Compositions and use of a fibrinogen binding motif present in EFB and COA for therapeutics and vaccines against Staphylococcus aureus

Information

  • Patent Grant
  • 11407819
  • Patent Number
    11,407,819
  • Date Filed
    Wednesday, May 20, 2020
    4 years ago
  • Date Issued
    Tuesday, August 9, 2022
    2 years ago
Abstract
The present disclosure provides methods and composition including vaccines, monoclonal antibodies, polyclonal antibodies, chimeric molecule of an extracellular fibrinogen binding protein (Efb) and targeted agent delivery pharmaceutical composition comprising at least a portion of a modified N-terminus region, at least a portion of a modified C-terminus region, or both, wherein the modified extracellular fibrinogen binding protein results in inhibiting the fibrinogen binding, C3 binding, or both or administering to a subject a pharmacologically effective amount of a vaccine in a pharmaceutically acceptable excipient, comprising a modified extracellular fibrinogen binding protein comprising at least a portion of a modified N-terminus region, at least a portion of a modified C-terminus region, or both, wherein the modified extracellular fibrinogen binding protein results in not shielding the staphylococcus bacterium from recognition by a phagocytic receptor.
Description
STATEMENT OF FEDERALLY FUNDED RESEARCH

Not applicable.


REFERENCE TO A SEQUENCE LISTING

The present application includes a Sequence Listing which has been submitted in ASCII format via EFS-Web and is herby incorporated by reference in its entirety. Said ASCII copy, created on Jun. 11, 2021 is named TAMU1055CIP_SL_TXT_061121 and is 106 KB in size.


TECHNICAL FIELD OF THE INVENTION

The present invention relates generally to compositions and methods for preventing and treating human and animal diseases including, but not limited to, pathogens.


BACKGROUND OF THE INVENTION

Without limiting the scope of the invention, its background is described in connection with compositions and methods of treating infection by pathogens. Pathogens present serious health concerns for all animals, including humans, farm livestock, and household pets. These health threats are exacerbated by the rise of strains that are resistant to antibiotic treatment. Staphylococcus aureus is a leading cause of severe bacterial infections in both hospital and community settings. Due to its increasing resistance to antibiotics, development of additional therapeutic strategies like vaccination is required to control this pathogen. Vaccination attempts against S. aureus have not been successful so far and an important reason may be the pathogen's elaborate repertoire of molecules that dampen the immune response. These evasion molecules not only suppress natural immunity but also hamper the current attempts to create effective vaccines.


SUMMARY OF THE INVENTION

In one embodiment, the present includes an antibody or antigen binding fragment thereof that specifically binds an extracellular fibrinogen binding protein, wherein the antibody or antigen binding fragment thereof comprises: (a) a heavy chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:131-134; a heavy chain CDR2 comprising the amino acid sequences selected from SEQ ID NOS:135-138; and a heavy chain CDR3 comprising the amino acid sequences selected from SEQ ID NOS:139-165; and (b) a light chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:166-184; a light chain CDR2 comprising the amino acid sequence selected from SEQ ID NOS:185-201; and a light chain CDR3 comprising the amino acid sequence selected from SEQ ID NOS:202-222. In one aspect, antibody is a full-length antibody. In another aspect, antibody or antigen binding fragment thereof is a humanized antibody. In another aspect, the antigen binding fragment comprises an Fab, a Fab′, a F(ab′)2, a single chain Fv (scFv), a disulfide linked Fv, an IgG-CH2, a F(ab′)3, a tetrabody, a triabody, a diabody, a (scFv)2, or a scFv-Fc. In another aspect, the extracellular fibrinogen binding protein is selected from Efb, Coa or both. In another aspect, the antibody or antigen binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence selected from SEQ ID NOS: 71-100 and a light chain variable domain comprising the amino acid sequence selected from SEQ ID NOS:101-130. In another aspect, the variable heavy chain and the variable light chain comprise, respectively SEQ ID NOS:71 and 101, 72 and 102, 73 and 103, 74 and 104, 75 and 105, 76 and 106, 77 and 107, 78 and 108, 79 and 109, 80 and 110, 81 and 111, 82 and 112, 83 and 113, 84 and 114, 85 and 115, 86 and 116, 87 and 117, 88 and 118, 89 and 110, 90 and 120, 91 and 121, 92 and 122, 93 and 123, 94 and 124, 95 and 125, 96 and 126, 97 and 127, 98 and 128, 99 and 129, or 100 and 130. In another aspect, antibody or antigen binding fragment thereof further comprises a collagen-like domain, a globular domain, or both. In another aspect, the antibody or antigen binding fragment thereof further comprises a label selected from the group consisting of: a radiolabel, a fluorophore, a chromophore, an imaging agent and a metal ion, wherein the labeled antibody is a diagnostic reagent. In another aspect, the antibody or antigen binding fragment thereof further comprises a therapeutic agent selected from an analgesic, an anti-histamine, an anti-inflammatory agent, an antibiotic, a chemotherapeutic, an immunosuppressant, a cytokine, an anti-proliferative, an antiemetic, or a cytotoxin.


In another embodiment, the present includes a method of making the antibody or antigen binding fragment thereof comprising: (a) culturing a cell expressing said antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a heavy chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:131-134; a heavy chain CDR2 comprising the amino acid sequences selected from SEQ ID NOS:135-138; and a heavy chain CDR3 comprising the amino acid sequences selected from SEQ ID NOS:139-165); and a light chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:166-184; a light chain CDR2 comprising the amino acid sequence selected from SEQ ID NOS:185-201; and a light chain CDR3 comprising the amino acid sequence selected from SEQ ID NOS:202-222; and (b) isolating the antibody or antigen binding fragment thereof from the cultured cell, wherein the cell is a eukaryotic cell. In one aspect, the variable heavy chain and the variable light chain comprise, respectively SEQ ID NOS:71 and 101, 72 and 102, 73 and 103, 74 and 104, 75 and 105, 76 and 106, 77 and 107, 78 and 108, 79 and 109, 80 and 110, 81 and 111, 82 and 112, 83 and 113, 84 and 114, 85 and 115, 86 and 116, 87 and 117, 88 and 118, 89 and 110, 90 and 120, 91 and 121, 92 and 122, 93 and 123, 94 and 124, 95 and 125, 96 and 126, 97 and 127, 98 and 128, 99 and 129, or 100 and 130.


In another embodiment, the present includes an immunoconjugate having the formula (A)-(L)-(C), wherein: (A) is the antibody or antigen binding fragment of claim 1; (L) is a linker; and (C) is a cytotoxic agent; wherein the linker (L) links (A) to (C) wherein the antibody or antigen binding fragment thereof comprises: a heavy chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:131-134; a heavy chain CDR2 comprising the amino acid sequences selected from SEQ ID NOS:135-138; and a heavy chain CDR3 comprising the amino acid sequences selected from SEQ ID NOS:139-165); and a light chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:166-184; a light chain CDR2 comprising the amino acid sequence selected from SEQ ID NOS:185-201; and a light chain CDR3 comprising the amino acid sequence selected from SEQ ID NOS:202-222. In one aspect, the linker is selected from the group consisting of a cleavable linker, a non-cleavable linker, a hydrophilic linker, and a dicarboxylic acid-based linker. In another aspect, the linker is selected from the group consisting: N-succinimidyl 4-(2-pyridyldithio)pentanoate (SPP) or N-succinimidyl 4-(2-pyridyldithio)-2-sulfopentanoate (sulfo-SPP); N-succinimidyl 4-(2-pyridyldithio)butanoate (SPDB) or N-succinimidyl 4-(2-pyridyldithio)-2-sulfobutanoate (sulfo-SPDB); N-succinimidyl 4-(maleimidomethyl) cyclohexanecarboxylate (SMCC); N-sulfosuccinimidyl 4-(maleimidomethyl) cyclohexanecarboxylate (sulfoSMCC); N-succinimidyl-4-(iodoacetyl)-aminobenzoate (SIAB); and N-succinimidyl-[(N-maleimidopropionamido)-tetraethyleneglycol] ester (NHS-PEG4-maleimide). In another aspect, the immunoconjugate further comprises a therapeutic agent selected from an analgesic, an anti-histamine, an anti-inflammatory agent, an antibiotic, a chemotherapeutic, an immunosuppressant, a cytokine, an anti-proliferative, an antiemetic, or a cytotoxin. In another aspect, the immunoconjugate comprises: 2-6 (C), 3-4 (C), or has an average of about 3 to about 4 (C) per (A) or an average of about 3.5+/−0.5 (C) per (A). In another aspect, the e immunoconjugate further comprises a pharmaceutically acceptable carrier.


In another embodiment, the present includes a pharmaceutical composition comprising an antibody or antigen binding fragment thereof that specifically binds an extracellular fibrinogen binding protein, wherein the antibody or antigen binding fragment thereof comprises: (a) a heavy chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:131-134; a heavy chain CDR2 comprising the amino acid sequences selected from SEQ ID NOS:135-138; and a heavy chain CDR3 comprising the amino acid sequences selected from SEQ ID NOS:139-165); and (b) a light chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:166-184; a light chain CDR2 comprising the amino acid sequence selected from SEQ ID NOS:185-201; and a light chain CDR3 comprising the amino acid sequence selected from SEQ ID NOS:202-222; and a pharmaceutically acceptable carrier. In one aspect, the variable heavy chain and the variable light chain comprise, respectively SEQ ID NOS:71 and 101, 72 and 102, 73 and 103, 74 and 104, 75 and 105, 76 and 106, 77 and 107, 78 and 108, 79 and 109, 80 and 110, 81 and 111, 82 and 112, 83 and 113, 84 and 114, 85 and 115, 86 and 116, 87 and 117, 88 and 118, 89 and 110, 90 and 120, 91 and 121, 92 and 122, 93 and 123, 94 and 124, 95 and 125, 96 and 126, 97 and 127, 98 and 128, 99 and 129, or 100 and 130.


In another embodiment, the present includes a pharmaceutical composition for use in the treatment of an infection comprises: a pharmacologically effective amount of a modified extracellular fibrinogen binding protein in a pharmaceutically acceptable excipient, wherein the modified extracellular fibrinogen binding protein comprises at least a portion of a N-terminus fibrinogen binding region, at least a portion of a C-terminus complement protein binding region, or both, wherein the modified extracellular fibrinogen binding protein results in inhibiting the fibrinogen binding, C3 binding, the surface-bound complement protein, an antibody or combination thereof; or a pharmacologically effective amount of a monoclonal and/or polyclonal antibody or antigen-binding fragment thereof that can specifically bind to a portion of a extracellular fibrinogen binding protein comprising a heavy and light chain variable regions that bind at least a portion of a N-terminus fibrinogen binding region of a extracellular fibrinogen binding protein, at least a portion of a C-terminus complement protein binding region of a extracellular fibrinogen binding protein, or both and results in the inhibition of fibrinogen binding, of complement protein binding, inhibition of the shielding of the staphylococcus bacterium from recognition by a phagocytic receptor or a combination thereof. In another aspect, the at least a portion of a N-terminus fibrinogen binding region is selected from SEQ ID NO: 3-61, preferably SEQ ID NO: 3-30 or SEQ ID NO: 35-61. In another aspect, the at least a portion of a N-terminus fibrinogen binding region is selected from SEQ ID NO: 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, and 61. In another aspect, the fibrinogen binding protein is Efb, Coa or both. In another aspect, the composition further comprises an antigen selected from SpA, SpA variant, Emp, EsxA, EsxB, EsaC, Eap, EsaB, Coa, vWbp, vWh, Ma, SdrC, SdrD, SdrE, IsdA, IsdB, IsdC, ClfA, ClfB, SasF, Sta006, Sta011, Hla, and EsxA-EsxB.


In another embodiment, the present includes a method for making a monoclonal antibody comprising the steps of: providing an effective amount of a composition comprising a modified extracellular fibrinogen binding protein having a N-terminus modified fibrinogen binding protein that does not bind fibrinogen, a C-terminus modified complement binding protein that does not bind a complement protein or both; producing an antibody pool of the modified extracellular fibrinogen binding protein, the C-terminus modified complement binding protein, or both; screening the antibody pool to detect active antibodies; wherein the active antibodies inhibit the fibrinogen binding to extracellular fibrinogen binding protein, wherein the antibody or antigen binding fragment thereof comprises: a heavy chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:131-134; a heavy chain CDR2 comprising the amino acid sequences selected from SEQ ID NOS:135-138; and a heavy chain CDR3 comprising the amino acid sequences selected from SEQ ID NOS:139-165); and a light chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:166-184; a light chain CDR2 comprising the amino acid sequence selected from SEQ ID NOS:185-201; and a light chain CDR3 comprising the amino acid sequence selected from SEQ ID NOS:202-222; separating the active antibodies; and adding the active antibodies to a pharmaceutically acceptable carrier.


In another embodiment, the present includes a method for making a vaccine comprising the steps of: providing an effective amount of a composition comprising a modified extracellular fibrinogen binding protein having a N-terminus modified fibrinogen binding protein that does not bind fibrinogen, a C-terminus modified complement binding protein that does not bind a complement protein or both and further comprising an antigen selected from SpA, SpA variant, Emp, EsxA, EsxB, EsaC, Eap, EsaB, Coa, vWbp, vWh, Hla, SdrC, SdrD, SdrE, IsdA, IsdB, IsdC, ClfA, ClfB, SasF, Sta006, Sta011, Hla, and EsxA-EsxB.


