSGGSTS	ARERGYSYGSFD	SSYLAWY	LLIYAASTLQ	QQFNSYSL
		2637	2638	2639	2640	2641	2642
79	VG9B208	SGYYWS	LIGYIFYSGSIN	ARVGKWELRSSFD	IGNNDVSWY	LLIYDNNKRP	GTWDSSLSVW
		2671	2672	2673	2674	2675	2676
80	VG9B372	SNGGFYWS	WLGYINYSGSTY	ARDRNYEWNFD	SSYLAWY	LLVYDASNRA	QQRSNWPL
		2705	2706	2707	2708	2709	2710
81	VG9B186	TNIRMSVS	WLAHIFSNDEKS	ARMRLPYGMD	IGSNTVNWY	LLIYSNNQRP	AAWDDSLNGP
		2739	2740	2741	2742	2743	2744
82	VG9B177	NNYFWS	WIGYIFYSGSTN	ARVGKWELRTAFD	VADYNYVSWY	LMIYEVSNRP	CSYTSSFTV
		2773	2774	2775	2776	2777	2778
83	VG9B114	SRYDMH	WVSAIGSAGDTY	ARGKWELRDAFD	HSYLAWY	LLIYVASTLQ	QQLNSYPY
		2807	2808	2809	2810	2811	2812
84	VG9B147	SGYFWN	WIGYIFYSGSTN	AREGKWELRSTFD	SYYATWY	LVIYGENNRP	NSRDTGDHHL
		2841	2842	2843	2844	2845	2846
85	VG9B65	NIYAIN	WMGGIIPFFGTAN	ARGGDSGYDWGFD	VHSDGNTYLSWL	LLIYQISNRF	MQATQFPL
		2875	2876	2877	2878	2879	2880
86	VG9B81	NTYYWS	LIGRIYTSDNTN	ARYNWNYWYFD	SSYLAWY	LLIYTASTLQ	QHLNSYPY
		2909	2910	2911	2912	2913	2914
87	VG9B203	GHYYWN	WIGRIYTSGSTN	ARSGGNFYWYFD	IGNNYVSWY	LLIYDNNKRP	GTWDSSLSAG
		2943	2944	2945	2946	2947	2948
88	VG9B380	SNYYWS	WIGRIYPSGITS	AGIMGTKGAFD	VGGYNYVSWY	LLIYEVSNRP	SSYTSTSV
		2977	2978	2979	2980	2981	2982
89	VG9B103	SSYAIS	WMGGIIPIFGTAT	ARGVGWGTDYYYGLD	VHSDGNTYLSWL	LLIYKISNRF	MQATHHPL
		3011	3012	3013	3014	3015	3016
90	VG9B462	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3045	3046	3047	3048	3049	3050
91	VG9B461	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3079	3080	3081	3082	3083	3084
92	VG9B106	TGYYLH	WVGWINPSSGDTD	ANELGIGVFD	LYSSNNKNYLGWY	LLIYWASTRE	QQYYSIPY
		3113	3114	3115	3116	3117	3118
93	VG9B115	STYGVGVG	WLALIYWNDDKR	SHESDWSYYFD	SSYLAWY	LLIYDASNRA	QQRSSWPW
		3147	3148	3149	3150	3151	3152
94	VG9B27	SSYVIS	WMGGILPILSTAN	ARAHDYYYGMD	VHSDGNTYLSWL	LLVYKISNRF	MQATHHPL
		3181	3182	3183	3184	3185	3186
95	VG9B458	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3215	3216	3217	3218	3219	3220
96	VG9B131	SSYDMN	WVSYISSSSTAKY	AREDIVVVTPILQ	SNYLAWY	LLIYDASNRA	QQRSNW
		3249	3250	3251	3252	3253	3254
97	VG9B163	SNHGMS	WVASITRGGDTTY	TRGPLTVGYAMD	IGHNYVSWY	LLIYDNNQRP	GIWDSSLSIV
		3283	3284	3285	3286	3287	3288
98	VG9B454	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3317	3318	3319	3320	3321	3322
99	VG9B439	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3351	3352	3353	3354	3355	3356
100	VG9B68	STYAIS	WMGGIIPIFGTAT	ARGVGWGSDYYYGLD	VHSDGNTYLSWL	LLIYKISNRF	IQATHHPL
		3385	3386	3387	3388	3389	3390
101	VG9B449	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3419	3420	3421	3422	3423	3424
102	VG9B204	SSFYWS	WIGRIYTSGGTI	ARWLRAFD	DKYACWY	LVIYQDSKRP	QAWDSSTV
		3453	3454	3455	3456	3457	3458
103	VG9B459	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3487	3488	3489	3490	3491	3492
104	VG9B157	SNHGMS	WVASITRGGDTTY	TRGPLTVGYAMD	SYYATWY	LVIYGENNRP	NSRDTGDHHL
		3521	3522	3523	3524	3525	3526
105	VG9B453	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3555	3556	3557	3558	3559	3560
106	VG9B443	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3589	3590	3591	3592	3593	3594
107	VG9B455	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3623	3624	3625	3626	3627	3628
108	VG9B466	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3657	3658	3659	3660	3661	3662
109	VG9B450	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3691	3692	3693	3694	3695	3696
110	VG9B438	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3725	3726	3727	3728	3729	3730
111	VG9B464	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3759	3760	3761	3762	3763	3764
112	VG9B437	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3793	3794	3795	3796	3797	3798
113	VG9B457	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3827	3828	3829	3830	3831	3832
114	VG9B442	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3861	3862	3863	3864	3865	3866
115	VG9B436	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3895	3896	3897	3898	3899	3900
116	VG9B434	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3929	3930	3931	3932	3933	3934
117	VG9B460	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		3963	3964	3965	3966	3967	3968
118	VG9B189	SNHGMS	WVASITRGGDTTY	TRGPLTVGYAMD	VGGYNYVSWY	LMIYEVSKRP	NSYAGSNNFE
		3997	3998	3999	4000	4001	4002
119	VG9B452	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		4031	4032	4033	4034	4035	4036
120	VG9B53	SSYYWS	WIGRIHTIGSIN	AMEGVGATNYYYGMA	LHSNGYNYLDWY	LLIYLGSNRA	MQALQTPY
		4065	4066	4067	4068	4069	4070
121	VG9B41	TTYWMH	WIGLIDPSDSETR	ASNRWLL	VHSDGNTYLSWL	LLIYKISNRF	VQTREFPL
		4099	4100	4101	4102	4103	4104
122	VG9B136	SSNRAAWN	WLGRTYYRSKWYNE	ARDLWELREACD	SSYLAWY	LLIYVASTLQ	QQLNSYPF
		4133	4134	4135	4136	4137	4138
123	VG9B399	SNYDMN	WVSSISSSSSYIY	ARDVGVTTDYYYYGMD	ASSYLAWY	LLIYGASSRA	QQYGSSPPY
		4167	4168	4169	4170	4171	4172
124	VG9B369	STIGVGVG	WLSLIYWNDDKR	AHSHDWVHAFD	SHYLNWY	FLIYDASNLD	QQYDNFPL
		4201	4202	4203	4204	4205	4206
125	VG9B144	TGYYMH	WMGWINPNSGATN	AREDDAFD	NYYATWF	LVFFGKNNRP	NSRDSSGNHV
		4235	4236	4237	4238	4239	4240
126	VG9B410	SNYGMN	WVSYISSGSSYKY	ARDPVVTEYYYYGMD	NSWLAWY	LLIYAASSLQ	QQANSFPW
		4269	4270	4271	4272	4273	4274
127	VG9B386	SSYSMI	WVSSIGSSSTYIY	ARDGETGGFD	SRSYLAWY	LLIYGPSNRA	QQYGSLPL
		4303	4304	4305	4306	4307	4308
128	VG9B125	SSYDMN	WVSYISSSSTAKY	AREDIVVVTPILQ	SKDLAWY	LLIYDASNRA	QQRINWPLF
		4337	4338	4339	4340	4341	4342
129	VG9B112	SSNSAAWN	WLGGTYYRSKWFNN	ARGEWGLRDAFD	HSYLAWY	LLIYVASTLQ	QQLNSYPW
		4371	4372	4373	4374	4375	4376
130	VG9B371	SSYDMN	WVSSISSSSSYIY	ARDRGVGGTDYYYYGLD	SSSYLAWY	LLIYGASSRA	QQYGSSPPY
		4405	4406	4407	4408	4409	4410
131	VG9B387	TGYYLQ	WMGWINPNSGYTD	ARLDDAFD	NYYAIWY	LVIFGKNNRP	NSRDSSGNHW
		4439	4440	4441	4442	4443	4444
132	VG9B47	SNYAIS	WMGGIIPFFGTPD	STGGGYGDYDYYYGIN	VHSDGNTYLSWL	LLIYKISNRF	MQAKEFPL
		4473	4474	4475	4476	4477	4478
133	VG9B379	TGDYIH	WMGWINPNSGGTN	AREGGVAPAAPDAFD	SYYARWY	VVIYGKNNRP	NSRDSSGNHR
		4507	4508	4509	4510	4511	4512
134	VG9B447	SNYYWS	WIGRIYSSGITN	AGIVGVKGAFA	VGGYNYVSWY	LMIYEVSNRP	SSYTSTSV
		4541	4542	4543	4544	4545	4546
135	VG9B392	TGYYIH	WMGWINPNSGYTN	AREDDAFD	SYYARWY	LVIYGKNNRP	NSRDNSGNHV
		4575	4576	4577	4578	4579	4580
136	VG9B96	SNYAIS	WMGGIIPIFSAGT	SSNSGTYYDYYYGMD	VHSDGNTYLSWL	LLIYKIFNRL	MQAKQFPL
		4609	4610	4611	4612	4613	4614
137	VG9B77	SSYAIS	WMGGIIPFFGTAD	ATATVTTDYYYGMD	VHSDGNTYLSWL	LLIYEISNRF	MQARQFPL
		4643	4644	4645	4646	4647	4648