In another embodiment, the present includes a method of treating of a Staphylococcus bacterium infection comprising: providing a pharmacologically effective amount of a monoclonal and/or polyclonal antibody or antigen-binding fragment thereof that can specifically bind to a portion of a extracellular fibrinogen binding protein comprising antibody or antigen binding fragment thereof that specifically binds an extracellular fibrinogen binding protein, wherein the antibody or antigen binding fragment thereof comprises: a heavy chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:131-134; a heavy chain CDR2 comprising the amino acid sequences selected from SEQ ID NOS:135-138; and a heavy chain CDR3 comprising the amino acid sequences selected from SEQ ID NOS:139-165); and a light chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:166-184; a light chain CDR2 comprising the amino acid sequence selected from SEQ ID NOS:185-201; and a light chain CDR3 comprising the amino acid sequence selected from SEQ ID NOS:202-222, that inhibits fibrinogen binding, complement protein binding, inhibition of the shielding of the Staphylococcus bacterium from recognition by a phagocytic receptor, or a combination thereof. In one aspect, the variable heavy chain and the variable light chain comprise, respectively SEQ ID NOS:71 and 101, 72 and 102, 73 and 103, 74 and 104, 75 and 105, 76 and 106, 77 and 107, 78 and 108, 79 and 109, 80 and 110, 81 and 111, 82 and 112, 83 and 113, 84 and 114, 85 and 115, 86 and 116, 87 and 117, 88 and 118, 89 and 110, 90 and 120, 91 and 121, 92 and 122, 93 and 123, 94 and 124, 95 and 125, 96 and 126, 97 and 127, 98 and 128, 99 and 129, or 100 and 130.


The present invention provides vaccine comprising: (a) a pharmacologically effective amount of a vaccine in a pharmaceutically acceptable excipient, comprising a modified extracellular fibrinogen binding protein comprising at least a portion of a modified N-terminus fibrinogen binding region, at least a portion of a modified C-terminus complement protein binding region, or both, wherein the modified extracellular fibrinogen binding protein results in inhibiting the fibrinogen binding, C3 binding, or both; (b) a pharmacologically effective amount of a vaccine in a pharmaceutically acceptable excipient, comprising a modified extracellular fibrinogen binding protein comprising at least a portion of a modified N-terminus fibrinogen binding region, at least a portion of a modified C-terminus complement protein binding region, or both, wherein the modified extracellular fibrinogen binding protein does not shield the surface-bound complement protein, an antibody or both from recognition by a phagocytic receptor; or (c) a pharmacologically effective amount of a vaccine in a pharmaceutically acceptable excipient, comprising a modified extracellular fibrinogen binding protein comprising at least a portion of a modified N-terminus fibrinogen binding region, at least a portion of a modified C-terminus complement protein binding region, or both, wherein the modified extracellular fibrinogen binding protein does not shield the staphylococcus bacterium from recognition by a phagocytic receptor.


The present invention provides a chimeric molecule of an extracellular fibrinogen binding protein (Efb) comprising: a N-terminus fibrinogen binding region that binds a fibrinogen; and a C-terminus complement protein binding region that binds a complement protein, wherein the chimeric molecule can modulate complement activity, modulate antibody binding, modulate recognition by a phagocytic receptor or a combination thereof.


The present invention provides a monoclonal and/or polyclonal antibody or antigen-binding fragment thereof that can specifically bind to a portion of a extracellular fibrinogen binding protein comprising a heavy and light chain variable regions that bind at least a portion of a N-terminus fibrinogen binding region of a extracellular fibrinogen binding protein, at least a portion of a C-terminus complement protein binding region of a extracellular fibrinogen binding protein, or both and results in the inhibition of fibrinogen binding, of complement protein binding, inhibition of the shielding of the staphylococcus bacterium from recognition by a phagocytic receptor or a combination thereof.


The present invention provides a pharmaceutical composition comprising a pharmacologically effective amount of a modified extracellular fibrinogen binding protein in a pharmaceutically acceptable excipient, wherein the modified extracellular fibrinogen binding protein comprises at least a portion of a N-terminus fibrinogen binding region, at least a portion of a C-terminus complement protein binding region, or both, wherein the modified extracellular fibrinogen binding protein results in inhibiting the fibrinogen binding, C3 binding, the surface-bound complement protein, an antibody or combination thereof.


The present invention provides a pharmaceutical composition comprising a monoclonal and/or polyclonal antibody or antigen-binding fragment thereof that can specifically bind to a portion of a extracellular fibrinogen binding protein comprising a heavy and light chain variable regions that bind at least a portion of a N-terminus fibrinogen binding region of a extracellular fibrinogen binding protein, at least a portion of a C-terminus complement protein binding region of a extracellular fibrinogen binding protein, or both and results in the inhibition of fibrinogen binding, of complement protein binding, inhibition of the shielding of the staphylococcus bacterium from recognition by a phagocytic receptor or a combination thereof.


The present invention provides a pharmaceutical composition for use in the treatment of an infection comprising (a) a pharmacologically effective amount of a modified extracellular fibrinogen binding protein in a pharmaceutically acceptable excipient, wherein the modified extracellular fibrinogen binding protein comprises at least a portion of a N-terminus fibrinogen binding region, at least a portion of a C-terminus complement protein binding region, or both, wherein the modified extracellular fibrinogen binding protein results in inhibiting the fibrinogen binding, C3 binding, the surface-bound complement protein, an antibody or combination thereof, or (b) a pharmacologically effective amount of a monoclonal and/or polyclonal antibody or antigen-binding fragment thereof that can specifically bind to a portion of a extracellular fibrinogen binding protein comprising a heavy and light chain variable regions that bind at least a portion of a N-terminus fibrinogen binding region of a extracellular fibrinogen binding protein, at least a portion of a C-terminus complement protein binding region of a extracellular fibrinogen binding protein, or both and results in the inhibition of fibrinogen binding, of complement protein binding, inhibition of the shielding of the staphylococcus bacterium from recognition by a phagocytic receptor or a combination thereof.


In another aspect, at least a portion of a N-terminus fibrinogen binding region may be selected from SEQ ID NO: 3-61, preferably SEQ ID NO: 3-30 or SEQ ID NO: 35-61. In one aspect, at least a portion of a N-terminus fibrinogen binding region may be selected from SEQ ID NO: 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, and 61. The fibrinogen binding protein may be Efb, Coa or both. The composition may further include an antigen selected from SpA, SpA variant, Emp, EsxA, EsxB, EsaC, Eap, EsaB, Coa, vWbp, vWh, Hla, SdrC, SdrD, SdrE, IsdA, IsdB, IsdC, ClfA, ClfB, SasF Sta006, Sta011, Hla and EsxA-EsxB.


The present invention provides a pharmaceutical composition for the targeted delivery of an active agent comprising a pharmacologically effective amount of a modified extracellular fibrinogen binding protein connected to a collagen-like domain, a globular domain or both and disposed in a pharmaceutically acceptable carrier, wherein the modified extracellular fibrinogen binding protein comprises a N-terminus fibrinogen binding region that binds a fibrinogen delivering the collagen-like domain, a globular domain or both to the fibrinogen. In another aspect, at least a portion of a N-terminus fibrinogen binding region may be SEQ ID NO: 2 or SEQ ID NO: 34. The collagen-like domain, a globular domain or both may form a hydrogel. The composition may further include an antigen selected from SpA, SpA variant, Emp, EsxA, EsxB, EsaC, Eap, EsaB, Coa, vWbp, vWh, Hla, SdrC, SdrD, SdrE, IsdA, IsdB, IsdC, ClfA, ClfB, SasF Sta006, Sta011, Hla and EsxA-EsxB.


The present invention provides a method for making a monoclonal antibody comprising the steps of: providing an effective amount of a composition comprising a modified extracellular fibrinogen binding protein having a N-terminus modified fibrinogen binding protein that does not bind fibrinogen, a C-terminus modified complement binding protein that does not bind a complement protein or both; producing an antibody pool of the modified extracellular fibrinogen binding protein, the C-terminus modified complement binding protein, or both; screening the antibody pool to detect active antibodies; wherein the active antibodies inhibit the fibrinogen binding to extracellular fibrinogen binding protein; separating the active antibodies; and adding the active antibodies to a pharmaceutically acceptable carrier.


The present invention provides a method for making a vaccine comprising the steps of: providing an effective amount of a composition comprising a modified extracellular fibrinogen binding protein having a N-terminus modified fibrinogen binding protein that does not bind fibrinogen, a C-terminus modified complement binding protein that does not bind a complement protein or both and further comprising an antigen selected from SpA, SpA variant, Emp, EsxA, EsxB, EsaC, Eap, EsaB, Coa, vWbp, vWh, Ha, SdrC, SdrD, SdrE, IsdA, IsdB, IsdC, ClfA, ClfB, SasF Sta006, Sta011, Hla and EsxA-EsxB. The N-terminus modified fibrinogen binding protein may have 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 99.1, 99.2, 99.3, 99.4, 99.5, 99.6, 99.7, 99.8, 99.9, or 99.99% homology to SEQ ID NO: 2; SEQ ID NO: 34; or both. In another aspect, at least a portion of a N-terminus fibrinogen binding region is selected from SEQ ID NO: 3-30; from SEQ ID NO: 35-61; or both. In another aspect, at least a portion of a N-terminus modified fibrinogen binding protein is selected from SEQ ID NO: 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, and 30 or from SEQ ID NO: 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61.


The present disclosure provides a method of vaccinating a host against staphylococcus bacterium by administering to a subject a pharmacologically effective amount of a vaccine in a pharmaceutically acceptable excipient, comprising a modified extracellular fibrinogen binding protein comprising at least a portion of a N-terminus region, at least a portion of a C-terminus region, or both, wherein the modified extracellular fibrinogen binding protein results in inhibiting the fibrinogen binding, C3 binding, or both or administering to a subject a pharmacologically effective amount of a vaccine in a pharmaceutically acceptable excipient, comprising a modified extracellular fibrinogen binding protein comprising at least a portion of a N-terminus region, at least a portion of a C-terminus region, or both, wherein the modified extracellular fibrinogen binding protein results in inhibiting the surface-bound complement protein, an antibody or both from shielding the staphylococcus bacterium from recognition by a phagocytic receptor.


The present disclosure provides a vaccine having a pharmacologically effective amount of a vaccine in a pharmaceutically acceptable excipient, comprising a modified extracellular fibrinogen binding protein comprising at least a portion of a N-terminus fibrinogen binding region, at least a portion of a C-terminus complement protein binding region, or both, wherein the modified extracellular fibrinogen binding protein results in inhibiting the fibrinogen binding, C3 binding, or both or having a pharmacologically effective amount of a vaccine in a pharmaceutically acceptable excipient, comprising a modified extracellular fibrinogen binding protein comprising at least a portion of a N-terminus fibrinogen binding region, at least a portion of a C-terminus complement protein binding region, or both, wherein the modified extracellular fibrinogen binding protein results in inhibiting the surface-bound complement protein, an antibody or both from shielding the staphylococcus bacterium from recognition by a phagocytic receptor.


The present disclosure also provides a monoclonal antibody or antigen-binding fragment thereof that can specifically bind to a portion of a extracellular fibrinogen binding protein comprising heavy and light chain variable regions that bind at least a portion of a N-terminus region of a extracellular fibrinogen binding protein that binds a fibrinogen, at least a portion of a C-terminus region of a extracellular fibrinogen binding protein that binds a complement protein, or both and results in the inhibition of the shielding of the staphylococcus bacterium from recognition by a phagocytic receptor.


One embodiment of the present disclosure provides a method for eliciting an immune response against a staphylococcus bacterium in a subject by identifying a subject having a staphylococcus bacterium; providing to the subject an effective amount of a composition comprising a modified extracellular fibrinogen binding protein (Efb) having a N-terminus binds that binds fibrinogen and a C-terminus binds a complement protein, wherein the Efb does not shield a surface-bound complement protein, an antibody or both from recognition by a phagocytic receptor.


Another embodiment of the present disclosure provides a vaccine made by combining a pharmaceutically acceptable excipient and an effective amount of a composition comprising a modified extracellular fibrinogen binding protein (Efb) having a N-terminus binds that binds fibrinogen and a C-terminus binds a complement protein, wherein the Efb does not shield a surface-bound complement protein, an antibody or both from recognition by a phagocytic receptor.


Another embodiment of the present disclosure provides a chimeric molecule of a extracellular fibrinogen binding protein (Efb) having a N-terminus that binds a fibrinogen; and a C-terminus that binds a complement protein, wherein the chimeric molecule can modulate complement activity, modulate antibody binding, modulate recognition by a phagocytic receptor or a combination thereof. The chimeric molecule may be capable of inhibiting or enhancing complement binding, antibody binding, recognition by a phagocytic receptor or a combination thereof.


Fibrinogen (Fg) is a plasma dimeric glycoprotein that is best known for its role in the blood coagulation cascade where thrombin proteolytically converts Fg to fibrin which then spontaneous assembles into the core of the clot. Coagulase (Coa) is a secreted staphylococcal protein and is a virulence determinant contributing to pathogenesis of staphylococcal diseases. Coa was named for its ability to support the conversion of Fg to insoluble fibrin. This activity involves Coa capturing and activating prothrombin in a non-proteolytic manner subsequently allowing the cleavage of Fg to fibrin by the activated protease. Coa also binds Fg directly independent of prothrombin. However, the molecular details underlying the Coa-Fg interaction remain elusive. The instant disclosure shows that the Fg binding activity of Coa is functionally related to that of staphylococcal Extracellular fibrinogen binding protein (Efb). In the competition ELISA assay, Coa and Efb compete with each other in binding to Fg suggesting these two staphylococcal proteins harbor similar Fg motif and are likely bind to the similar site(s) in Fg. Biochemical analyses allowed us to identify the critical residues for Fg binding in Efb and showed that the core of these residues are conserved in Fg binding motifs in Coa. This motif locates to an intrinsically disordered section of the protein and is unusually long covering 25-27 residues. Competition ELISA and isothermal titration calorimetry analyses demonstrate that Coa from Newman strain contains multiple Fg binding sites in which one locates in residues 474-505 and the others are in 5 tandem repeats which immediately follow the first binding site (residues 474-505). Binding of the Efb/Coa motif to Fg likely induces a conformational change in the plasma protein which might be the bases for the proteins ability to induce the formation of a Fg containing barrier around staphylococci that protects the bacteria from clearance by phagocytes.





DESCRIPTION OF THE DRAWINGS

For a more complete understanding of the features and advantages of the present invention, reference is now made to the detailed description of the invention along with the accompanying figures and in which:



FIGS. 1A-1F show the full-length Efb inhibits phagocytosis of S. aureus in human plasma.



FIG. 2A shows the domain organization of Efb, and 2B and 2C show the simultaneous binding to Fg and C3 is essential for phagocytosis inhibition by Efb.



FIGS. 3A-3C show the purified Efb blocks phagocytosis ex vivo and in vivo.



FIGS. 4A-4D show phagocytosis inhibition by Efb is independent of complement inhibition.



FIGS. 5A-5D show that Efb attracts Fg to the bacterial surface.



FIGS. 6A-6C show that Efb prevents recognition of opsonic C3b and IgG.



FIGS. 7A-7D show endogenously produced Efb blocks phagocytosis via complex formation.



FIG. 8 shows a mechanism for phagocytosis inhibition by Efb.



FIGS. 9A to 9D illustrate a schematic presentation of recombinant Coa fragments generated in this study. Coa is depicted in its secreted form Coa (27-636) lacking the signal peptide (1-26). FIG. 9B illustrates an ELISA assays of GST-tagged Coa fragments binding to immobilized Fg, Coa (Coa 27-636); Coa-N(Coa 27-310); Coa-C(Coa 311-636); Coa-R (Coa 506-636); Coa-F (Coa 311-505). FIG. 9C is a table that shows the protein concentration at which the reaction rate is half of Vmax (Km) and the goodness of fit (R2).



FIG. 9D illustrates the effect of peptide Efb-O on inhibition of recombinant Coa (rCoa) binding to Fg. Increasing concentration of Efb-O were incubated with 4 nM GST-tagged Coa proteins in Fg-coated microtiter wells. Control, BSA.



FIG. 10A is a table of the Efb-O variant peptides were synthesized where each residue in the sequence is individually replaced with Ala (or Ser when the native a.a. is Ala). FIG. 10A includes SEQ ID NOS:1-30. FIG. 10B is a plot of the Efb-O variant peptides inhibit rEfb-O (5 nM) binding to immobilized Fg in solid phase assay. FIG. 10 includes SEQ ID NO:2-30 Wells were coated with 0.25 μg/well Fg. Peptides (2 μM) were mixed with rEfb-O proteins (5 nM) and incubated in the Fg wells for 1 hour. FIG. 10C is a plot showing selected peptides inhibit rEfb-O binding to immobilized Fg. Increasing concentrations of Efb peptides were incubated with 5 nM rEfb-O in Fg-coated microtiter wells.



FIG. 11A is an image of a ClustalW alignment of amino acid sequence from Efb-O (Efb 68-98) and Coa from Newman strain (col-Newman). FIG. 11A includes SEQ ID NOS:62, 223, 224. FIGS. 11B and 11C show a comparison of amino acid sequence of Efb-O with Coa 474-505 (FIG. 11B) and Coa 506-532 (FIG. 11C). FIG. 11B includes SEQ ID NOS. 2 and 32. FIG. 11C includes SEQ ID NOS:2 and 33. FIGS. 11D and 11E show the effect of Coa and Efb peptides on inhibition of rEfb-N (Efb 30-104) (FIG. 11D) and rCoa-C (Coa 311-636) (FIG. 11E) binding to Fg by the inhibition ELISA assays.



FIG. 12A is a panel of Coa-RI variant peptides were synthesized where each residue in the sequence is individually replaced with Ala (or Ser when the native a.a. is Ala). FIG. 12A includes SEQ ID NOS: 34-61. FIG. 12B is shows sCoa-RI variant peptides (50 μM) inhibit GST-tagged rCoa-C(Coa 311-636) (2 nM) binding to immobilized Fg in solid phase assay. FIG. 12B includes SEQ ID NO: 34-61. Labels -1, -2, -3, -4, -5, -6, -7, -8, -9, -10, -11, -12, -13, -14, -15, -16, -17, -18, -19, -20, -21, -22, -23, -24, -25, -26, -27 refer to Coa-RI-1, Coa-RI-2, Coa-RI-3, Coa-RI-4, Coa-RI-5, Coa-RI-6, Coa-RI-7, Coa-RI-8, Coa-RI-9, Coa-RI-10, Coa-RI-11, Coa-RI-12, Coa-RI-13, Coa-RI-14, Coa-RI-15, Coa-RI-16, Coa-RI-17, Coa-RI-18, Coa-RI-19, Coa-RI-20, Coa-RI-21, Coa-RI-22, Coa-RI-23, Coa-RI-24, Coa-RI-25, Coa-RI-26, Coa-RI-27, respectively. Wells were coated with 0.25 μg/well Fg. FIG. 12C is a comparison of amino acid sequence of Efb-O with Coa-RI. FIG. 12C includes SEQ ID NOS:1 and 34. FIG. 12D is a Fg-binding register of tandem repeats in Coa. Bold letters denote the residues that are important for Fg binding. FIG. 12D includes SEQ ID NOS:63 and 225-229.



FIG. 13A is a schematic presentation of Coa R peptides. FIG. 13A includes SEQ ID NOS:34, 64, 65, 66-70. FIG. 13B is a plot of the effect of Coa peptides on inhibition of rCoa-C binding to fibrinogen.



FIGS. 14A-14C show a characterization of the interaction of Fg-D fragment with Coa peptides by VP-ITC.



FIG. 15 shows Coa and Efb prevent monocytic cells from adherence to fibrinogen.



FIG. 16A is a Schematic representation of DC2-Fg with fibrinogen (Fg) binding motif Efb-O. FIG. 16B is an image of a circular dichroism (CD) spectra of DC2 and DC2-Fg. Peak at 220 nm is indicative of triple helix. FIG. 16C is plot of the integrin α1 and α2 subunit expressing C2C12 cell adhesion to DC1 (no integrin binding site), DC2 (binding site for integrins α1 and α2), DC2-Fg (DC2 with fibrinogen binding site), and collagen (multiple binding sites for integrins α1 and α2). FIG. 16D is a graph showing fibrinogen binding to DC2, DC2-Fg, and Efb, as determined by solid phase binding assay.



FIG. 17 shows the binding of FBE5 antibodies to Coa and Efb fragments. The 11 monoclonal antibodies, selected against Coa-C311-636 were tested for binding to truncated recombinant proteins of the C-terminal part of Coagulase, namely Coa-F311-505, Coa-R0474-505 and Coa-R506-636, and different fragments of Efb, namely Efb-N30-105, Efb-A30-67 and Efb-O68-98. Coa-F311-505, Coa-R0474-505 and Coa-R506-636, and Efb-N30-105, Efb-A30-67 and Efb-O68-98 proteins were immobilized (200 ng/well) in a 96 well microtiter plate and probed with the indicated antibodies at a fixed concentration (0.5 μg/ml) in a solid-phase binding assay. Binding was observed for all of tested antibodies and it is noticeable that the antibodies displayed variable apparent affinities to the different Efb and Coa fragments. None of the FBE5 antibodies bound to Coa-R506-636.



FIG. 18 shows the dose-dependent binding of FBE5 antibodies to Coa fragments. The 11 monoclonal antibodies selected against Coa-C311-636 were titrated on different truncated recombinant proteins of the C-terminal part of Coagulase, namely Coa-C311-636, Coa-F311-505, Coa-R0474-505. Recombinant Coa-C311-636. Coa-F311-505. Coa-R0474-505 proteins were resuspended in 1×TBS buffer and immobilized (200 ng/well) in a 96 well microtiter plate overnight at 4° C. and probed with the selected antibodies in a solid-phase binding assay. Purified scFv-Fc were diluted in 2% BSA+1×PBS+0.05% TWEEN® 20 and a 10-fold serial dilution of each scFv-Fc was prepared. Varying concentration of scFv-Fcs' were incubated with Coa proteins for 1 hour at room temperature with shaking at 250 rpm. The bound scFv-Fv were detected using polyclonal α-human IgG HRP-conjugated Ab (P0214, Dako), diluted 1:10000 in 2% BSA+1×PBS+0.05% TWEEN® 20. SIGMAFAST™ OPD tablets (P9187, Sigma) were used for development as per manufacturer's instructions. Dose dependent binding was observed for all FBE5 antibodies and it is noticeable that the antibodies display variable apparent affinities to the different proteins. An irrelevant isotype-matched antibody (isotype control) was tested. As shown, no binding was detectable for this latter antibody.



FIG. 19 is a table that shows the apparent Kd of anti-CoaC mAbs to different truncated recombinant Coa proteins determined through EC50 calculation in ELISA. Apparent affinity values were generated through analysis of the half maximum binding in ELISA, using GRAPHPAD PRISM® Version 6.01. Apparent Kd values in the range of 10−9-10−10 M were obtained for most antibodies against all three Coa fragments tested (Coa-C311-636, Coa-F311-505. Coa-R0474-505). The antibody FBE5-F11 has the highest affinity to all the three proteins tested and FBE5-C8, conversely was the weakest binder to the three fragments of Coa tested.



FIG. 20 shows the dose-dependent binding of FBE5 antibodies to recombinant truncated Efb proteins. The 11 monoclonal antibodies selected against Coa-C311-636 were titrated on different portions of the N-terminal part of Efb protein, that, as reported in previous claims, has sequence and functional homology to Coagulase. Recombinant proteins Efb-N30-105, Efb-A30-67 and Efb-O68-98 were resuspended in 50 mM sodium carbonate pH 9.6 and immobilized (200 ng/well) in 96 well microtiter plate overnight at 4° C. and probed for recognition in a solid-phase binding assay. These proteins were probed with different quantities of the selected antibodies. Ten-fold serial dilution of scFv-Fc were prepared in 2% BSA+1×PBS+0.05% TWEEN® 20 and incubated with immobilized protein for 1 hour at room temperate with shaking at 250 rpm. Bound scFv-Fc were detected using α-human IgG HRP-conjugated Ab (P0214, Dako) diluted 1:10000 in 2% BSA+1×PBS+0.05% TWEEN® 20. SIGMAFAST™ OPD tablets (P9187, Sigma) were used for development as per manufacturer's instructions. Dose dependent binding was observed for all the antibodies tested and it is noticeable that the antibodies display variable apparent affinities to the different proteins. An irrelevant isotype-matched antibody (isotype control) was tested. As shown, no binding was detectable for this latter antibody.



FIG. 21 is a table with the apparent Kd of anti-CoaC mAbs to Efb fragments determined through EC50 calculation in ELISA. Apparent affinity values were generated through analysis of the half maximum binding in ELISA, using GRAPHPAD PRISM® Version 6.01. In most cases, apparent Kd values in the range of 10−8-10−9 M were obtained for antibodies against all three Efb fragments tested (namely Efb-N30-105, Efb-A30-67 and Efb-O68-98). FBE5-F11 was the only exception, since it displayed apparent affinities in the range of 10−10 M against all three Efb fragments. Weak binders, FBE5-C1, FBE5-C8, FBE5-E5, showed very modest binding and in some cases an estimation of apparent affinities was not possible (ND, not determinable).



FIG. 22 shows the FBE 5 mAbs that efficiently inhibit binding of Coa and Efb to Fg in a dose-dependent manner. To assess the inhibitory activity of anti-Coa scFv-Fc antibodies, 0.5 μg/well of human Fg was immobilized at 4° C. overnight in 50 mM Carbonate Buffer, pH 9.6. Indicated amounts (50, 5, 0.5 μg/ml) of scFv-Fcs prepared in 2% BSA+1×TBS+0.05% TWEEN® 20 were pre-incubated for 1 hour with a constant concentration of Coa or Efb fragments also prepared in 2% BSA+1×TBS+0.05% TWEEN® 20 at room temperature, 250 rpm shaking. Specifically, Coa-F, Coa-R0, Efb-N and Efb-O were at a fixed concentration of 10 nM; whereas Efb-A was at 750 nM. Fg-binding activity of each protein alone was also checked (no mAb control—0 μg/ml). The Fg-coated plate was blocked with 2% BSA-TBST and washed with PBST. The pre-incubated mixture of Coa/Efb and anti-Coa scFv-Fc was transferred on the Fg-coated plate and incubated for 1 hour at room temperature with shaking at 250 rpm. Residual bound Coa and Efb fragments were detected with HRP-conjugated (HorseRadish Peroxidase-conjugated) α-GST-tag antibody, except for Efb-N, where an HRP-conjugated α-HIS-tag was used (see FIG. 18). HRP-tagged antibodies were diluted in 2% BSA+1×TBS+0.05% TWEEN® 20 and used at 1:10000 dilution. Antibodies were incubated for 1 hour at room temperature with shaking at 250 rpm. HRP signal was developed using SIGMAFAST™ OPD tablets using manufacturer's guidelines. Binding of Coa and Efb fragments to Fg (no mAb control) was set to 100% and residual binding to Fg of Coa and Efb fragments in the presence of different concentrations of antibodies was calculated and represented. FBE5-A12, FBE5-D10, FBE5-F9 and FBE5-F11 did show a dose dependent inhibition of all proteins tested. In particular FBE5-F11 showed a marked inhibition against all fragments of Coa and Efb. FBE5-A12, FBE5-D10 and FBE5-F9 showed a clear inhibition of CoaF, CoaRO and EfbA, being less efficient in inhibiting EfbN and EfbO.