TABLE 7
IMGT CDR Amino Acid Sequences (SEQ ID NO
disclosed in the cell under each respective sequence)
	Protein	HC IMGT	HC IMGT	HC IMGT	LC IMGT	LC IMGT	LC IMGT
#	Name	CDR1	CDR2	CDR3	CDR1	CDR2	CDR3
1	VG9B54	GFAFSSYS	ISSSSSYI	ATDGELGPFDY	QSVSSSY	GAS	QQYGRSPLT
		25	26	27	28		30
2	VG9B121	GFTFSDYA	ISSTSNYI	ANSYNWNYGGAFDI	QSVSSSY	GAS	QQYGRSPLT
		59	60	61	62		64
3	VG9B429	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QGINSW	AAS	QQANSFPWT
		93	94	95	96		98
4	VG9B370	RFTLSSYD	ISSSSSYI	ARDRGVGGTDYYYYGLDV	QSVSSSY	GAS	QQYGSSPPYT
		127	128	129	130		132
5	VG9B80	GFTFSTYS	ISSSSSYI	AKDGELGVFDY	QSISSSY	GPS	QQFGRSPLT
		161	162	163	164		166
6	VG9B414	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QGINSW	AAS	QQANSFPWT
		195	196	197	198		200
7	VG9B195	GFTFSPYT	ISSSSSYM	ARDGDLVGPTYYFDY	KLGDKY	QHN	QAWDSTTVV
		229	230	231	232		234
8	VG9B140	GFTFRSYD	ISTSSGYI	ARDRGIAVAGDYYYGMDV	QSVSSSY	GAS	QQYGSSPPYT
		263	264	265	266		268
9	VG9B426	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QSVASSY	GAS	QQYGSSPPYT
		297	298	299	300		302
10	VG9B46	GFTFSINS	ISSTSDYI	VRDDVFGAFDI	QSVSRSY	GSS	QQYSRSPLT
		331	332	333	334		336
11	VG9B416	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QSVASSY	GAS	QQYGSSPPYT
		365	366	367	368		370
12	VG9B69	GFTFSSYD	ITSSSYYI	ARDLGVRGVDYYYYGLDV	QSVSSSY	GAS	QQYGSSPPYT
		399	400	401	402		404
13	VG9B415	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QSVASSY	GAS	QQYGSSPPYT
		433	434	435	436		438
14	VG9B104	GFTFSVYS	IGSSSSYI	GRDHDYGGLDY	QSVSSSY	GPS	QQYGRSPLT
		467	468	469	470		472
15	VG9B198	GDSISSIY	IYTTDIT	AKNGYSYGGFNY	SSNIGAGYD	GDS	QSYDSSLSVVV
		501	502	503	504		506
16	VG9B463	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	SSNIGSNT	TNT	AAWDDSLNAWV
		535	536	537	538		540
17	VG9B469	GFTFSHYD	ISSSSSYI	ARDRGVGDTSDYYSFGLDV	QNVSSTY	GAC	QQYGSSPPYT
		569	570	571	572		574
18	VG9B428	GFTFSNYG	ISSGSSYK	ARDPVVTEYYYYGMDV	QGINSW	AAS	QQANSFPWT
		603	604	605	606		608
19	VG9B430	GFTFSSYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QSVASSY	GAS	QQYGSSPPYT
		637	638	639	640		642
20	VG9B423	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QSVASSY	GAS	QQYGSSPPYT
		671	672	673	674		676
21	VG9B98	GFTFSSYS	IGSSSTYI	ARDGELGPFEY	QSVSTSY	GTS	LQYGRSPLT
		705	706	707	708		710
22	VG9B73	GFTFSNYD	ISSSSSYI	AREIGVTGTTYYQDYGMDV	QSFSSNY	GAS	QQYGSSPPFT
		739	740	741	742		744
23	VG9B133	GFTFSNYD	ISSSSSYI	ARDLGITGTTMDYYYGMDV	QSVSSSY	GAS	QQYGSSPPYT
		773	774	775	776		778
24	VG9B368	GFTFNSYD	ISSSSSYI	ARDRGIGGDYYSYAMDV	QSVSSSY	GAS	QQYGSSPPYT
		807	808	809	810		812
25	VG9B424	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QSVASSY	GAS	QQYGSSPPYT
		841	842	843	844		846
26	VG9B427	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QSVASSY	GAS	QQYGSSPPYT
		875	876	877	878		880
27	VG9B417	GFTFSNYG	ISSGSSYK	ARDPVVTEYYYYGMDV	QGINSW	AAS	QQANSFPWT
		909	910	911	912		914
28	VG9B58	GGSIKSSY	MFYLGST	SRERPVLDAFDI	QDITNY	AAS	LQHDTYPYT
		943	944	945	946		948
29	VG9B419	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QSVASSY	GAS	QQYGSSPPYT
		977	978	979	980		982
30	VG9B425	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QSVASSY	GAS	QQYGSSPPYT
		1011	1012	1013	1014		1016
31	VG9B143	GFTFSTYG	ISTSSYTI	AREGDWWYFDL	SSDVGGYNY	EVS	SSYTSSSTLV
		1045	1046	1047	1048		1050
32	VG9B418	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QSVASSY	GAS	QQYGSSPPYT
		1079	1080	1081	1082		1084
33	VG9B472	GFTFSHYD	ISSSSSYI	ARDRGVGDTSDYYSFGLDV	QGIATY	AAS	QKYNSAPPWT
		1113	1114	1115	1116		1118
34	VG9B421	GFTFSNYG	ISSGSSYK	ARDPVVTEYYYYGMDV	QGINSW	AAS	QQANSFPWT
		1147	1148	1149	1150		1152
35	VG9B88	GFTFSSYT	ISTSSSYI	ARDGDMVAPIKGSFDY	QSLLNSDDGNTY	TLS	MQRIEFPIT
		1181	1182	1183	1184		1186
36	VG9B384	GFSLSSSGMC	IDWFDDK	ARIRGTGAYYYGLDV	ELGDKY	QDN	QAWDSSKVV
		1215	1216	1217	1218		1220
37	VG9B413	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QSVASSY	GAS	QQYGSSPPYT
		1249	1250	1251	1252		1254
38	VG9B36	GFTFSSYG	ISTGSSYI	ARDKGLAVTGYIMDV	QDISNY	DAS	QQYDNLPMYT
		1283	1284	1285	1286		1288
39	VG9B403	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QSVASSY	GAS	QQYGSSPPYT
		1317	1318	1319	1320		1322
40	VG9B191	GFTFSRYS	ISSSSSYI	ARDGPTVNWDYYFDL	SSNIGNNY	DNN	GTWDSSLSTSVV
		1351	1352	1353	1354		1356
41	VG9B44	GDSVSSNSAA	TYYRSKWYN	ARESGSYYTDGFDI	QGISSY	AAS	QEFNSYPYT
		1385	1386	1387	1388		1390
42	VG9B67	GFTFSSYT	ISSSSSYI	ARDGDILATIRGSFDY	QSLLDSDAGNTY	TLS	MQRIEFPIT
		1419	1420	1421	1422		1424
43	VG9B402	GFTFSNYG	ISSGSSYK	ARDPVVTEYYYYGMDV	QGINSW	AAS	QQANSFPWT
		1453	1454	1455	1456		1458
44	VG9B127	GFTFGAYT	ISSSSSYI	ARDGDIVSTIRGSFDY	QSLLDSDDGNTY	TLS	MQRIEFPIT
		1487	1488	1489	1490		1492
45	VG9B137	GITFSSYS	IGSSSSYI	ATSYSWNYGGAFDI	QSVSSSY	GAS	QQYGSSPPYT
		1521	1522	1523	1524		1526
46	VG9B33	GFTFSSYN	ISTSSSYI	ARDTSVTKYPDTFDI	QDINNY	GAS	QKYNSAPFT
		1555	1556	1557	1558		1560
47	VG9B162	GYTFTGDY	INPNSGYT	AREGDAFDV	SSDVGGYNY	EVS	NSYAGSNNFEV
		1589	1590	1591	1592		1594
48	VG9B152	GFTFSSYS	ISSSSDYI	ARDWELLGFDC	KLGDKY	QHN	QAWDSTTVV
		1623	1624	1625	1626		1628
49	VG9B64	GFSLSISGVS	IYWNDDK	VHSGQWLEGDAFDI	ESLVHSDGNTY	KIS	MQATQFPLT
		1657	1658	1659	1660		1662
50	VG9B21	GFSFSNYD	ISSSSHYI	ARDRGVTTDYYYYALDV	QGIYNY	AAS	QKYNRAPFT
		1691	1692	1693	1694		1696
51	VG9B128	GFTFGTYG	IWYNGSNK	ARGGFGESFDS	QSVIDY	DAS	QQRSNWPLT
		1725	1726	1727	1728		1730
52	VG9B66	GFTFSTYT	ISSSSFYM	ARDGDIVATIRGSFDY	QDITNF	TAS	QKYNSAPFT
		1759	1760	1761	1762		1764
53	VG9B32	GFTFSRYA	ISGTGYTV	ARDQEPGFDY	QSLVHSDGNTY	KIS	MQATHFPFT
		1793	1794	1795	1796		1798
54	VG9B57	GFTFSSHD	ISSSSSYI	ARDLGVGVRDYYYYGMDV	QDITNY	AAS	LQHDTYPYT
		1827	1828	1829	1830		1832
55	VG9B135	GFSLTTYGVG	IYWNDDK	AHDYDFWSGYFDY	QSVSSSY	GAS	QQYGSSPLT
		1861	1862	1863	1864		1866
56	VG9B60	GYTFTGYY	INPNSGVT	ARGGSLVRGVISGLDY	QSFSGSY	GAS	QQYGSSPPYT
		1895	1896	1897	1898		1900
57	VG9B409	GYTLTSYY	INPSGGST	ARGSYGWYFDL	QSVTSSY	GAS	QQYGSSPPYT
		1929	1930	1931	1932		1934
58	VG9B411	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QGINSW	AAS	QQYNNWPRT
		1963	1964	1965	1966		1968
59	VG9B129	GGTFSSYV	ILPILSTA	ARAHDYYYGMDV	QSVSNNY	GAS	QQYGSSPPYT
		1997	1998	1999	2000		2002
60	VG9B396	GDSIRGYY	IFTTGNT	AREKWDSSSSALYFDF	SSNIGADYD	GNT	QSYDSRLTGYVV
		2031	2032	2033	2034		2036
61	VG9B470	GFSLTTSGVG	ILWNDHT	ARDKWELRDAFDI	QGISRY	VAS	QQLISYPYT
		2065	2066	2067	2068		2070
62	VG9B111	GFTFSTYS	ISSDSSYI	ARDSVTGPFDY	QDISHY	DSY	QQYDNLPYT
		2099	2100	2101	2102		2104
63	VG9B169	GGSITNYF	IFYSGST	ARVGRWELRTAFDI	SSNIGSNT	SNN	AAWDDSLNGPGV
		2133	2134	2135	2136		2138
64	VG9B639	GFTFTTYR	ISSSSIYI	ARERVYTVSFDY	QDISHY	DSY	QQYDNLPYT
		2167	2168	2169	2170		2172
65	VG9B201	GFSLTTHGVG	IYWNADK	AHEGDWGHYFDF	SSNIGNND	DNN	ETWDSSLSAIWV
		2201	2202	2203	2204		2206
66	VG9B161	GGSISSYF	IFYSGST	ARVGRWELRGAFDI	SSNIGSNT	SNN	AAWDDSLNSPGV
		2235	2236	2237	2238		2240
67	VG9B383	SGSISSYY	IYTIGNT	AREGYYDSSGSFFPGAFGI	SNDVGSYNL	AGS	CSFAGATNVV
		2269	2270	2271	2272		2274
68	VG9B382	GDSISGYY	IFTTGNT	ARERWDSSSSALYFDY	SSNIGADYD	GNS	QSYDSSMSGYVV
		2303	2304	2305	2306		2308
69	VG9B156	NGSISGYF	IFYSGST	AKLGKWELRTAFDI	TSNIGSDT	SNN	AAWDDSLNGPV
		2337	2338	2339	2340		2342
70	VG9B205	NGSISGYF	IFYSGST	AKLGKWELRTAFDI	KLGDKY	QDS	QAWDSSTVV
		2371	2372	2373	2374		2376
71	VG9B86	GDSISSSY	FYSSGST	ARYSGSYWYFDL	QSVSSY	DTS	QQRSDWLLT
		2405	2406	2407	2408		2410
72	VG9B154	GGSISYYF	IYYSGST	AREGKWELRTTFDI	SSNIGSNT	SNN	AAWDDSLNGPV
		2439	2440	2441	2442		2444
73	VG9B159	GGSISSYY	FYTGGRN	ARDMEYYYDRSGYSYWYFDL	NIGSKS	DDS	QVWDSSSDHVV
		2473	2474	2475	2476		2478
74	VG9B465	GGSITSYY	IYTIGNT	AREGYYESDGSFFPGAFNI	SNDVGSYNL	AGS	CSYAGTTNVV
		2507	2508	2509	2510		2512
75	VG9B194	GYTFTGDY	INPNSGYT	TRELDALDV	SSDVGGYNY	EVS	NSYAGSNNFEV
		2541	2542	2543	2544		2546
76	VG9B182	GDSINNHF	VFYNGNT	ARVGRWVLRTAFDI	SSNIGSNT	SNN	AAWDDSLNGPGV
		2575	2576	2577	2578		2580
77	VG9B173	GGSINNYF	IYYSGST	AREGKWELRSAFDI	SSNIESNT	SNN	TAWDDSLNGPV
		2609	2610	2611	2612		2614
78	VG9B87	GYTFTSEY	INPSGGST	ARERGYSYGSFDY	QGISSY	AAS	QQFNSYSLT
		2643	2644	2645	2646		2648
79	VG9B208	GGSISGYY	IFYSGSI	ARVGKWELRSSFDI	TSNIGNND	DNN	GTWDSSLSVWV
		2677	2678	2679	2680		2682
80	VG9B372	GGSISNGGFY	INYSGST	ARDRNYEWNFDL	QSVSSY	DAS	QQRSNWPLT
		2711	2712	2713	2714		2716
81	VG9B186	GFSLTNIRMS	IFSNDEK	ARMRLPYGMDV	TSNIGSNT	SNN	AAWDDSLNGPV
		2745	2746	2747	2748		2750
82	VG9B177	GGSINNYF	IFYSGST	ARVGKWELRTAFDI	SSDVADYNY	EVS	CSYTSSFTVV
		2779	2780	2781	2782		2784
83	VG9B114	GFTFSRYD	IGSAGDT	ARGKWELRDAFDI	QGIHSY	VAS	QQLNSYPYT
		2813	2814	2815	2816		2818
84	VG9B147	GGSISGYF	IFYSGST	AREGKWELRSTFDI	SLRSYY	GEN	NSRDTGDHHLV
		2847	2848	2849	2850		2852
85	VG9B65	GGTFNIYA	IIPFFGTA	ARGGDSGYDWGFDY	QSLVHSDGNTY	QIS	MQATQFPLT
		2881	2882	2883	2884		2886
86	VG9B81	GGSINTYY	IYTSDNT	ARYNWNYWYFDL	QGISSY	TAS	QHLNSYPYT
		2915	2916	2917	2918		2920
87	VG9B203	GDSIGHYY	IYTSGST	ARSGGNFYWYFDL	SSNIGNNY	DNN	GTWDSSLSAGV
		2949	2950	2951	2952		2954
88	VG9B380	GGSISNYY	IYPSGIT	AGIMGTKGAFDI	SSDVGGYNY	EVS	SSYTSTSVV
		2983	2984	2985	2986		2988
89	VG9B103	GGTFSSYA	IIPIFGTA	ARGVGWGTDYYYGLDV	QGLVHSDGNTY	KIS	MQATHHPLT
		3017	3018	3019	3020		3022
90	VG9B462	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3051	3052	3053	3054		3056
91	VG9B461	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3085	3086	3087	3088		3090
92	VG9B106	GYTFTGYY	INPSSGDT	ANELGIGVFDY	QSVLYSSNNKNY	WAS	QQYYSIPYT
		3119	3120	3121	3122		3124
93	VG9B115	GFSLSTYGVG	IYWNDDK	SHESDWSYYFDY	QSVSSY	DAS	QQRSSWPWT
		3153	3154	3155	3156		3158
94	VG9B27	GGTFSSYV	ILPILSTA	ARAHDYYYGMDV	QSLVHSDGNTY	KIS	MQATHHPLT
		3187	3188	3189	3190		3192
95	VG9B458	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3221	3222	3223	3224		3226
96	VG9B131	GFTFSSYD	ISSSSTAK	AREDIVVVTPILQH	QSVSNY	DAS	QQRSNWT
		3255	3256	3257	3258		3260
97	VG9B163	GFTFSNHG	ITRGGDTT	TRGPLTVGYAMDY	SSNIGHNY	DNN	GIWDSSLSIVV
		3289	3290	3291	3292		3294
98	VG9B454	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3323	3324	3325	3326		3328
99	VG9B439	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3357	3358	3359	3360		3362
100	VG9B68	GGTFSTYA	IIPIFGTA	ARGVGWGSDYYYGLDV	QSLVHSDGNTY	KIS	IQATHHPLT
		3391	3392	3393	3394		3396
101	VG9B449	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3425	3426	3427	3428		3430
102	VG9B204	YGSFSSFY	IYTSGGT	ARWLRAFDY	KLGDKY	QDS	QAWDSSTVV
		3459	3460	3461	3462		3464
103	VG9B459	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3493	3494	3495	3496		3498
104	VG9B157	GFTFSNHG	ITRGGDTT	TRGPLTVGYAMDY	SLRSYY	GEN	NSRDTGDHHLV
		3527	3528	3529	3530		3532
105	VG9B453	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3561	3562	3563	3564		3566
106	VG9B443	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3595	3596	3597	3598		3600
107	VG9B455	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3629	3630	3631	3632		3634
108	VG9B466	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3663	3664	3665	3666		3668
109	VG9B450	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3697	3698	3699	3700		3702
110	VG9B438	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3731	3732	3733	3734		3736
111	VG9B464	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3765	3766	3767	3768		3770
112	VG9B437	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3799	3800	3801	3802		3804
113	VG9B457	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3833	3834	3835	3836		3838
114	VG9B442	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3867	3868	3869	3870		3872
115	VG9B436	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3901	3902	3903	3904		3906
116	VG9B434	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3935	3936	3937	3938		3940
117	VG9B460	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		3969	3970	3971	3972		3974
118	VG9B189	GFTFSNHG	ITRGGDTT	TRGPLTVGYAMDY	SSDVGGYNY	EVS	NSYAGSNNFEV
		4003	4004	4005	4006		4008
119	VG9B452	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		4037	4038	4039	4040		4042
120	VG9B53	GGSISSYY	IHTIGSI	AMEGVGATNYYYGMAV	QSLLHSNGYNY	LGS	MQALQTPYT
		4071	4072	4073	4074		4076
121	VG9B41	GYSFTTYW	IDPSDSET	ASNRWLLG	QSLVHSDGNTY	KIS	VQTREFPLT
		4105	4106	4107	4108		4110
122	VG9B136	GDSVSSNRAA	TYYRSKWYN	ARDLWELREACDI	QGISSY	VAS	QQLNSYPFT
		4139	4140	4141	4142		4144
123	VG9B399	GFTFSNYD	ISSSSSYI	ARDVGVTTDYYYYGMDV	QSVASSY	GAS	QQYGSSPPYT
		4173	4174	4175	4176		4178
124	VG9B369	GFSLSTIGVG	IYWNDDK	AHSHDWVHAFDI	QDISHY	DAS	QQYDNFPLT
		4207	4208	4209	4210		4212
125	VG9B144	GYTFTGYY	INPNSGAT	AREDDAFDV	NLRNYY	GKN	NSRDSSGNHVV
		4241	4242	4243	4244		4246
126	VG9B410	GFTFSNYG	ISSGSSYK	ARDPVVTEYYYYGMDV	QGINSW	AAS	QQANSFPWT
		4275	4276	4277	4278		4280
127	VG9B386	GFTFSSYS	IGSSSTYI	ARDGETGGFDY	QSISRSY	GPS	QQYGSLPLT
		4309	4310	4311	4312		4314
128	VG9B125	GFTFSSYD	ISSSSTAK	AREDIVVVTPILQH	QSVSKD	DAS	QQRINWPLFT
		4343	4344	4345	4346		4348
129	VG9B112	GDSVSSNSAA	TYYRSKWFN	ARGEWGLRDAFDI	QGIHSY	VAS	QQLNSYPWT
		4377	4378	4379	4380		4382
130	VG9B371	RFTLSSYD	ISSSSSYI	ARDRGVGGTDYYYYGLDV	QSVSSSY	GAS	QQYGSSPPYT
		4411	4412	4413	4414		4416
131	VG9B387	GFTFTGYY	INPNSGYT	ARLDDAFDV	SLRNYY	GKN	NSRDSSGNHWV
		4445	4446	4447	4448		4450
132	VG9B47	GGSFSNYA	IIPFFGTP	STGGGYGDYDYYYGINV	QSLVHSDGNTY	KIS	MQAKEFPLT
		4479	4480	4481	4482		4484
133	VG9B379	GYTFTGDY	INPNSGGT	AREGGVAPAAPDAFDI	SLRSYY	GKN	NSRDSSGNHRV
		4513	4514	4515	4516		4518
134	VG9B447	GGSISNYY	IYSSGIT	AGIVGVKGAFAI	SSDVGGYNY	EVS	SSYTSTSVV
		4547	4548	4549	4550		4552
135	VG9B392	GYTFTGYY	INPNSGYT	AREDDAFDI	SLRSYY	GKN	NSRDNSGNHVV
		4581	4582	4583	4584		4586
136	VG9B96	GGTFSNYA	IIPIFSAG	SSNSGTYYDYYYGMDV	QSLVHSDGNTY	KIF	MQAKQFPLT
		4615	4616	4617	4618		4620
137	VG9B77	GGTFSSYA	IIPFFGTA	ATATVTTDYYYGMDV	QSLVHSDGNTY	EIS	MQARQFPLT
		4649	4650	4651	4652		4654