FIG. 23 shows that Peptide CoaRO, but not peptide CoaRI, inhibit FBE5 mAbs binding to CoaC. To investigate if FBE5 mAbs could be inhibited by CoaRO and CoaRI peptides, CoaC (200 ng/well) was immobilized at 4° C. overnight in 50 mM Carbonate Buffer, pH 9.6. A fixed concentration of mAbs (0.5 μg/ml) in 2% BSA+1×TBS+0.05% TWEEN® 20 was added to the wells along with indicated amounts of CoaRO and CoaRI peptides diluted in 1×TBS. Incubation for 1 hour, room temperature, 250 rpm shaking followed. Bound scFv-Fcs were detected using a polyclonal α-human IgG HRP-conjugated Ab diluted 1:10000 in 2% BSA+1×PBS+0.05% TWEEN® 20. Antibody was incubated in the 96 well plate for 1 hour at room temperature with shaking at 250 rpm. HRP signal was developed using SIGMAFAST™ OPD following manufacturer's guidelines. An irrelevant, isotype-matched scFv-Fc served as a control (FBE3-X). All FBE5 antibodies were inhibited by peptide CoaRO in a fashion dependent of the peptide concentration. Instead, peptide CoaRI was unable to affect FBE5 mAbs binding to CoaC. An irrelevant isotype-matched antibody (FBE3-X) was tested. As shown, no binding to Coa-C was detected for this latter antibody, nor did the presence of CoaRO or CoaRI peptide affect this antibody.



FIG. 24 shows the dose-dependent binding of LIG40 antibodies to Coa and Efb fragments. The 2 monoclonal antibodies selected against Coa-R506-636 were titrated on different portions of the N-terminal part of Efb protein (Efb-N30-105, Efb-A30-67 and Efb-O68-98), that, as reported in the parent patent, has sequence and functional homology to Coagulase. As well, binding was tested against Coa fragments, namely Coa-C311-636. Coa-F311-505. Coa-R0474-505 and Coa-R506-636. Recombinant proteins Efb-N30-105, Efb-A30-67, Efb-O68-98, Coa-C311-636, Coa-F311-505, Coa-R0474-505 and Coa-R506-636 were diluted in 50 mM sodium carbonate pH 9.6 and immobilized at the concentration of 200 ng/well for 1 hour at room temperature. Immobilized proteins were probed for recognition in a solid-phase binding assay with different quantities of LIG40 antibodies after blocking and washing. After washing, varying concentrations of LIG40 scFv-Fc antibodies were diluted in 2% BSA+1×PBS+0.05% TWEEN® 20 and incubated with the immobilized proteins for 1 hour at room temperature with shaking at 250 rpm. Bound scFv-Fcs were detected using polyclonal α-human IgG HRP-conjugated Ab diluted to 1:10000 in 2% BSA+1×PBS+0.05% TWEEN® 20. HRP-conjugated Ab was incubated for 1 hour at room temperature with shaking at 250 rpm. HRP signal was developed with SIGMAFAST™ OPD using manufacturers guidelines. These 2 antibodies bound only Coa fragments in a dose dependent manner. No binding to truncated recombinant Efb proteins was observed. LIG40-A11 recognized specifically Coa-R506-636 and, reasonably, Coa-C311-636, even though the latter with lower apparent affinity. No binding to all other proteins has been detectable for LIG40-A11. LIG40-D8 also bound Coa-R506-636 and Coa-C311-636 but also binding of Coa-F311-505 and Coa-R0474-505 was detected to a minor extent. Both antibodies did not show binding to BSA and an irrelevant isotype-matched antibody (isotype control) did not show binding to the immobilized proteins.



FIG. 25 shows that LIG40-A11 mAb inhibits binding to Fg of Coa-C311-636 and Coa-R506-636 in a dose-dependent manner. To assess the inhibitory activity of LIG40-A11 antibody, 0.5 μg/well of human Fg was immobilized at 4° C. overnight in 50 mM Carbonate Buffer, pH 9.6. Indicated amounts of LIG40-A11 prepared in 2% BSA+1×TBS+0.05% TWEEN® 20 were pre-incubated for 1 hour with a constant concentration of CoaC or CoaR (10 nM) also prepared in prepared in 2% BSA+1×TBS+0.05% TWEEN® 20 at room temperature with shaking at 250 rpm. Fg-binding activity of each protein at 10 nM was also checked in the absence of antibody, referred as CTRL+(CoaC) and CTRL+(CoaR) in the figure (no mAb control—CTRL+). The Fg-coated plate was blocked with 2% BSA-TBST and washed with TBST. The pre-incubated mixture of CoaC/CoaR and LIG40-A11 was transferred on the Fg-coated plate. Residual bound CoaC and CoaR were detected with HRP-conjugated α-GST-tag antibody, diluted 1:10000 in 2% BSA-1×TBS+0.05% TWEEN® 20, incubated for 1 hour, room temperature, 250 rpm. Binding of CoaC and CoaR to Fg in the absence of mAb (referred as CTRL+(CoaC) and CTRL+(CoaR) in the figure) (no mAb control—CTRL+) was set to 100% and residual binding to Fg of CoaC and CoaR in the presence of different concentrations of antibodies was calculated and represented. LIG40-A11 showed a dose-dependent inhibition of CoaC and CoaR, being more potent against CoaR.



FIG. 26 shows that peptides CoaRO and CoaRI differentially inhibit LIG40 mAbs (LIG40-A11 and LIG40-D8) binding to CoaC and CoaR. To investigate if LIG40 mAbs could be inhibited by CoaRO and CoaRI peptides, CoaC and CoaR (200 ng/well) was immobilized at 4° C. overnight in 50 mM Carbonate Buffer, pH 9.6. A fixed concentration of mAbs (0.5 μg/ml) prepared in 2% BSA+1×TBS+0.05% TWEEN® 20 was added to the wells along with indicated amounts of CoaRO and CoaRI peptides prepared in 1X TBS. Incubation for 1 hour, room temperature, 250 rpm shaking followed. After washing, the levels of bound mAbs were determined using a polyclonal α-human IgG HRP-conjugated Ab diluted 1:10000 in 2% BSA+1×TBS+0.05% TWEEN® 20. Incubation lasted 1 hour at room temperature with shaking at 250 rpm. The development was performed through SIGMAFAST™ OPD tablets following manufacturer's protocol. Surprisingly, LIG40-A11 and LIG40-D8 behaved differently in the presence of the two peptides. First, to achieve appreciable inhibition high concentration of peptides needed to be used (above 100 μM). Secondly and most importantly, LIG40-A11 was inhibited only by CoaRI peptide, both when mAb binding was tested against CoaC and CoaR. In symmetrical opposite way, LIG40-D8 was only impaired in its binding activity by CoaRO peptide, suggesting that the differential role of the two repeats.



FIG. 27 is a table that shows the apparent Kd of anti-Coa-R506-636 mAbs to Coa fragments determined through EC50 calculation in ELISA. Apparent affinity values were generated through analysis of the half maximum binding in ELISA, using GRAPHPAD PRISM® Version 6.01. For both antibodies, values in the range of 10−10-10−11 M were obtained. LIG40-A11 showed the highest apparent affinity for CoaR (7.05×10−11 M) whereas LIG40-D8 was the one that showed the highest half-maximum binding to CoaC (9.39×10−11 M). Only LIG40-D8 showed minor binding to CoaRO and CoaF, instead for LIG40-A11 there was no detectable binding (apparent affinity not determinable, ND).





DESCRIPTION OF EMBODIMENTS

While the making and using of various embodiments of the present invention are discussed in detail below, it should be appreciated that the present invention provides many applicable inventive concepts that can be embodied in a wide variety of specific contexts. The specific embodiments discussed herein are merely illustrative of specific ways to make and use the invention and do not delimit the scope of the invention.


To facilitate the understanding of this invention, a number of terms are defined below. Terms defined herein have meanings as commonly understood by a person of ordinary skill in the areas relevant to the present invention. Terms such as “a”, “an” and “the” are not intended to refer to only a singular entity but include the general class of which a specific example may be used for illustration. The terminology herein is used to describe specific embodiments of the invention, but their usage does not delimit the invention, except as outlined in the claims.


Upon contact with human plasma, bacteria are rapidly recognized by the complement system that labels their surface for uptake and clearance by phagocytic cells. Staphylococcus aureus secretes the 16 kD Extracellular fibrinogen binding protein (Efb) that binds two different plasma proteins using separate domains: the Efb N-terminus binds to fibrinogen, while the C-terminus binds complement C3. Efb blocks phagocytosis of S. aureus by human neutrophils. In vitro, Efb blocks phagocytosis in plasma and in human whole blood. Using a mouse peritonitis model, Efb effectively blocks phagocytosis in vivo, either as a purified protein or when produced endogenously by S. aureus. Mutational analysis revealed that Efb requires both its fibrinogen and complement binding residues for phagocytic escape. Using confocal and transmission electron microscopy it can be see that Efb attracts fibrinogen to the surface of complement-labeled S. aureus generating a ‘capsule’-like shield. This thick layer of fibrinogen shields both surface-bound C3b and antibodies from recognition by phagocytic receptors. This information is critical for future vaccination attempts, since opsonizing antibodies may not function in the presence of Efb. Efb from S. aureus uniquely escapes phagocytosis by forming a bridge between a complement and coagulation protein.


The present disclosure describes a novel mechanism by which S. aureus can prevent uptake by phagocytic immune cells. Specifically, the secreted S. aureus protein Extracellular fibrinogen binding protein (Efb) generates a ‘capsule’-like shield around the bacterial surface through a dual interaction with the plasma proteins complement C3b and fibrinogen. The Efb-dependent fibrinogen shield masks important opsonic molecules like C3b and antibodies from binding to phagocyte receptors. This information is critical for future vaccination attempts, since opsonizing antibodies may not function in the presence of this anti-phagocytic shield.


Phagocytosis by neutrophils is crucial to the host innate defense against invading bacteria since it leads to intracellular destruction of bacteria by production of oxygen radicals and proteolytic enzymes. Bacterial engulfment by neutrophils is strongly enhanced by the labeling or ‘opsonization’ of bacteria with plasma factors such as antibodies and complement activation products (C3b, iC3b). Complement activation takes place at the bacterial surface and is initiated by recognition molecules (C1q, Mannose Binding Lectin (MBL)) that interact with bacterial surface structures like sugars or proteins. Complement activation occurs through three different pathways (classical, lectin and alternative) that converge in the formation of C3 convertase enzymes that cleave the central complement protein C3. This cleavage step leads to massive decoration of the bacterial surface with covalently deposited C3b and iC3b molecules, which are recognized by complement receptor 1 and 3 (CR1 and CR3) on neutrophils. Complement activation proceeds by formation of C5 convertase enzymes that cleave C5 to release the potent chemoattractant C5a and C5b, which initiates formation of the membrane attack complex.



Staphylococcus aureus is an important human pathogen notorious for its ability to cause both community- and hospital-acquired diseases, ranging from mild skin infections to bacteremia, sepsis and endocarditis. Although Methicillin-resistant S. aureus (MRSA) was previously considered as an opportunistic pathogen causing hospital-acquired infections in immune-compromised patients, the emergence of the highly virulent community-associated (CA-) MRSA showed that this bacterium could also cause serious infections in otherwise healthy persons. Due to the rapid emergence of antibiotic resistance strains, alternative therapy options are now being explored. Vaccination has not been successful so far and an important reason may be the bacteria's elaborate immune evasion repertoire. Therefore, immune evasion proteins are now considered as important vaccination targets. One proposed vaccine candidate is the S. aureus Extracellular fibrinogen binding protein (Efb), a 16-kD secreted protein with a presumable role in disease pathogenesis, which is found in 85% of S. aureus strains. The secreted Efb protein consists of two functionally distinct domains: a disordered 9 kD N-terminus (Efb-N) that harbors two binding sites for fibrinogen (Fg) and a folded 7 kD C-terminus (Efb-C) that binds to the C3d domain of complement C3 (which is also present in C3b and iC3b). Although previous papers described various functions for the isolated N- and C-terminal domains of Efb, it is currently not understood why the full-length Efb protein harbors both a Fg and C3d binding site. The present disclosure shows Efb potently blocks phagocytosis of bacteria via a novel mechanism linking the complement and coagulation proteins.


Full-length Efb inhibits phagocytosis in the presence of plasma. FIG. 1A shows phagocytosis of fluorescently labeled S. aureus by purified human neutrophils in the presence of human serum or plasma and Efb (0.5 μM). FIG. 1B shows a histology image of human neutrophils incubated with S. aureus and 2.5% plasma in the presence or absence of Efb (0.5 μM). Cells were stained using Diff-Quick. FIG. 1C shows dose-dependent phagocytosis inhibition by Efb in the presence of 2.5% human plasma. IC50 was calculated using non-linear regression analysis, R2=0.95. FIGS. 1D-1F show phagocytosis in the presence of 5% human serum supplemented with either full-length human Fg (FIG. 1D), the D domain of human Fg (1 μM or 86 μg/ml) (FIG. 1E) or mouse Fg (WT or lacking the Mac-1 binding site) (FIG. 1F). A, C-F are mean f se of three independent experiments. B is a representative image. *P<0.05, **P<0.005 for Efb versus buffer (two-tailed Student's t-test).


The present disclosure provides potential role for full-length Efb in phagocytosis escape, fluorescently labeled S. aureus was mixed with purified human neutrophils, Efb (0.5 μM) and human serum or plasma as a source for complement and analyzed bacterial uptake by flow cytometry. In the presence of serum, Efb did not affect bacterial uptake by neutrophils (FIG. 1A). However, when human plasma as a complement source was used, Efb strongly prevented phagocytosis (FIGS. 1A and 1B) and subsequent bacterial killing by neutrophils. Phagocytosis inhibition in plasma occurred in a dose-dependent fashion with a calculated IC50 of 0.08 μM (FIG. 1C). Since the main difference between plasma and serum lies in the presence of coagulation proteins, it was investigated whether the observed differences in phagocytosis inhibition were caused by the fact that serum lacks Fg. The supplementation of serum with physiological concentrations of Fg led to phagocytosis inhibition by Efb (FIG. 1D). Fg is a large (340 kD) dimeric protein that comprises one central E-fragment and two lateral D-fragments. Since Efb binds to the D-fragment of Fg, it was examined if supplementing serum with Fg-D would also lead to phagocytosis inhibition by Efb. Interestingly, Efb could not block phagocytosis in the presence of Fg-D (FIG. 1E) indicating that full-length Fg is required for phagocytosis inhibition by Efb. Since Fg is a ligand for CR3 (or Mac-1) on neutrophils, it was examined whether the binding of Fg to this receptor is important for the anti-phagocytic effect of Efb. Therefore, purified Fg from wild-type mice or Fgγ390-396A mice (ΔMac-1 Fg) mice that express a mutated form of Fg lacking the Mac-1 binding site but retaining clotting function. FIG. 1F shows that supplementation of human serum with both forms of mouse Fg led to inhibition by Efb, indicating that Fg binding to Mac-1 is not important for inhibition. In conclusion, Efb interferes with phagocytosis in a plasma environment and the presence of full-length Fg is required for this inhibition.