Variable Region Cloning. Both RNA purified by QIAGEN kit (RNEASY Plus Mini Kit) and B cells lysate were used for cDNA synthesis using the Smarter cDNA synthesis kit (Clontech, Mount View, CA). To facilitate cDNA synthesis, oligodT was used to prime reverse transcription of all messenger RNAs followed by “5′ capping” with a Smarter IIA oligonucleotide. Subsequent amplification of the VH and VL fragments was performed using a two-step PCR amplification using 5′ primers targeting the SMARTER IIA cap and 3′ primers targeting consensus regions in CH1. Briefly, each 50 μl PCR reaction consists of 20 pM of forward and reverse primer mixes, 25 μl of PRIMIESTAR MAX DNA polymerase premix (Clontech), 2 μl of unpurified cDNA, and 21 μl of double-distilled H2O. The cycling program started at 94° C. for 3 min., followed by 35 cycles (94° C. for 30 sec., 55° C. for 1 min., 68° C. for 1 min.), and ended at 72° C. for 7 min. The second round PCR was performed with VL and VH second round primers containing 15 bp complementary extensions that “overlap” respective regions in their respective Lonza mother vector (VH and VL). Second round PCR was performed with the following program: 94° C. for 3 min.; 35 cycles (94° C. for 30 sec., 55° C. for 1 min., 68° C. for 1 min.), and ended at 72° C. for 7 min. IN-FUSION® HD Cloning Kit (Clonetech, U.S.A.) was used for directional cloning of VL gene into Lonza huIgK or Lambda vector and VH gene into Lonza huIgG1 vector. To facilitate IN-FUSION® HD Cloning, PCR products were treated with Cloning Enhancer before IN-FUSION HD Cloning. Cloning and transformation were performed according to manufacturer's protocol (Clonetech, U.S.A.). Mini-prep DNAs were subjected to Sanger sequencing to confirm that complete V-gene fragments were obtained.