FIG. 2A shows a schematic overview of Efb mutants generated in this study. Efb is depicted in its secreted form (30-165) lacking the signal peptide (1-29). Bounding boxes indicate Fg- and C3-binding domains. The N-terminus of Efb (9 kD) harbors two Fg binding sites named Fg1 (residues 30-67) and Fg2 (residues 68-98). The C-terminus of Efb (7 kD) harbors the C3 binding site (residues R131 and N138). EfbΔFg1 has deletion of residues 30-45, resulting in non-functional binding Fg1; whereas EfbΔFg2 has deletion of residues 68-76, resulting in non-functional binding Fg2. In the figure, SP represents the signal peptide, N shows the N-terminus of the protein, C represents the C-terminus of the protein, the light grey box represents the His tag and the dark grey box represents the GST tag. FIG. 2B shows phagocytosis of fluorescent S. aureus by human neutrophils in the presence of 5% human plasma and Efb fragments (B) or Efb mutants (C) (all at 1 μM). B&C are mean f se of three independent experiments. **P<0.005 for Efb versus buffer (two-tailed Student's t-test).


Simultaneous binding to Fg and C3 is essential for phagocytosis inhibition by Efb. To get more insight into the mechanism of inhibition, panel of Efb mutants was constructed (FIG. 2A). FIG. 2A shows a schematic representation of domain organization of Efb protein. From the N-terminus Efb contains a signal peptide (SP), N-terminus domain that binds fibrinogen is labeled as EfbN and a C-terminus domain that binds complement protein is labeled as EfbC. The individual N or C termini of Efb could not block phagocytosis in plasma (FIG. 2B). In addition, mixing the N and C terminal fragments of Efb did not markedly affect phagocytosis, indicating that full-length Efb is required. Second, mutants of full-length Efb lacking the previously characterized binding sites for Fg and C3 were generated (FIG. 2A). Three different Fg-binding mutants were created: EfbΔFg1 lacking residues 30-45, EfbΔFg2 lacking residues 68-76 and EfbΔFg1+2 lacking both these Fg binding sites. Furthermore, EfbΔC3 were created in which the C3d-binding residues R131 and N138 were each replaced with a glutamic acid (E) (also known as Efb-RENE). Using ELISA's it can be seen that EfbΔFg1+2 could no longer bind Fg, while the single EfbΔFg1 and EfbΔFg2 mutants and EfbΔC3 still bound Fg. As expected, all mutants except EfbΔC3 to bound to C3b. Next, these mutants in the neutrophil phagocytosis assay were compared in the presence of human plasma. EfbΔFg1+2 and EfbΔC3 could no longer block phagocytosis (FIG. 2C), indicating that a simultaneous interaction with both Fg and complement C3 (products) is essential for the anti-phagocytic action of Efb. The finding that EfbΔFg1 and EfbΔFg2 were still active indicates that Efb requires only one of its two Fg binding sites to block phagocytosis.



FIG. 3A shows Ex vivo phagocytosis of fluorescent S. aureus incubated with 50% human whole blood and Efb (1 μM). Neutrophils were gated based on forward and side scatter properties. FIG. 3B shows In vivo phagocytosis of fluorescent S. aureus by human neutrophils in the mouse peritoneum. Neutrophils were attracted to the peritoneal cavity using carrageenan (i.p.) and subsequently challenged with 108 heat-inactivated fluorescent S. aureus and Efb (1 μM) for 1 hour. The peritoneal lavage was collected, and neutrophil phagocytosis was analyzed by flow cytometry. Neutrophils were gated based on Gr-1 expression. The mouse studies were carried out three times. 3 mice per group were used and the cells of these 3 mice were pooled for phagocytosis analysis. FIG. 3C shows a representative histograms of FIG. 3B. A, B are mean f se of three independent experiments. *P<0.05, **P<0.005 for Efb versus buffer (two-tailed Student's-test).


Efb blocks phagocytosis ex vivo and in vivo. To study whether Efb can also block phagocytosis in a natural environment, its activity in ex vivo and in vivo was examined using phagocytosis models. In an ex vivo human whole blood model, fluorescent S. aureus was incubated with 50% human whole blood and Efb. After 25 minutes, neutrophil phagocytosis was analyzed by flow cytometry. Full-length Efb potently blocked phagocytosis by human neutrophils in whole blood (FIG. 3A) and that this inhibition depends on the interaction of Efb with both Fg and C3. Phagocytosis of S. aureus in an in vivo mouse peritonitis model was examined. To this end, mice were treated with carrageenan (i.p.) to induce neutrophil infiltration into the peritoneal cavity and subsequently challenged with 108 heat-inactivated fluorescent S. aureus in the presence or absence of Efb (1 μM). One hour later, mice were sacrificed, and the peritoneum was lavaged with sterile PBS. Neutrophils were stained and phagocytosis of fluorescent bacteria was analyzed by flow cytometry. It can be seen that Efb blocked phagocytosis in the peritoneum (FIGS. 3B and 3C). Efb mutants showed that inhibition of phagocytosis in vivo also depends on the Fg and C3 binding domains of Efb.



FIG. 4A shows phagocytosis of fluorescently labeled S. epidermidis and E. coli by purified human neutrophils in the presence of human plasma (5%) and Efb. FIG. 4B shows an immunoblot detecting surface-bound C3b after incubation of S. aureus with 5% human plasma in the presence of 5 mM EDTA or 0.5 μM Efb. Blot is a representative of 3 independent experiments. FIG. 4C shows alternative pathway hemolysis of rabbit erythrocytes in 5% human plasma and Efb (mutants) (1 μM). Bars are the mean t se of three independent experiments. **P<0.005 for Efb versus buffer (two-tailed Student's t-test). FIG. 4D shows phagocytosis with a washing step. Fluorescent S. aureus was first incubated with 5% serum to deposit complement. Bacteria were washed and subsequently mixed with neutrophils and Fg in the presence or absence of Efb (0.5 μM).


Phagocytosis inhibition by Efb is independent of complement inhibition. Studies shown above indicate that Efb requires an interaction with both complement and Fg to block phagocytosis. To study whether Efb also interacts with S. aureus specifically, it was analyzed whether purified Efb can block phagocytosis of other bacteria as well. Fluorescent S. epidermidis or E. coli were mixed with human plasma and phagocytosis by neutrophils was evaluated. Efb potently inhibits the uptake of these bacteria as well, indicating that Efb can block phagocytosis independently of S. aureus (FIG. 4A). The C-terminal domain of Efb is a complement inhibitor that inactivates C5 convertases to prevent cleavage of C5. Efb-C did not affect C3b labeling of bacteria in conditions where all complement pathways are active. However, since the effects of Efb on complement were performed with serum instead of plasma, it was examined whether full-length Efb might affect C3b labeling of bacteria in a plasma environment. S. aureus was incubated with human plasma and Efb and quantified surface-bound C3b using immunoblotting. As a control, EDTA was added to prevent activation of all complement routes (which are calcium and magnesium dependent). Lower amounts of C3b was not found on the bacterial surface in the presence of Efb compared to buffer (FIG. 4B), indicating that Efb does not interfere with C3b labeling in plasma. Subsequently, the inhibition of C5 convertases by Efb (mutants) in plasma using an alternative pathway hemolytic assay was examined. Rabbit erythrocytes were incubated with human plasma and C5 cleavage was measured by means of C5b-9 dependent lysis of erythrocytes. In conjunction with previous results in serum, it can be see that all Efb mutants except for EfbΔC3 inhibited C5 cleavage in plasma (FIG. 4C). Since this inhibition exclusively depends on the C-terminal domain (all Fg binding mutants of Efb could still block C5 cleavage), this proves that interference with C5 cleavage is at least not sufficient for phagocytosis inhibition by Efb. To further show that the effects of Efb on complement activation are dispensable for phagocytosis inhibition a washing step was added to the phagocytosis assay. Bacteria were first incubated with serum (in the absence of Efb) to deposit C3b. After washing away unbound serum proteins (including C5a), these pre-opsonized bacteria were incubated with Fg and neutrophils. In this assay, Efb could potently block phagocytosis (FIG. 4D). In conclusion, these results indicate that the anti-phagocytic activity of Efb is not related to its complement-inhibitory effect.



FIG. 5A shows an ELISA showing that Efb can bind Fg and C3b at the same time. C3b-coated microtiter wells were incubated with Efb (mutants) and, after washing, incubated with 50 nM Fg that was detected with a peroxidase-conjugated anti-Fg antibody (Abcam). Graph is a representative of two independent studies performed in duplicate. FIG. 5B shows binding of ALEXA FLUOR™ 488-labeled Fg (60 μg/ml) to serum-opsonized S. aureus in the presence of Efb (mutants) (0.5 μM). Graph represents mean±se of three independent experiments. *P<0.05, **P<0.005 for Efb versus buffer (two-tailed Student's t-test). N.S. is not significant. FIG. 5C shows confocal analysis of samples generated in B (representative images). FIG. 5D shows TEM pictures of S. aureus incubated with 5% human plasma in the absence or presence of Efb (0.5 μM).


Efb covers S. aureus with a shield of Fg. To determine whether Efb might bind to C3b-labeled bacteria and then attract Fg to the surface, full-length Efb binding to Fg and C3b at the same time. C3b-coated microtiter plates were incubated with Efb and, after a washing step, treated with Fg. FIG. 5A shows that Efb is able to form a complex with C3b and Fg. Also, the EfbΔFg1 and EfbΔFg2 mutants could still form Fg-C3b complexes. In contrast, complex formation was not detected for the mutants that lack either both Fg (EfbΔFg1+2) or the C3 binding domains (EfbΔC3) (FIG. 5A). Then Efb binding and attracting Fg to pre-opsonized bacteria was examined. Therefore, S. aureus was pre-opsonized with human serum to deposit complement and subsequently incubated with Efb. After washing, bacteria were incubated with ALEXA FLUOR™ 488 conjugated Fg. Using both flow cytometry and confocal microscopy it can be seen that that Efb mediates Fg binding to pre-opsonized bacteria (FIGS. 5B, 5C). Consistent with the ELISA data for complex formation, no Fg binding was detected in the presence of EfbΔFg1+2 or EfbΔC3. Confocal analyses indicated that Efb covers the complete bacterial surface with Fg (FIG. 5C). Using Transmission Electron Microscopy this Fg layer created by Efb and be seen in more detail. After incubation of S. aureus with plasma and Efb, a diffuse outer layer formed around the bacteria (FIG. 5D). Altogether these studies show that Efb binds to C3b on the bacterial surface and subsequently attracts Fg forming a shield around the bacterial surface.


Flow cytometry assay detecting binding of soluble CR1 (FIG. 6A) or anti-IgG antibody (FIG. 6B) to pre-opsonized S. aureus in the presence of buffer, Efb (0.5 μM) and/or Fg (200 μg/ml). FIG. 6C shows Efb inhibits phagocytosis of encapsulated S. aureus by human neutrophils. FITC-labeled S. aureus strain Reynolds (high capsule CP5 expressing strain) was incubated with human plasma and/or Efb (0.5 μM) in the presence (dotted line) or absence (solid line) of polyclonal rabbit anti-CP5 antibody. All figures represent the mean f se of three separate experiments. *P<0.05, **P<0.005 for Efb+Fg versus buffer (A, B) or Efb versus buffer (for dotted lines) (two-tailed Student's t-test).


Efb blocks recognition of C3b and IgG on the surface. Since Efb covers bacteria with a shield of Fg, which would frustrate the binding of phagocytic receptors to their ligands on the bacterial surface using flow cytometry, it was first analyzed whether C3b-labeled bacteria were still recognized by CR1. Pre-opsonized S. aureus was incubated with soluble CR1 in the presence of Fg and Efb. Clearly, binding of CR1 to pre-opsonized bacteria was blocked by the presence of both Fg and Efb (FIG. 6A). Addition of Fg or Efb alone did not affect CR1 binding. Next, it was investigated whether the Fg shield specifically blocks C3b-CR1 interactions or whether it also disturbs the binding of neutrophil Fc receptors to opsonic antibodies. To analyze this, it was determined whether the Fc part of bacterium-bound IgG could still be recognized by specific antibodies and found that incubation of pre-opsonized bacteria with Efb and Fg disturbs recognition of the antibody Fc domain on the surface (FIG. 6B), suggesting that Fc receptors can no longer recognize their target. This information is crucial for future vaccine development since opsonic antibodies against S. aureus may not function when Efb hides these antibodies underneath an Fg shield. To further prove that Efb functionally blocks opsonization, phagocytosis of an encapsulated S. aureus strain in the presence or absence of anti-capsular antibodies was analyzed. The encapsulated S. aureus strain Reynolds was grown for 24 hours in Columbia agar supplemented with 2% NaCl (for optimal capsule expression) and subsequently labeled with FITC. Capsule expression after FITC-labeling was confirmed using specific antibodies. In low plasma concentrations (0-1%), it was observed that anti-capsular antibodies caused a 6-fold increase in phagocytic uptake of encapsulated S. aureus (FIG. 6C). At these plasma concentrations, Efb could not block phagocytosis. However, at higher plasma concentrations (3% and more), Efb potently impeded phagocytosis in the presence of anti-capsule antibody (FIG. 6C). These data support our idea that the Fg shield created by Efb prevents recognition of important opsonins like C3b and IgG, also in the context of a capsule-expressing strain that is targeted by specific antibodies.