1.3 Binding Activity of TRGV9, TRDV2 and TRGDC Antibodies on Target Cell Lines.

Binding of antibodies to human γδ T cells or SKW cell lines expressing Vγ9/Vδ2, Vγ9/Vδ2 or Vγ5/Vδ2 was carried out by flow cytometry. Briefly, the cells were centrifuged at 300×g for 5 minutes and the pellet was resuspended in 34 ml fresh media (in RPMI+10% FBS). 50 μL of the cells were then plated (44K cells/well) into assay plates. Samples were incubated for one hour at 37° C. in tissue culture (TC) incubator followed by wash steps by adding 100 μl FACS staining buffer. Secondary detention antibodies (A647 conjugated anti-human IgG Fc specific antibody (2 pg/mL) along with AF488 anti mouse CD3, clone OKT3 at 1 μg/mL) were added at 50 μL/well to appropriate wells according to the plate map. After incubating for 60 minutes at 37° C. in the TC incubator, cells were again washed as described above. This is followed by resuspension in 20 μL/well running buffer containing 1:1000 dilution of Sytox blue dead cell stain and the plates were run on iQue Screener.

Gating and data analysis: Human ant-human Vγ9 antibody (VG9B2 mAb at 10 nM) was used to mark the gating of positive population. All cells were first gated for singlets on SCS-A vs. SCS-H dot plot, live/dead followed by CD3 positive population, and this subset of CD3 positive population was gated for Vγ9 positive binding using positive control mAb. Cells were also assessed for cell binding of control mAbs by RL1 (A647) Geomeans from the live cell population. Advanced metrics were used and normalization metrics were chosen to calculate fold over background wells containing secondary antibody alone (designated as ‘background’ within ForeCyt settings). The results were exported to GeneData screener to graph and summarize results, which are shown in Table 8.

TABLE 8
Antibody Binding
	SKW-Cell Lines
				DRC Binding	DRC Binding	DRC Binding
				Flow 37° C.:	Flow 37° C.:	Flow 37° C.:
			Human	AG000003284	AG000003287	AG000003285
			γδ T cells	(SKW3_4	(SKW3	(SKW3
			DRC Binding	expressing	expressing	expressing
			Flow 37° C.:	Vg9/Vd2)	Vg9/Vd1)	Vg5/Vd2)
			AG000003021	[CLI000001324	[CLI000001326	[CLI000001325
	Protein		(γδ T cells)	(C3819A)]	(C3821A)]	(C3820A)]
#	Name	Specificity	Max. Activity	Max. Activity	Max. Activity	Max. Activity
1	VG9B54	Vg9	4287.92	165.54	348.47	2.49
2	VG9B121	Vg9	3666.93	160.56	360.43	18.44
3	VG9B429	Vg9	3637.59	177.29	420.69	1.76
4	VG9B370	Vg9	3529.08	183.63	424.06	2.63
5	VG9B80	Vg9	3480.37	133.20	313.72	2.24
6	VG9B414	Vg9	3295.02	195.62	498.04	10.02
7	VG9B195	Vg9	3257.31	119.35	299.67	10.31
8	VG9B140	Vg9	3226.11	133.46	325.32	2.78
9	VG9B426	Vg9	3212.79	154.44	339.73	2.40
10	VG9B46	Vg9	3207.94	164.92	349.12	1.95
11	VG9B416	Vg9	3122.34	180.59	420.36	1.91
12	VG9B69	Vg9	3109.88	147.17	341.06	3.35
13	VG9B415	Vg9	3077.36	173.88	411.15	2.66
14	VG9B104	Vg9	3052.98	147.85	358.46	1.90
15	VG9B198	Vg9	3042.49	160.00	372.45	1.89
16	VG9B463	Vg9	3032.24	144.29	321.13	4.19
17	VG9B469	Vg9	3003.65	168.31	399.44	1.44
18	VG9B428	Vg9	2984.79	162.05	346.00	2.86
19	VG9B430	Vg9	2965.48	142.74	324.73	1.49
20	VG9B423	Vg9	2963.87	155.60	344.61	2.87
21	VG9B98	Vg9	2879.14	153.54	343.86	2.47
22	VG9B73	Vg9	2844.52	117.98	317.45	1.79
23	VG9B133	Vg9	2835.38	143.97	307.41	5.97
24	VG9B368	Vg9	2784.27	185.70	398.79	3.23
25	VG9B424	Vg9	2782.65	154.63	341.58	19.79
26	VG9B427	Vg9	2728.10	151.51	344.45	1.82
27	VG9B417	Vg9	2698.70	169.62	424.38	2.15
28	VG9B58	Vg9	2694.07	159.70	350.03	1.49
29	VG9B419	Vg9	2689.29	171.96	400.28	1.87
30	VG9B425	Vg9	2664.04	155.86	368.27	1.87
31	VG9B143	Vg9	2629.19	97.35	241.41	1.07
32	VG9B418	Vg9	2625.01	190.37	397.53	3.80
33	VG9B472	Vg9	2618.27	171.46	327.75	2.22
34	VG9B421	Vg9	2613.21	164.91	357.78	2.16
35	VG9B88	Vg9	2559.14	153.54	345.70	18.78
36	VG9B384	Vg9	2546.76	120.75	289.57	18.67
37	VG9B413	Vg9	2472.53	184.38	405.73	4.47
38	VG9B36	Vg9	2411.74	156.79	354.36	2.45
39	VG9B403	Vg9	2388.25	192.50	426.04	2.43
40	VG9B191	Vg9	2366.62	155.61	381.04	17.18
41	VG9B44	Vg9	2317.34	169.68	375.29	2.13
42	VG9B67	Vg9	2267.90	128.38	317.80	1.14
43	VG9B402	Vg9	2245.94	175.93	390.71	2.50
44	VG9B127	Vg9	2225.81	91.86	317.54	1.78
45	VG9B137	Vg9	2199.84	133.26	316.80	1.84
46	VG9B33	Vg9	2093.60	173.44	377.35	2.85
47	VG9B162	Vg9	1855.16	96.27	249.35	2.44
48	VG9B152	Vg9	1851.56	140.95	351.66	1.64
49	VG9B64	Vg9	1688.57	100.31	259.64	2.22
50	VG9B21	Vg9	1672.33	39.71	121.09	1.86
51	VG9B128	Vg9	1483.38	120.69	215.26	11.39
52	VG9B66	Vg9	1223.28	33.87	179.02	1.04
53	VG9B32	Vg9	1211.08	40.02	108.12	2.52
54	VG9B57	Vg9	1206.73	30.76	75.94	1.04
55	VG9B135	Vg9	577.24	15.10	59.87	2.65
56	VG9B60	Vg9	567.17	16.70	40.58	1.42
57	VG9B409	Vg9	410.62	176.35	408.24	8.45
58	VG9B411	Vg9	396.41	19.12	24.89	2.76
59	VG9B129	Vg9	271.32	10.36	23.35	1.13
60	VG9B396	Vd2	4543.78	154.68	2.19	222.19
61	VG9B470	Vd2	4273.42	166.74	1.59	231.07
62	VG9B111	Vd2	3433.67	116.94	1.92	154.43
63	VG9B169	Vd2	3246.37	165.28	2.21	175.26
64	VG9B639	Vd2	3236.63	155.28	1.29	185.68
65	VG9B201	Vd2	3170.12	152.35	2.74	204.61
66	VG9B161	Vd2	2819.85	180.14	1.43	210.72
67	VG9B383	Vd2	2778.28	183.98	1.36	283.96
68	VG9B382	Vd2	2775.57	176.98	1.04	275.40
69	VG9B156	Vd2	2698.68	152.58	1.60	169.64
70	VG9B205	Vd2	2689.76	153.49	2.04	161.98
71	VG9B86	Vd2	2670.16	137.94	1.16	206.91
72	VG9B154	Vd2	2592.95	152.88	1.09	92.70
73	VG9B159	Vd2	2505.10	123.26	1.58	11.37
74	VG9B465	Vd2	2500.83	148.03	7.28	214.03
75	VG9B194	Vd2	2470.37	151.47	6.29	148.31
76	VG9B182	Vd2	2365.20	159.31	1.68	195.27
77	VG9B173	Vd2	2362.86	181.80	1.82	25.36
78	VG9B87	Vd2	2331.26	138.98	1.40	51.63
79	VG9B208	Vd2	2306.11	176.93	2.15	203.33
80	VG9B372	Vd2	2293.95	127.30	1.02	171.26
81	VG9B186	Vd2	2287.42	142.50	1.20	66.88
82	VG9B177	Vd2	2247.18	161.00	1.28	192.81
83	VG9B114	Vd2	1975.60	176.44	8.38	226.28
84	VG9B147	Vd2	1890.32	30.48	1.59	69.75
85	VG9B65	Vd2	1819.09	88.75	8.50	122.51
86	VG9B81	Vd2	1771.18	42.23	1.17	77.02
87	VG9B203	Vd2	1753.37	143.32	1.30	193.78
88	VG9B380	Vd2	1749.32	163.87	11.60	232.97
89	VG9B103	Vd2	1675.38	96.41	1.79	236.84
90	VG9B462	Vd2	1541.64	140.24	21.55	141.65
91	VG9B461	Vd2	1539.12	148.91	9.04	153.18
92	VG9B106	Vd2	1524.56	10.48	1.20	64.28
93	VG9B115	Vd2	1522.89	41.89	1.49	66.95
94	VG9B27	Vd2	1446.95	137.76	5.83	208.79
95	VG9B458	Vd2	1412.02	147.86	4.38	123.29
96	VG9B131	Vd2	1403.08	58.11	2.38	91.72
97	VG9B163	Vd2	1346.41	57.19	10.63	48.91
98	VG9B454	Vd2	1244.69	180.68	29.37	158.37
99	VG9B439	Vd2	1244.61	169.53	1.84	162.87
100	VG9B68	Vd2	1192.87	124.09	2.08	207.12
101	VG9B449	Vd2	1178.94	164.57	1.47	158.60
102	VG9B204	Vd2	1129.50	99.65	1.50	169.49
103	VG9B459	Vd2	1087.45	156.84	7.55	137.62
104	VG9B157	Vd2	1070.92	10.96	0.96	11.69
105	VG9B453	Vd2	1037.24	171.23	1.69	162.89
106	VG9B443	Vd2	1005.02	171.26	5.90	150.44
107	VG9B455	Vd2	1000.40	169.15	1.33	153.89
108	VG9B466	Vd2	945.82	139.31	1.76	126.03
109	VG9B450	Vd2	927.78	167.57	1.13	159.63
110	VG9B438	Vd2	895.07	164.78	1.74	165.98
111	VG9B464	Vd2	886.16	145.74	1.73	115.48
112	VG9B437	Vd2	885.19	164.62	1.30	153.25
113	VG9B457	Vd2	864.60	179.57	0.93	157.79
114	VG9B442	Vd2	856.24	159.04	1.48	158.00
115	VG9B436	Vd2	812.47	162.02	1.88	169.69
116	VG9B434	Vd2	803.78	171.06	1.48	159.57
117	VG9B460	Vd2	767.37	138.23	1.47	129.82
118	VG9B189	Vd2	738.68	46.15	1.46	21.54
119	VG9B452	Vd2	686.75	181.12	2.10	166.55
120	VG9B53	Vd2	536.30	7.34	0.93	109.60
121	VG9B41	Vd2	137.19	11.43	2.18	16.08
122	VG9B136	g/d constant	2684.58	180.54	288.27	226.18
123	VG9B399	g/d constant	2478.03	214.03	435.82	206.50
124	VG9B369	g/d constant	2429.10	258.91	319.93	241.30
125	VG9B144	g/d constant	2425.86	123.44	204.70	193.74
126	VG9B410	g/d constant	2253.41	222.69	434.89	54.42
127	VG9B386	g/d constant	2113.79	210.54	388.92	92.74
128	VG9B125	g/d constant	1992.68	126.84	277.32	194.19
129	VG9B112	g/d constant	1991.02	227.15	328.28	217.02
130	VG9B371	g/d constant	1970.39	225.19	430.68	130.30
131	VG9B387	g/d constant	1965.44	200.61	434.64	261.40
132	VG9B47	g/d constant	1558.28	162.35	308.26	211.59
133	VG9B379	g/d constant	1458.49	160.15	294.95	260.37
134	VG9B447	g/d constant	1417.79	196.00	94.00	161.41
135	VG9B392	g/d constant	1247.94	154.25	295.22	281.15
136	VG9B96	g/d constant	1022.01	126.04	244.90	223.89
137	VG9B77	g/d constant	771.90	102.46	137.09	147.80