FIG. 7A left shows immunoblot detecting Efb in 4 h and 20 h culture supernatants of S. aureus Newman; fixed concentrations of His-tagged Efb were loaded as controls. FIG. 7A right shows immunoblot of 4 h culture supernatants of S. aureus Newman (WT), an isogenic Efb deletion mutant (ΔEfb) and its complemented strain (ΔEfb+pEfb). Blots were developed using polyclonal sheep anti-Efb and Peroxidase-labeled donkey anti-sheep antibodies. Blot is a representative of two independent experiments. FIG. 7B shows flow cytometry analysis of the binding of ALEXA FLUOR™ 488-labeled Fg to pre-opsonized S. aureus in the presence of 4 h culture supernatants (2-fold diluted) or purified Efb (250 nM). FIG. 7C shows in vitro phagocytosis of fluorescently labeled S. aureus by purified human neutrophils. Pre-opsonized S. aureus was first incubated with 4 h culture supernatants (2-fold diluted) or purified Efb (250 nM) and subsequently mixed with Fg and neutrophils. FIG. 7D shows in vivo phagocytosis of GFP-expressing wild-type or Efb-deficient S. aureus strains by neutrophils in the mouse peritoneal cavity. Neutrophils were attracted to the peritoneal cavity using carrageenan (i.p.) and subsequently injected with 300 μl of GFP-expressing wild-type (SA WT) or Efb-deficient (SAΔEfb) S. aureus strains during the exponential phase of growth. The peritoneal lavage was collected 1 hour thereafter and neutrophil phagocytosis was analyzed by flow cytometry. Neutrophils were gated based on Gr-1 expression. Graphs in B-D represent mean f se of three independent experiments. *P<0.05, **P<0.005 for Buffer versus WT Sup or WT (Sup) versus ΔEfb (Sup) (two-tailed Student's t-test).


Endogenous Efb blocks phagocytosis in vitro and in vivo. To study whether endogenous expression of Efb leads to impaired phagocytosis of S. aureus via complex formation, the analyses was extended with (supernatants of) an isogenic Efb-deletion mutant in S. aureus Newman. First immunoblotting was performed to semi-quantify the production levels of Efb in liquid bacterial culture supernatants. Supernatants of wild-type (WT) S. aureus Newman were subjected to Immunoblotting and developed using polyclonal anti-Efb antibodies (FIG. 7A). Efb expression in the supernatant was quantified using ImageJ software and compared with fixed concentrations of purified (His-tagged) Efb using linear regression analysis (R2=0.986). Efb levels in 4 hours and 20 hours supernatants contained 1.1 μM and 0.9 μM Efb respectively. Although the Efb levels in strain Newman are suspected to be higher than in other S. aureus strains (up to 10-fold, due to a point mutation in the SaeR/S regulatory system that drives expression of immune evasion genes), the fact that these levels are >10 times higher than the calculated IC50 needed for phagocytosis inhibition (0.08 μM, FIG. 1C), suggests that Efb concentrations required for phagocytosis inhibition can be reached in vivo. In a separate Immunoblot, the presence of Efb was checked in 4 hours supernatants of the WT, Efb-deficient (ΔEfb) and the complemented strain (ΔEfb+pEfb) confirming the lack of Efb expression in the mutant (FIG. 7A). Next these supernatants were used to study whether endogenous Efb can mediate C3b-Fg complex formation on the bacterial surface. S. aureus was first incubated with serum to deposit C3b, then mixed with bacterial supernatants and subsequently incubated with fluorescently labeled Fg. Whereas WT supernatants attracted Fg to the surface of pre-opsonized bacteria, Efb-deficient supernatants did not mediate complex formation (FIG. 7B). This phenotype was restored in the complemented strain. Then it was studied whether endogenous Efb could inhibit phagocytosis by neutrophils in vitro. Therefore, it was repeated the latter study (but using fluorescent bacteria and unlabeled Fg) and subsequently mixed the bacteria with human neutrophils. That supernatants of WT and complemented strains were found to inhibit phagocytosis, while Efb-deficient supernatants did not influence this process (FIG. 7B). To mimic bacterial phagocytosis during a natural infection, carrageenan-treated mice were injected i.p. with GFP-expressing WT S. aureus or the Efb-deficient mutant in their original broth culture and sacrificed 1 h thereafter. Mice were subjected to peritoneal lavage and the percentage of neutrophils with internalized staphylococci was determined by flow cytometry. As depicted in FIG. 7D, the Efb-deficient S. aureus strain was phagocytosed by neutrophils to a significantly higher extent than the WT strain despite of the fact that the amount of inoculated bacteria was comparable in both groups (app. 2×107). These observations demonstrate that the levels of Efb produced by S. aureus are sufficient for preventing phagocytosis in vivo.



FIG. 8 shows a schematic picture of the phagocytosis escape mechanism by Efb. Left, Complement activation on the bacterial surface results in massive labeling of S. aureus with C3b molecules, while Fg stays in solution. Right, S. aureus secretes Efb, which binds to surface-bound C3b via its C-terminal domain. Using its N-terminus, Efb attracts Fg to the bacterial surface. This way, S. aureus is covered with a shield of Fg that prevents binding of phagocytic receptors to important opsonins like C3b and IgG.


The coagulation system has a dual role in the host defense against bacterial infections. On one hand, coagulation supports innate defenses by entrapment and killing of invading bacteria inside clots or via the formation of small antibacterial and pro-inflammatory peptides. On the other hand, bacterial pathogens can utilize coagulation proteins to protect themselves from immune defenses. It was found that S. aureus effectively protects itself from immune recognition by secreting Efb that specifically attracts Fg from the solution to the bacterial surface creating a capsule-like shield (FIG. 8). To accomplish this, Efb forms a multi-molecular complex of soluble Fg and surface-bound C3b. The fact that the levels of C3b at the bacterial surface are high and that Fg is an abundant plasma protein (1.5-4.0 g/L) makes this a very efficient anti-phagocytic mechanism. The Fg shield created by Efb effectively protects S. aureus from recognition by phagocyte receptors. The attracted Fg was found not only to block the binding of C3b to its receptor, but also hides the important opsonin IgG underneath the Fg shield. This information is critical for vaccine development against S. aureus. Generation of protective ‘opsonizing’ antibodies recognizing S. aureus surface structures was considered to be an important goal of vaccination. However, these antibodies will not function if they are protected underneath a layer of Fg. Including Efb in future vaccines might be beneficial as it could prevent formation of this anti-phagocytic shield and enhance the function of opsonizing antibodies. The fact that Efb is conserved among S. aureus strains may make it a suitable vaccine candidate.


In addition to Efb, S. aureus secretes two other proteins that specifically interact with the coagulation system: the S. aureus ‘coagulases’ named Coagulase and Von Willebrand factor binding protein are secreted proteins that activate prothrombin in a nonproteolytic manner and subsequently convert Fg into fibrin. Thereby, coagulases embed bacteria within a network of fibrin, protecting them from immune recognition and facilitate formation of S. aureus abscesses and persistence in host tissues. Coagulase and Efb are expressed at the same time during infection since they are both regulated by the SaeRS regulator for secreted (immune evasion) proteins. Efb is highly important for proper functioning of Coagulase since Efb can attract Fg to the bacterial surface. This way, Efb may aid Coagulase-dependent fibrin formation to occur close to the bacterial surface instead of in solution. Nevertheless, these studies show that Efb can block phagocytosis in the absence of prothrombin and Coagulase. However, in a more complex environment the anti-phagocytic mechanisms of Efb and S. aureus Coagulase might work synergistically. Furthermore, it seems tempting to speculate that the ability of Efb to attract Fg to the bacterial surface is also beneficial in other infection processes like adhesion. Since, Fg is an important constituent of the extracellular matrix (ECM), Efb might also facilitate binding of C3b-opsonized bacteria to the ECM. In fact, Efb was previously classified as an adhesion molecule belonging to the group of SERAMs (secreted expanded repertoire adhesive molecules). However, as a secreted protein, Efb cannot facilitate bacterial adhesion if it solely binds to Fg in the ECM without interacting with the bacterial surface. Binding to C3b-labeled bacteria via the Efb C-terminus might therefore be crucial for effective bacterial adhesion to Fg.


The pathogenic potential of S. aureus is a result of its versatile interactions with multiple host factors, evidenced by the fact that it can survive at multiple sites of the body causing a wide range of infections. At most body sites, S. aureus has to deal with cellular and humoral components of the immune system. However, increasing evidence now suggests that S. aureus protects itself from immune defense by forming abscess communities surrounded by capsule-like structures that prevent neutrophil invasion. This study shows that Efb might be crucial in the formation of these capsules. Furthermore, these whole blood assays show that Efb may also play an important role in S. aureus survival in the blood allowing it to spread to other sites of the body. Previous studies using animal models have highlighted the critical role of Efb in S. aureus pathogenesis. For instance, Efb delays wound healing in a rat wound infection model and is important for S. aureus pneumonia and abscess formation in kidneys. The in vivo studies corroborate the in vitro findings and show that complex formation can occur under physiological conditions in vivo, however, the available mouse models do not closely mimic this process during clinical infections in humans. Efb is produced in later stages of bacterial growth, thus the bacteria need time to produce Efb before they come into contact with neutrophils. Since neutrophils need to be recruited from the blood to the site of the infection, there normally is time for Efb production and complex formation, especially in the human host where an infection starts with a low number of bacteria. In contrast, in available mouse models the timing is much different as a high inoculum (up to 108 bacteria) is required to establish an infection and these high numbers of bacteria trigger a strong inflammatory response resulting in that the bacteria are already phagocytized before Efb is produced. For this reason, the bacteria were mixed with their supernatants to ensure the presence of endogenous Efb during the course of the studies and chosen a model in which neutrophils are already attracted to the infection site to focus on the anti-phagocytic activity of the molecule. Future studies are needed to design and execute appropriate animal studies that overcome the limitations of current models and better reflect the clinical situation. The present disclosure provides that full-length Efb can inhibit phagocytosis in a unique way through its dual interaction with complement and Fg. Our studies indicate that Efb is a highly effective immune escape molecule that blocks phagocytosis of S. aureus in vivo.


Fg is a major plasma dimeric glycoprotein composed of three polypeptides, Aα, Bβ, and γ. Fg is best known for its role in the later stages in the blood coagulation cascade where thrombin proteolytically converts Fg to fibrin which then spontaneous assemble into the ultrastructural core of the clot. However, Fg is also a critical participant in a number of different physiological processes such as thrombosis, wound healing, and angiogenesis and in innate immune defense against pathogens. A role for Fg in inflammation is evident from analysis of Fg knockout mice, which exhibit a delayed inflammatory response as well as defects in wound healing. Furthermore, the fibrinopeptides, generated by thrombin cleavage of Fg, are potent chemoattractants, which can act as modulators in inflammatory reactions. A genetically engineered mouse expressing a mutant form of Fg that is not recognized by the leukocyte integrin αMβ2 has profound impediment in clearing S. aureus following intraperitoneal inoculation. This study highlights the importance of Fg interactions with the leukocyte integrin αMβ2/Mac-1/complement receptor 3 in the clearance of staphylococci. Fg also interacts with the complement system and modulates complement dependent clearance of bacteria.


Recent studies of some of the secreted Fg binding S. aureus virulence factors point to yet another mechanism of Fg dependent inhibition of bacterial clearance. In a mouse model of S. aureus abscess formation, Fg accumulates and is co-localized with coagulase (coa) and von Willebrand factor binding protein (vWbp) within the staphylococcal abscess lesions. The profound amount of Fg in the periphery of the abscess forms a capsule-like structure that borders the uninfected tissue and prevents phagocytes from accessing and clearing bacteria in the center of the abscess. Coagulase (Coa) is an “old” S. aureus hall mark protein best known for its ability to induce blood/plasma coagulation which allows the classification of the staphylococcal genus into coagulase positive and negative species. More recent studies have shown that Coa is a critical virulence factor in some staphylococcal diseases. Coa dependent blood coagulation is initiated when Coa activates the zymogen prothrombin by insertion of the Ile1-Val2 residues present at the N-terminus of Coa into the Ile16 pocket of prothrombin, inducing a conformational change and a functional active site in the serine protease. This activation process does not involve proteolytic cleavage of prothrombin which is required in physiological blood coagulation. The Coa/prothrombin complex then recognizes Fg as a specific substrate and converts it into fibrin. The crystal structure of Coa/prothrombin complex reveals that the exosite 1 of α-thrombin, the Fg recognition site, is blocked by D2 domain of Coa. This information raises questions concerning the nature of Fg recognition and subsequent cleavage by the complex. Coa can interact with Fg directly without the aid of prothrombin and this interaction site(s) was tentatively located to the C-terminus of Coa. The C-terminal region of Coa is comprised of tandem repeats of a 27-residue sequence that is relatively conserved among strains but the numbers of repeats varies from 5 to 8 in different strains. The Fg-binding activity of Coa was characterized and show that Coa contains multiple copies of a Fg binding motif that is structurally and functionally related to the Fg binding motifs in Efb. The interaction of this common motif with Fg is analyzed in some detail.



FIG. 9A illustrates a schematic presentation of recombinant Coa fragments generated in this study. Coa is depicted in its secreted form Coa (27-636) lacking the signal peptide (1-26). The N-terminus of Coa (Coa-N; Coa 27-310) constitutes D1D2 prothrombin binding domain. The C-terminus of Coa (Coa-C; Coa 311-636) includes the central region and the tandem-repeat region. The Coa-C further divides into two parts, the Coa-R is corresponding to the tandem-repeat region covering residue 506-636, and the Coa-F fragment covering residues 311-505. Recombinant protein Coa-R0 corresponds to the residues 474-506 residues. In the figure, SP represents the signal peptide, N shows the N-terminus of the protein, C represents the C-terminus of the protein and the dark grey box represents the GST tag. FIG. 9B illustrates an ELISA assays of GST-tagged Coa fragments binding to immobilized Fg. Open circle, Coa (Coa 27-636); open upright triangle, Coa-N(Coa 27-310); open inverted triangle, Coa-C(Coa 311-636); closed circle, Coa-R (Coa 506-636); closed diamond, Coa-F (Coa 311-505). FIG. 9C is a table that shows the protein concentration at which the reaction rate is half of Vmax (Km), and the goodness of fit (R2). FIG. 9D illustrates the effect of peptide Efb-O on inhibition of rCoa binding to Fg. Increasing concentration of Efb-O were incubated with 4 nM GST-tagged Coa proteins in Fg-coated microtiter wells. Control, BSA.