Cytokine and effector molecule analysis. Cytokines and effector molecules were assessed both intracellularly and in the cell culture supernatants. For intracellular cytokine and effector molecules assessment by flow cytometry, cells were initially surface stained with indicated monoclonal antibodies and washed twice with wash buffer. Stained cells were fixed and permeabilized using BD Fix/Perm kit (BD biosciences) per manufacturer's instructions. Permeabilized cells were probed with monoclonal antibodies against intracellular cytokines (TNFα, IFNγ) or effector molecules (Granzyme B) for 30 minutes at 4° C. Cells were washed twice and acquired on Novocyte flow cytometer. FMO (Fluorescence Minus One) controls were used to establish the gating for cytokines. For assessing cytokines in cell culture supernatant, cell culture supernatants were collected on indicated time points and subjected to quantification using customized human magnetic Luminex assay 15-plex kit (R&D Systems, Minneapolis, USA), as per the manufacturer's instructions. Quantification of the cytokines was carried out in MAGPIX multiplex detection system with xPONENT software. Results are shown in Table 9.

Activated T Cell Surface Marker Profiles. Flow cytometery was utilized to asses the percentage of Vγ9+ cells expressing certain T cell activation markers, including CD25 and CD71 expression, as well as the percentage of Vγ9 T cells in the cell population. Briefly, 48-well plates were coated with 200 μl of antibodies (1 pg/ml) and control antibody (VG7A5 1 μg/ml) in PBS overnight at 40° C. PBMCs were thawed and resuspended in RPMI+10% FBS media. They were then labeled with CTV dye to track proliferation. CTV labeled PBMCs were plated 2×10⁶ in 250 μl media per well of the antibody coated plates and incubated at 37° C. for 2 days. Supernatant was collected on day 2 for Luminex analysis (IFNγ, TNFα, Granzyme B). The cells were spun down and transferred to IL-2 containing media (100 IU/ml) and allowed to rest for 3 days followed by staining for CD25, CD71, IFNγ and Granzyme B after 3 days. The results are shown in Table 9.

TABLE 9
Cell Cytokine and Surface Marker Profiles
	Flow Staining
	Protein	Luninex (supernatant)	CD25+	CD71+	Vg9 T
#	Name	TNFα	IL6	IFNγ	Granzyme B	(Vg9+ cells)	(Vg9+ cells)	cell %
1	VG9B54	6096	761	1601	3103	32.4	93.3	10.5
2	VG9B121	96	161	429	1352	50.9	98.7	16.1
3	VG9B429	583	816	1249	2148	25.8	91.6	3.0
4	VG9B370	2297	541	2839	5023	44.9	98.6	8.0
5	VG9B80	4914	385	1364	3009	49.6	98.3	5.2
6	VG9B414	186	219	476	1489	24.8	88.1	4.0
7	VG9B195	61	166	303	1064	15.8	86.9	3.7
8	VG9B140	3517	602	796	2161	20.4	70.6	3.9
9	VG9B426	789	621	2348	4586	36.5	98.8	7.6
10	VG9B46	5256	375	1154	3174	37.9	95.8	4.4
11	VG9B416	87	225	1175	3390	46.4	98.8	13.9
12	VG9B69	1099	591	2070	3238	40.4	97.7	8.8
13	VG9B415	193	403	1213	5157	31.5	96.9	5.3
14	VG9B104	4132	1092	2441	5290	41.4	95.2	5.1
15	VG9B198	66	199	324	1103	23.0	91.2	3.6
16	VG9B463	2109	100	364	965	26.0	87.4	4.1
17	VG9B469	173	440	1585	3696	29.9	98.5	7.8
18	VG9B428	390	613	1995	4125	37.0	98.1	5.0
19	VG9B430	125	372	1491	2515	37.5	96.2	10.7
20	VG9B423	229	590	1432	3376	40.3	98.9	13.9
21	VG9B98	2007	294	305	1424	29.4	90.5	7.2
22	VG9B73	136	359	1051	3372	30.6	94.1	13.8
23	VG9B133	123	478	1167	3475	21.8	91.4	5.8
24	VG9B368	118	260	1484	3314	42.3	98.2	11.5
25	VG9B424	174	931	1405	3964	36.7	98.8	12.1
26	VG9B427	220	340	2487	4676	50.6	99.1	13.6
27	VG9B417	202	1409	2873	5568	49.6	98.8	10.9
28	VG9B58	3454	572	1599	3839	33.9	91.8	6.8
29	VG9B419	216	362	2429	4250	34.2	98.1	5.0
30	VG9B425	127	612	1356	3740	39.3	98.6	15.6
31	VG9B143	32	113	155	1086	11.4	87.5	6.2
32	VG9B418	163	279	2182	3886	46.9	99.2	13.3
33	VG9B472	84	394	575	2780	23.4	96.6	6.3
34	VG9B421	255	604	2454	6129	36.7	98.7	7.1
35	VG9B88	1263	551	1531	2377	15.1	88.1	4.1
36	VG9B384	3744	610	1099	2301	26.4	89.9	3.4
37	VG9B413	229	1961	2830	5795	44.9	98.8	13.3
38	VG9B36	188	607	2581	3893	29.1	89.4	7.8
39	VG9B403	102	175	1388	3017	36.2	97.5	7.2
40	VG9B191	7323	400	1385	3373	42.4	93.6	5.2
41	VG9B44	198	587	1147	3031	45.4	98.8	14.4
42	VG9B67	144	365	972	2553	28.5	87.4	14.0
43	VG9B402	376	433	2367	4497	45.5	99.1	9.5
44	VG9B127	709	348	1173	2453	37.3	96.5	11.2
45	VG9B137	30	8	44	36	8.7	77.3	3.6
46	VG9B33	85	240	749	1994	28.0	95.2	14.0
47	VG9B162	329	54	57	481	9.7	70.3	2.7
48	VG9B152	51	118	344	1060	8.1	81.9	3.0
49	VG9B64	46	122	383	863	21.4	79.6	4.0
50	VG9B21	3329	459	1660	3153	27.5	91.8	7.1
51	VG9B128	3964	304	1242	4854	36.6	97.4	9.6
52	VG9B66	405	145	162	470	25.4	84.6	3.8
53	VG9B32	10	11	44	68	19.1	87.3	5.1
54	VG9B57	349	147	29	468	17.1	77.4	4.0
55	VG9B135	225	717	57	270	20.6	77.7	4.3
56	VG9B60	2425	269	280	912	9.1	73.0	2.9
57	VG9B409	190	194	195	585	18.7	80.6	3.2
58	VG9B411	25	88	51	115	10.8	75.4	3.0
59	VG9B129	192	94	36	305	16.4	73.4	3.6
60	VG9B396	908	172	531	1388	44.7	92.7	2.7
61	VG9B470	3659	554	828	2231	43.5	92.6	2.3
62	VG9B111	42	32	44	98	27.8	84.4	8.8
63	VG9B169	722	399	577	2381	30.3	95.3	2.0
64	VG9B639	6081	755	1397	4289	37.8	94.7	4.3
65	VG9B201	460	77	225	987	21.8	89.4	4.2
66	VG9B161	1285	286	620	1671	31.3	94.5	5.4
67	VG9B383	687	379	1242	6027	29.7	91.3	6.4
68	VG9B382	49	46	440	1640	32.7	93.9	6.0
69	VG9B156	14	37	44	493	27.5	93.7	6.4
70	VG9B205	224	66	99	800	22.0	91.4	2.4
71	VG9B86	2254	186	503	1052	27.4	94.1	4.7
72	VG9B154	9	4	44	181	26.3	93.7	6.9
73	VG9B159	17	42	44	711	10.3	85.7	3.5
74	VG9B465	132	126	795	1472	28.7	94.0	3.6
75	VG9B194	276	40	44	316	17.0	82.6	3.7
76	VG9B182	1040	209	938	2180	37.9	91.0	2.5
77	VG9B173	17	104	83	766	22.9	90.4	5.1
78	VG9B87	674	117	154	652	32.9	94.5	4.5
79	VG9B208	22	31	68	618	16.8	91.7	3.8
80	VG9B372	73	105	149	828	11.2	89.3	4.0
81	VG9B186	429	56	68	327	13.3	78.3	3.4
82	VG9B177	99	117	60	768	22.8	88.6	2.4
83	VG9B114	6999	731	1081	3901	53.7	98.3	9.7
84	VG9B147	58	81	44	307	12.0	89.0	3.0
85	VG9B65	42	190	179	1040	24.6	96.4	7.2
86	VG9B81	1147	144	138	500	27.4	79.7	8.4
87	VG9B203	22	30	44	525	19.0	90.2	4.5
88	VG9B380	15	21	44	228	15.5	84.3	4.2
89	VG9B103	4760	298	889	3212	46.6	96.4	5.0
90	VG9B462	7463	819	1461	2639	28.5	83.6	2.7
91	VG9B461	7904	748	1353	3166	34.4	85.3	2.7
92	VG9B106	119	39	44	287	12.2	73.9	3.5
93	VG9B115	204	104	44	186	26.8	83.5	3.5
94	VG9B27	3537	274	1492	4123	35.4	92.6	4.0
95	VG9B458	4324	384	1026	2230	27.6	84.5	3.1
96	VG9B131	371	76	91	429	18.8	80.3	3.4
97	VG9B163	9	5	44	41	9.7	75.9	3.7
98	VG9B454	2063	458	1215	2475	39.9	92.7	5.0
99	VG9B439	190	140	167	760	13.8	86.0	3.9
100	VG9B68	6831	539	1544	4204	35.6	93.5	9.3
101	VG9B449	266	131	256	1089	16.3	87.2	3.5
102	VG9B204	3255	230	698	1878	31.8	91.4	4.3
103	VG9B459	1589	409	1060	2322	24.2	86.6	2.9
104	VG9B157	74	606	36	115	13.1	78.3	3.3
105	VG9B453	5756	612	1670	3297	29.7	87.9	3.0
106	VG9B443	5106	860	1174	2548	33.6	86.0	3.8
107	VG9B455	7052	1576	2726	9278	24.2	77.3	2.6
108	VG9B466	5870	558	1194	2375	21.7	84.6	2.6
109	VG9B450	1510	293	560	1379	26.1	83.9	3.5
110	VG9B438	1419	387	653	2365	28.2	86.4	4.2
111	VG9B464	5479	392	1584	2486	26.6	86.2	3.3
112	VG9B437	311	899	666	1489	20.4	85.4	3.7
113	VG9B457	1201	1066	778	1836	24.0	83.2	3.4
114	VG9B442	617	542	322	1306	18.4	82.0	3.9
115	VG9B436	271	149	230	1080	21.5	87.0	3.9
116	VG9B434	478	985	900	4803	20.5	85.3	4.2
117	VG9B460	333	528	410	1252	18.5	88.0	3.2
118	VG9B189	64	30	44	230	11.6	80.0	3.5
119	VG9B452	1891	273	1037	1828	26.4	84.9	3.6
120	VG9B53	9	17	44	125	10.8	81.4	3.7
121	VG9B41	213	95	29	274	16.9	79.5	4.8
122	VG9B136	192	279	560	1542	33.3	94.9	5.7
123	VG9B399	157	511	2400	8239	36.8	96.5	7.0
124	VG9B369	138	4897	1458	2633	27.1	92.4	6.1
125	VG9B144	215	123	352	1762	20.6	89.6	3.8
126	VG9B410	158	590	2119	4389	36.5	98.2	12.3
127	VG9B386	89	228	846	2963	29.7	97.0	8.5
128	VG9B125	959	587	1491	3755	24.8	70.8	12.4
129	VG9B112	1255	256	461	1143	23.4	91.8	7.9
130	VG9B371	4097	1555	4834	7484	42.3	98.4	8.2
131	VG9B387	135	5196	746	1471	24.7	89.7	5.5
132	VG9B47	73	293	383	1284	30.0	96.1	6.4
133	VG9B379	258	465	710	2529	29.9	94.7	7.7
134	VG9B447	1539	197	462	1303	23.3	84.6	3.4
135	VG9B392	78	191	258	1548	21.2	96.5	7.6
136	VG9B96	3808	4354	2690	7663	33.1	82.5	15.1
137	VG9B77	195	864	787	4675	19.4	90.3	5.1

It will be appreciated by those skilled in the art that changes could be made to the embodiments described above without departing from the broad inventive concept thereof. It is understood, therefore, that this invention is not limited to the particular embodiments disclosed, but it is intended to cover modifications within the spirit and scope of the present invention as defined by the present description.