Staphylococcal Coagulase contains multiple Fibrinogen binding sites. With the goal to identify the Fg-binding motifs in Coa we first sought to locate the Fg-binding site(s) in the protein. To this end, a panel of recombinant proteins covering different segments of Coa (FIG. 9A) was constructed and examined their Fg-binding activities in an ELISA-type binding assay. Earlier observations that Coa interacts with Fg primarily through the disordered C-terminal part of the protein (Coa-C, corresponding to residues Coa 27-636) were confirmed. Fg-binding to recombinant Coa-C is a concentration dependent process that exhibits saturation kinetics and shows half maximum binding at 7.5 nM (FIG. 9B). The tandem repeat region of Coa (fragment Coa-R, corresponding to residues Coa 506-636) binds to Fg in a similar way but with a higher apparent affinity (0.8 nM) compared to that of the whole C terminus (Coa-C). A recombinant protein containing the segment between the D1D2 domain and Coa-R was therefore constructed (fragment Coa-F, corresponding to residues Coa 311-505) and that recombinant Coa-F also binds Fg (FIG. 9B). The N-terminal D1D2 domain of Coa (Coa-N) that contains the prothrombin binding activity also interacts with Fg. However, the apparent affinity observed for Coa-N binding to Fg was much lower than that exhibited by Coa-C and the Fg-binding activity of the Coa-N was therefore not further examined in this study.


The fibrinogen binding activities in Coagulase and Efb are functionally related. Fg-binding activity of Efb protein has been located to a disordered region in the N-terminal part of the protein. Two related Fg-binding segments in Efb named Efb-O (corresponding to Efb 68-98) and Efb-A (corresponding to Efb 30-67) were identified (FIG. 2A). The Efb-O segment was determined to have a higher affinity for Fg compared to Efb-A but that the two motifs likely bound to the same region in Fg since recombinant Efb-O (rEfb-O) effectively inhibited rEfb-A binding to the host protein. Because the Fg-binding activities in Efb and Coa are both located to disordered regions and both proteins can induce a protective Fg containing barrier we explored the possibility that the Fg-binding motifs in the two proteins are functionally related. To this end it was used a competition ELISA where the binding of recombinant Coa to Fg coated wells was quantitated in the presence of increasing concentrations of the synthetic peptide Efb-O (sEfb-O) that mimics the high affinity Fg-binding motif in Efb. Peptide sEfb-O effectively inhibited recombinant Coa binding to Fg (FIG. 9D), suggesting that Coa and Efb are functionally related and that the dominant Fg-binding motifs found in the two proteins likely bind to the same or overlapping sites in Fg.



FIG. 10A is a table of the Efb-O variant peptides were synthesized where each residue in the sequence is individually replaced with Ala (or Ser when the native a.a. is Ala). FIG. 10B is a plot of the Efb-O variant peptides inhibit rEfb-O (5 nM) binding to immobilized Fg in solid phase assay. Wells were coated with 0.25 μg/well Fg. Peptides (2 μM) were mixed with rEfb-O proteins (5 nM) and incubated in the Fg wells for 1 hour. FIG. 10C is a plot showing selected peptides inhibit rEfb-O binding to immobilized Fg. Increasing concentrations of Efb peptides were incubated with 5 nM rEfb-O in Fg-coated microtiter wells. To identify the residues in Efb-O that are important for Fg binding an Alanine scanning approach was used. A panel of Efb-O variant peptides were synthesized where each residue in the sequence is individually replaced with Ala (or Ser when the native a.a. is Ala; FIG. 10A). The individual peptides are then examined for their ability to compete with the binding of rEfb-O (5 nM) to immobilized Fg. The inhibitory activity of the peptides was compared at a fixed concentration (2 μM) for each peptide (FIG. 10B) and at increasing concentrations for selected peptides (FIG. 10C). As the Efb-O sequence is found in a disordered segment of the protein, the peptides are likely to be very flexible in solution. Therefore, a peptide's inhibitory activity reflects its relative affinity for Fg.


As expected, the control wild-type peptide sEfb-O efficiently blocked the corresponding recombinant protein rEfb-O from binding to Fg, demonstrating that peptide sEfb-O has full Fg binding activity compared to rEfb-O. Surprisingly Ala substitution of over 15 residues distributed throughout the 25 amino acid long Efb-O motif resulted in loss or significant reduction in inhibitory activity (FIG. 10B), suggesting that residues throughout the entire segment are involved in Fg-binding. The results revealed that peptides in which Ala replaces residues K1, I3, H7, Y9, I11, E13, F14, D16, G17, T18, F19, Y21, G22, R24 and P25 lose their ability to inhibit rEfb-O binding (shown in red color in FIG. 10B), indicating that these residues are critical for Efb-O to bind to Fg (FIG. 10B). Ala replacement of residues Ile3 and Glu13 resulting in peptides sEfb-03 (I3A) and sEfb-013 (E13A), respectively, showed a markedly reduced yet significant dose dependent inhibitory activity suggesting that the residues Ile3 and Glu13 play some but less important roles in the Fg interaction (FIG. 10C).


Coa-F contains an Efb like fibrinogen binding motif. FIG. 11A is an image of a ClustalW alignment of amino acid sequence from Efb-O (Efb 68-98) and Coa from Newman strain (col-Newman). Sequence similarity was identified at Coa 474-505. Bold letters denote conserved residues and underlined letters represent similar residues. FIGS. 11B and 11C show a comparison of amino acid sequence of Efb-O with Coa 474-505 (FIG. 11B) and Coa 506-532 (FIG. 11C). Large letters in Efb-O indicate the residues important for Fg binding. The red letters show the identical residues and the yellow letters indicate the similar residues. FIGS. 11D and 11E shows the effect of Coa peptides on inhibition of rEfb-N (Efb 30-104) (FIG. 11D) and rCoa-C(Coa 311-636) (FIG. 11E) binding to Fg by the inhibition ELISA assays. Increasing concentration of Coa peptides was incubated with 2 nM GST fusion proteins in Fg-coated microtiter wells. Closed square, sCoa-O; closed circle, sCoa-RI; closed triangle, sEfb-O.


Next, sequences similar to the Fg-binding motifs in Efb were identified in Coa by comparing the amino acid sequence of Efb-O with Coa and found that a segment corresponding to residues Coa 474-505, named Coa-O, showed 56% amino acid identity and 75% similarity to that of the Efb-O sequence (FIG. 11A). Strikingly, of the residues in Efb-O determined to be important for Fg-binding (FIG. 10B) and FIG. 11B all but three are conserved in Coa-O (FIG. 10B, shown in large red and orange letters), indicating that Coa-O likely constitutes an Efb-like Fg-binding motif. A peptide was synthesized that corresponds to the Coa-O sequence (sCoa-O) and determined its Fg binding activity in a competition ELISA. Microtiter wells were coated with Fg and binding of the recombinant N-terminal segment of Efb (rEfb-N), that harbors the two Fg binding sites, was quantitated in the presence of increasing concentration of different synthetic peptides. As expected, the control peptide sEfb-O potently inhibited rEfb-N binding to the Fg surface (FIG. 11D). Peptide sCoa-O also acted as a potent inhibitor of the rEfb-N/Fg interaction (FIG. 11D), demonstrating that the Coa segment covered by residues 474-505 contains a Fg-binding site. The result also suggested that Coa-O likely competed with Efb-O for the same site in Fg.


It is noted that the repeated sequence of Coa contains remnants of the Efb Fibrinogen binding motif. The C-terminus of Coa harbors tandem repeats of a 27-residues segment and this region has been shown to bind Fg (FIGS. 9A and 9B). However, a Fg-binding motif has not been identified in the repeat region of Coa. An initial blast search failed to identify an Efb like Fg-binding motif in the Coa repeats but when the Efb-O sequence and the first repeat sequence were over-layered and showed that remnants of the Efb motif are also found in the Coa repeat sequences (FIG. 11C). Importantly the common residues are some of the ones shown to be critical for Efb-O binding to Fg (Bold letters represent the identical residues and underlined residues represent the similar residues). This observation suggests that the Coa repeats may bind Fg and possibly help define a functional register in the repeats. To investigate if the Coa repeats indeed have Fg binding activity, a peptide that constitutes the first 27 residues (Coa 506-532) (named sCoa-RI) was synthesized. This assumes that the functional Fg-binding repeats are directly following onto Coa-O (474-505). The Fg-binding activity of sCoa-RI was compared with those of sCoa-O and sEfb-O in competition ELISAs (FIGS. 11D, 11E) where increasing concentrations of the peptides were used to inhibit the binding of rEfb-N (FIG. 11D) or rCoa-C (FIG. 11E) to Fg. All three peptides effectively inhibited rEfb-N binding to Fg, suggesting that the sCoa-RI also contains a Fg binding site likely targeting the same site in Fg as that recognized by Efb and Coa-O. Furthermore, sCoa-RI was a somewhat more effective inhibitor than sCoa-O despite the fact that the Coa-O sequence is more similar to that of Efb-O than Coa-RI. This observation suggests that some of the residues unique to Coa-RI are also participating in the Fg interaction. To determine what residues in Coa-RI are important for Fg-binding the Ala scanning approach was again used.


The residues in Coa-RI important for fibrinogen binding. FIG. 12A is a panel of coa-RI variant peptides were synthesized where each residue in the sequence is individually replaced with Ala (or Ser when the native a.a. is Ala). FIG. 12B shows inhibition of GST-tagged rCoa-C(Coa 311-636) (2 nM) binding to immobilized Fg in solid phase assay by sCoa-RI variant peptide (50 μM). Wells were coated with 0.25 μg/well Fg. Labels -1, -2, -3, -4, -5, -6, -7, -8, -9, -10, -11, -12, -13, -14, -15, -16, -17, -18, -19, -20, -21, -22, -23, -24, -25, -26, -27 refer to Coa-RI-1, Coa-RI-2, Coa-RI-3, Coa-RI-4, Coa-RI-5, Coa-RI-6, Coa-RI-7, Coa-RI-8, Coa-RI-9, Coa-RI-10, Coa-RI-11, Coa-RI-12, Coa-RI-13, Coa-RI-14, Coa-RI-15, Coa-RI-16, Coa-RI-17, Coa-RI-18, Coa-RI-19, Coa-RI-20, Coa-RI-21, Coa-RI-22, Coa-RI-23, Coa-RI-24, Coa-RI-25, Coa-RI-26, Coa-RI-27, respectively. FIG. 12C is a comparison of amino acid sequence of Efb-O with Coa-RI. FIG. 12D is a Fg-binding register of tandem repeats in Coa. Bold letters denote the residues that are important for Fg binding. The peptide panel generated and tested is shown in FIG. 12A. Binding of a fixed concentration of rCoa-C (2 nM) to immobilized Fg was determined in the presence of a fixed concentration of these peptides (50 uM) (FIG. 12B). Interestingly, results revealed a similar pattern to that observed for Efb-O showing that the Ala substitution of over 13 residues distributed throughout the 27 amino acid long Coa-RI motif resulted in loss or significant reduction in inhibitory activity (FIG. 12B). This result suggests that, similar to Efb-O, residues in the entire segment of Coa-RI are involved in Fg binding. The results also showed that peptides in which alanine replaces residues N3, Y5, V7, T8, T9, H10, N12, G3, V15 Y17G18 R20 and P21 (FIG. 12B) lose their ability to inhibit rCoa-C binding (FIG. 12B, shown), indicating that these residues are critical for Coa-RI to bind to Fg. Efb-O and Coa-RI sequences were compared to see how the critical residues in the two motifs line up. Strikingly, despite difference in numbers of residues and no extensive sequence identities between them, the critical residues in Coa-RI correlate with similar residues in the corresponding position in Efb-O (FIG. 12C, bold, identical residues; underline, similar residues, italics, non-similar residues). Furthermore, sequence comparisons within the different 27 residues repeats showed that the identified critical residues are conserved or replaced by similar residues (FIG. 12D).