Claims

1. A method of directing a γδ T cell to a target cell, the method comprising contacting the γδ T cell with a multispecific antibody, wherein the target cell expresses a second target, and wherein the contacting directs the γδ T cell to the target cell, and wherein the multispecific antibody is a multispecific TRDV2 antibody that binds a Vδ2 (TRDV2) polypeptide, the multispecific antibody comprising a first binding domain that binds TRDV2, and a second binding domain that binds to the second target; wherein the first binding domain that binds to TRDV2 comprises:(1) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2037; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2038;(2) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2071; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2072;(3) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2105; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2106;(4) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2139; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having amino acid sequence of SEQ ID NO:2140;(5) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2173; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having amino acid sequence of SEQ ID NO:2174;(6) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2207; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2208;(7) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2241; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2242;(8) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having amino acid sequence of SEQ ID NO:2275; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2276;(9) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2309; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2310;(10) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2785; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2786;optionally wherein(a) the multispecific antibody binds a TRDV2 antigen or a TRDV2 epitope;(b) the multispecific antibody specifically binds to TRDV2;(c) the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an antigen or an epitope of the TRDV2; or(d) the TRDV2 is present on the surface of a T cell.

2. The method of claim 1, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to (a) the Kabat numbering system,(b) the Chothia numbering system,(c) the AbM numbering system,(d) the Contact numbering system or(e) the IMGT numbering system.

3. The method of claim 1, wherein the multispecific antibody: (a) is a humanized multispecific antibody;(b) is a multispecific IgG antibody; wherein optionally the IgG antibody is an IgG1, IgG2, IgG3, or IgG4 antibody;(c) comprises a kappa light chain or a lambda light chain; or(d) is a monoclonal multispecific antibody.

4. A method of inhibiting growth or proliferation of target cells, the method comprising contacting the target cells with a multispecific antibody, wherein the target cells express a second target on the cell surface, and wherein contacting the target cells with the multispecific antibody inhibits growth or proliferation of the target cells, wherein the multispecific antibody is a multispecific TRDV2 antibody that binds a V62 (TRDV2) polypeptide, the multispecific antibody comprising a first binding domain that binds TRDV2, and a second binding domain that binds to the second target; wherein the first binding domain that binds to TRDV2 comprises:(1) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2037; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2038;(2) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2071; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2072;(3) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2105; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2106;(4) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2139; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having amino acid sequence of SEQ ID NO:2140;(5) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2173; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having amino acid sequence of SEQ ID NO:2174;(6) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2207; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2208;(7) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2241; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2242;(8) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having amino acid sequence of SEQ ID NO:2275; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2276;(9) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2309; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2310;(10) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2785; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2786;optionally wherein(a) the multispecific antibody binds a TRDV2 antigen or a TRDV2 epitope;(b) the multispecific antibody specifically binds to TRDV2;(c) the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an antigen or an epitope of the TRDV2; or(d) the TRDV2 is present on the surface of a T cell.

5. The method of claim 4, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to (a) the Kabat numbering system,(b) the Chothia numbering system,(c) the AbM numbering system,(d) the Contact numbering system or(e) the IMGT numbering system.

6. The method of claim 4, wherein the multispecific antibody: (a) is a humanized multispecific antibody;(b) is a multispecific IgG antibody; wherein optionally the IgG antibody is an IgG1, IgG2, IgG3, or IgG4 antibody;(c) comprises a kappa light chain or a lambda light chain; or(d) is a monoclonal multispecific antibody.

7. The method of claim 4, wherein the target cells are in the presence of a γδ T cell while in contact with the multispecific antibody.

8. A method for eliminating target cells in a subject, comprising administering an effective amount of a multispecific antibody to the subject, wherein the target cells express a second target optionally wherein the subject is a subject in need thereof, wherein the multispecific antibody is a multispecific TRDV2 antibody that binds a V62 (TRDV2) polypeptide, the multispecific antibody comprising a first binding domain that binds TRDV2, and a second binding domain that binds to the second target; wherein the first binding domain that binds to TRDV2 comprises:(1) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2037; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2038;(2) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2071; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2072;(3) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2105; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2106;(4) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2139; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having amino acid sequence of SEQ ID NO:2140;(5) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2173; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having amino acid sequence of SEQ ID NO:2174;(6) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2207; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2208;(7) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2241; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2242;(8) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having amino acid sequence of SEQ ID NO:2275; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2276;(9) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2309; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2310;(10) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2785; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2786;optionally wherein(a) the multispecific antibody binds a TRDV2 antigen or a TRDV2 epitope;(b) the multispecific antibody specifically binds to TRDV2;(c) the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an antigen or an epitope of the TRDV2; or(d) the TRDV2 is present on the surface of a T cell.

9. The method of claim 8, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to (a) the Kabat numbering system,(b) the Chothia numbering system,(c) the AbM numbering system,(d) the Contact numbering system or(e) the IMGT numbering system.

10. The method of claim 8, wherein the multispecific antibody: (a) is a humanized multispecific antibody;(b) is a multispecific IgG antibody; wherein optionally the IgG antibody is an IgG1, IgG2, IgG3, or IgG4 antibody;(c) comprises a kappa light chain or a lambda light chain; or(d) is a monoclonal multispecific antibody.

11. A method for treating a disease caused all or in part by target cells in a subject, comprising administering an effective amount of a multispecific antibody to the subject, wherein the target cells express a second target; optionally wherein the subject is a subject in need thereof, wherein the multispecific antibody is a multispecific TRDV2 antibody that binds a Vδ2 (TRDV2) polypeptide, the multispecific antibody comprising a first binding domain that binds TRDV2, and a second binding domain that binds to the second target; wherein the first binding domain that binds to TRDV2 comprises:(1) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2037; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2038;(2) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2071; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2072;(3) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2105; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2106;(4) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2139; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having amino acid sequence of SEQ ID NO:2140;(5) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2173; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having amino acid sequence of SEQ ID NO:2174;(6) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2207; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2208;(7) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2241; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2242;(8) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having amino acid sequence of SEQ ID NO:2275; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2276;(9) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2309; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2310;(10) (i) a VH comprising a VH CDR1, a VH CDR2, and a VH CDR3 having an amino acid sequence of a VH CDR1, a VH CDR2, and a VH CDR3, respectively, of a VH having the amino acid sequence of SEQ ID NO:2785; and (ii) a VL comprising a VL CDR1, a VL CDR2, and a VL CDR3 having an amino acid sequence of a VL CDR1, a VL CDR2, and a VL CDR3, respectively, of a VL having the amino acid sequence of SEQ ID NO:2786;optionally wherein(a) the multispecific antibody binds a TRDV2 antigen or a TRDV2 epitope;(b) the multispecific antibody specifically binds to TRDV2;(c) the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 and VL CDR3 form a binding site for an antigen or an epitope of the TRDV2; or(d) the TRDV2 is present on the surface of a T cell.

12. The method of claim 11, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to (a) the Kabat numbering system,(b) the Chothia numbering system,(c) the AbM numbering system,(d) the Contact numbering system or(e) the IMGT numbering system.

13. The method of claim 11, wherein the multispecific antibody: (a) is a humanized multispecific antibody;(b) is a multispecific IgG antibody; wherein optionally the IgG antibody is an IgG1, IgG2, IgG3, or IgG4 antibody;(c) comprises a kappa light chain or a lambda light chain; or(d) is a monoclonal multispecific antibody.

14. A method of activating a T cell, wherein: (a) the T cell expresses TRGV9, and the method comprises contacting the T cell with an antibody;

15. The method of claim 14, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 amino acid sequences are according to (a) the Kabat numbering system,(b) the Chothia numbering system,(c) the AbM numbering system,(d) the Contact numbering system or(e) the IMGT numbering system.

16. The method of claim 14, wherein the antibody: (a) is a humanized antibody;(b) is an IgG antibody; wherein optionally the IgG antibody is an IgG1, IgG2, IgG3, or IgG4 antibody;(c) comprises a kappa light chain or a lambda light chain; or(d) is a monoclonal antibody.

17. The antibody of claim 14, wherein the antibody is multivalent; wherein optionally (a) the antibody is capable of binding at least three antigens;(b) the antibody is capable of binding at least four antigens; or(c) the antibody is capable of binding at least five antigens.

18. The antibody of claim 14, wherein the antibody is a multispecific antibody, wherein optionally the multispecific antibody is a bispecific antibody, a trispecific antibody, or a quadraspecific antibody.