FIG. 13A is a schematic presentation of Coa peptides. FIG. 13B is a plot of the effect of Coa peptides on inhibition of rCoa-C binding to fibrinogen. Increasing concentrations of synthetic peptides were incubated with 4 nM GST fusion protein in Fg-coated microtiter wells. Peptide sCoa-RI appears to be the most potent inhibitor. Closed circle, sCoa-RI; closed square, coa-R12 peptide; closed upright triangle, coa-R13; closed inverted triangle, coa-RI4; closed diamond, coa-RV1; open circle, coa-RV2; open square, coa-RV3; open triangle, coa-RV4. In previous studies the repeated unit in Coa is proposed to start with residues alanine (A497) in S. aureus strain Newman. This register was based exclusively on sequence comparisons of Coa from different strains. To experimentally define a register of the repeats based on their Fg-binding function a panel of 27-residues peptides was synthesized and each peptide has 22-24 residues overlapped and largely covering the repeat I (RI) and repeat V (RV) (FIG. 13A). The Fg binding activities of these peptides were then investigated in a competition ELISA where the binding of rCoa-C to Fg coated microtiter wells were determined in the presence of increasing concentrations of peptide (FIG. 13B). It was observed that although peptides sCoa-RI, —RI2, —RI3, —RI4 and —RV1 showed some inhibitory activity, peptide sCoa-RI appears to be the most potent inhibitor among these eight peptides, suggesting that sCoa-RI (Coa 506-532) has the highest affinity for Fg (FIG. 13B) and that sCoa-RI likely represents a functional repeat unit that interacts with Fg. Notably, peptide sCoa-RV2 (Coa 605-631), representing the previously proposed register, did not inhibit Fg binding in the experimental condition tested (FIG. 13B), indicating that this peptide has very low, if any, Fg binding activity. The results show that the functional (Fg binding) register of the repeat section is as outlined in FIG. 12D.


sCoa-RI, -RI3 and -RV bind to fibrinogen Coa-RI binds with higher affinity than other Coa peptides to Fg-D. FIGS. 14A-C shows a characterization of the interaction of Fg-D fragment with Coa peptides by VP-ITC. Binding isotherms for the interaction of Fg-D with Coa peptide sCoa-RI (FIG. 14A), sCoa-R13 (FIG. 14B) and sCoa-RV (FIG. 14C) were generated by titrating the peptides (˜200 μM) into an ITC cell containing 10 μM Fg-D. The top panels show heat difference upon injection of coa peptides, and the lower panels show integrated heat of injections. The data were fitted to a one-binding site model (bottom panels), and binding affinities are expressed as dissociation constants (KD) or the reciprocal of the association constants determined by Microcal Origin software. N represents the binding ratio. To generate more quantitative binding data for the Coa peptide Fg interaction isothermal titration calorimetry and titrated the Coa peptides into a solution containing a fixed concentration of Fg-D fragments was used. Synthetic peptide sCoa-RI (Coa 506-532) bound to Fg-D fragment with a high affinity (KD=88 nM) and a binding stoichiometry is 0.93 (FIG. 14A), suggesting that one molecule of sCoa-RI bound to one Fg-D molecule. Interactions between peptide sCoa-RI3 (Coa 502-528) and Fg-D fragments revealed an affinity of 124 nM (KD); whereas sCoa-RV1 (Coa 610-636) had a KD of 139 nM (FIG. 14B and FIG. 14C, respectively). These results corroborated with our competition ELISA results (FIG. 13B) and showed that sCoa-RI (Coa 506-532) bound Fg-D stronger than sCoa-R13 (Coa 502-528) and sCoa-RV1 (Coa 610-636).



FIG. 15 shows Coa and Efb prevent monocytic cells from adherence to fibrinogen. Attachment of THP-1 cells to Fg immobilized on the 48-wells was inhibited by the addition of monoclonal αM antibody M1/70 (20 μg/ml), rEfb (0.2 μM) and rCoa (0.5 μM). Addition of single peptide alone (sEfb-O, sEfb-A as well as sCoa-RI and sCoa-O, respectively, 0.5 uM each) or combination of two peptides together (sEfb-A+sEfb-O) or (sCoa-O+sCoa-RI), 0.5 μM each, did not inhibit THP-1 adherence. However, preincubation of sCoa-O peptide (50 uM) with rEfb (0.2 uM) or sEfb-O (50 μM) with rCoa (0.2 μM) reverses the inhibitory activities elicited by rEfb or rCoa. Error bars, S.D., n>3. As Coa and Efb share similar Fg binding motif and could inhibit each other from binding to Fg, it was explored if Coa could also inhibit THP-1 monocytic cells adherence to Fg. THP-1 cells adhere to immobilized Fg primary through αMβ2 integrin (also named Mac-1, CR3). In consistent to previously reported, antibody against αM (M1/70) inhibits THP-1 adherence to immobilized Fg (FIG. 15), confirming adherence of THP-1 cells to Fg is primary mediated by αMβ2 integrin. Efb has been shown to block neutrophil-Fg interaction in an αMβ2 dependent mechanism. Here as expected, Efb also efficiently inhibited THP-1 binding to Fg (FIG. 15). Similar to Efb, rCoa protein, that harbors multiple Fg binding motif, could also inhibit cell adherence to Fg surface. Interestingly, application of single individual synthetic peptides efb-O or efb-a that each contains one single Fg binding motif or in combination of two peptides (sEfb-O+sEfb-A) together did not show an effect. Similar phenomena were observed for sCoa-O and sCoa-RI, suggesting that inhibition of THP-1 cells adherence to Fg requires more than one Fg binding sites in one molecule. This is further supported by the observation that an excess amount of single peptide can partially, if not all, resolve the inhibitory effect mediated by rEfb or rCoa proteins (FIG. 15). In this situation, an excess amount of peptide sEfb-O or sCoa-O (50 uM) was mixed with rCoa (0.5 uM) or rEfb-N (0.2 uM), respectively, in the adherence assay. Coa is functionally related to Efb and that similar to Efb and Coa also inhibits monocytic-Fg interaction in αMβ2 dependent process.


The pathogenic potential of S. aureus is a result of its multitude of virulence factors and their versatile interactions with multiple host factors. As a result S. aureus can survive and strive at many tissue sites in the host and cause a wide range of diseases. Fibrinogen is a surprisingly common target for many of the staphylococcal virulence factor proteins. The known Fg-binding staphylococcal proteins largely fall into two groups: a family of structurally related cell-wall anchored proteins of the MSCRAMM type that include ClfA, ClfB, FnbpA, FnbpB and Bbp/SdrE) and a group of secreted smaller proteins (sometimes referred to as the SERAMs) that include Efb, Coa, von Willebrand factor-binding protein (vWbp), extracellular matrix binding protein (Emp) and extracellular adherence protein (Eap). The Fg-binding sites in the MSCRAMs are located to a segment of the proteins composed of two IgG-folded sub-domains that bind Fg by variants of the so called “dock, lock, and latch” mechanism. In this mechanism a short, disordered segment of Fg docks in a trench formed between the two sub-domains through beta-complementation to a strand of the second sub-domain which subsequently triggers conformational changes in the MSCRAMM resulting in the subsequent steps.


The secreted proteins do not share a common domain organization and the mechanisms of Fg-binding used by these proteins remain largely unknown. However, these proteins do have some features in common. One, they all interact with multiple ligands and Fg is the common ligand among them. Two, they all contribute to S. aureus abscess formation in animal infection models. Three, an intrinsically disordered region represents a significant part of each protein and it has previously been shown that the Fg binding sites in Efb is located to its disordered region. A disordered protein is particularly suited for accommodating multiple ligands since several interacting motifs can fit in a short segment of the protein and these motifs can be overlapping because the segment has structural plasticity. Furthermore, amino acid sequence changes in a disordered protein segment are common since in these sections amino acid residue substitutions, deletions or additions can occur without interfering with a pre-existing structure. This tendency of sequence variations makes it particularly challenging to recognize interactive sequence motifs since these are often non-precise particularly if the motif is extended. The secreted staphylococcal Coa contains multiple copies of a Fg binding motif that functionally is similar to that previously identified in Efb's but that contains significant variations. Using an Alanine scanning approach, the residues in the motifs critical for Fg binding were identified. Comparing these critical residues in the Efb and the Coa motifs we find that these are largely conserved and that the Coa and Efb motifs are variants of the same motif. This Fg-binding motif has several unique characteristics. Firstly, the motif consists of 25-27 residues long peptide. This is unusual long compared to other known and well characterized interactive motifs. Secondly, along the length of the motif almost every other residue is important for Fg binding but exchange for similar residues is tolerated.


The Efb/Coa Fg-binding motif has been searched out in other eukaryotic and prokaryotic proteins including other staphylococcal SERAMs but so far without any hits. vWbp is structurally and functionally similar to Coa in the way that vWbp also activates prothrombin through the N-terminal D1D2 domain of the protein in a non-proteolytic manner and subsequently converts soluble Fg to insoluble fibrin clots. vWbp also binds Fg and this binding site was initially located to the C-terminal putatively disordered region but a recent study located the Fg-binding activity to the D1D2 domain of vWbp. No significant parts of the Efb/Coa Fg-binding motif is seen in any part of vWbp.


Efb is capable of escaping phagocytosis by formation of Fg containing shield surrounding the bacteria surface. This shield may protect the bacteria from clearance since opsonizing antibodies and phagocytes will not access the bacteria. In Efb dependent shield, Fg is brought to the surface of bacteria by Efb's ability to bind to microbial surface bound complement C3 through the C-terminal domains of the protein and recruits Fg through the N-terminal domain of the protein. Coa contains similar Efb's binding motif for Fg and therefore likely can form a Fg containing shield but Coa does not contain any known interaction with the bacterial surface. Therefore, the Fg shield may not be formed on the bacterial surface but surrounding the colony as seen in an abscess. In fact, Coa and Fg coincide in the core surrounding an abscess lesion and it is likely this core has a structural organization similar to the Fg protective shield formed by Efb. Also, some of the Fg binding MSCRAMMs can assemble a protective Fg containing shield around staphylococcal cells, a mechanism that could explain the virulence potential of proteins like ClfA.


It is likely that the interaction of staphylococcal proteins with Fg induces a conformational change in the host molecule which may in turn increase its tendency to aggregate. Efb binding to Fg results in a masking of the site in Fg recognized by the αMβ2/Mac-1 integrin. However, Efb effectively binds to a Fg variant where this site is mutated suggesting that this masking is not due to a direct competition for the site but possibly caused by an induced conformational change in Fg. Here experiments demonstrate that Coa harboring similar Fg binding motif can also inhibit THP-1 cell adherence through αMβ2/Mac-1 dependent mechanism suggesting that similar conformational changes can be induced by variants of the motif present in Efb and Coa. A more complete understanding of the molecular basis for the interaction of staphylococcal proteins interaction with Fg and the resulting Fg shield formed should lead to a better understanding of bacterial immune evasion strategies and may potential lead to novel strategies for the prevention and treatment of staphylococcal infections.


Secreted Fg binding proteins from S. aureus Coa and Efb are functionally related and locate Fg binding motifs to the intrinsically disordered section of the proteins. The residues in both the Efb and Coa Fg binding motifs were identified and it was concluded that these sequences are preserved and span a surprisingly long segment of the protein. Also, Coa contains multiples of this Fg-binding motif and define the functional register of the repeats in the disordered C-terminal region of Coa.


Bacterial Strains, Plasmids, and Culture Conditions—Escherichia coli XL-1 Blue was used as the host for plasmid cloning whereas E. coli BL21 or BL21(DE3)pLys were used for expression of GST- or His-tag fusion proteins. Chromosomal DNA from S. aureus strain Newman was used to amplify the Coagulase DNA sequence. E. coli XL-1 bule and BL21 containing plasmids were grown on LB media with ampicillin (100 μg/ml) and BL21(DE3)pLys containing plasmids were grown on LB media with ampicillin (100 μg/ml) and chloramphenicol (35 μg/ml).


Cloning of Coa construct—Chromosomal DNA from S. aureus strain Newman was used as template for all PCR reactions using the oligonucleotide primers described in supplement data. PCR products were digested with BamH I and Sal I and ligated into the pGEX-5x-1 vector or digested with BamHI and PstI and ligated into the pRSETA. Insertions were confirmed by DNA sequencing.


Expression and purification of recombinant Coa—Plasmids encoding N-terminal glutathione S-transferase (GST) or N-terminal 6×His-tagged Coa fusion proteins were expressed in either E. coli strain BL21 (GST tagged) or strain BL21(DE3)pLys (His-tagged). Bacteria were grown overnight at 37° C. in LB containing appropriate antibiotics as described above. The overnight cultures were diluted 1:20 into fresh LB medium and recombinant protein expression was induced with 0.2 mM IPTG for 2-3 hours. Bacteria were harvested by centrifugation and lysed using a French press. Soluble proteins were purified through glutathione-SEPHAROSE®-4B column or by Ni-chelating chromatography according to the manufacturer's manual. Purified proteins were dialysis into TBS and stored at −20° C. Protein concentrations were determined by the Bradford assay (Pierce). Recombinant Efb proteins were purified as previously described (12).


Enzyme-linked Immunosorbent Assay—96-well immulon 4HBX microtiter plates were coated with 0.25 μg/well full-length human Fibrinogen (diluted in PBS, Enzyme research) overnight at 4° C. unless otherwise indicated. After blocking the wells with 3% BSA/PBS, recombinant Coa proteins were added and the plates were incubated for one hour. Bound Coa proteins were detected through incubation with horseradish peroxidase (HRP)-conjugated anti-His antibodies (10,000×dilution) or HRP-conjugated anti-GST polyclonal antibodies (5000× dilution) for one hour and quantified after adding the substrate 0-phenylenediamine dihydrochloride by measuring the resulting absorbance at 450 nm in an ELISA microplate reader.


In the case of peptide inhibition assay, various concentration of Efb or Coa peptides were mixed with a fixed concentration of Coa-GST or Efb-GST fusion proteins (5-10 nM) in TBS and the bound GST fusion proteins were detected through incubation with HRP-conjugated rabbit anti-GST polyclonal antibodies (5000× dilution). All proteins were diluted in TBS containing 1% BSA and 0.05% TWEEN® 20 and the ELISA assays were carried out at room temperature.


Isothermal titration calorimetry—The interaction between Coa peptides and the soluble, isolated Fibrinogen-D fragment was further characterized by isothermal titration calorimetry (ITC) using a VP-ITC microcalorimeter. The Fibrinogen-D fragment used in these studies was generated by digesting full length Fibrinogen with plasmin for 4 h and fractionating the digestion products by gel filtration chromatography. The ITC cell contained 10 μM Fibrinogen-D fragments and the syringe contained 150-200 μM Coa peptides in TBS (25 mM Tris, 3.0 mM KCl and 140 mM NaCl, pH 7.4). All proteins were filtered through 0.22 μm membranes and degassed for 20 minutes before use. The titrations were performed at 27° C. using a single preliminary injection of 2 μl of Coa peptide followed by 30˜40 injections of 5 μl with an injection speed of 0.5 μl s-1. Injections were spaced over 5-minute intervals at a stirring speed of 260 rpm. Raw titration data were fit to a one-site model of binding using MicroCal Origin version 5.0.


Cell adherence assay using cell lines—A monocytic cell line THP-1 cell stably expressing αMβ2 was maintained in RPMI1640 supplemented with 10% fetal bovine serum, 2 μM L-glutamine, 100 units/ml penicillin and 100 μg/ml streptomycin. Prior to use, cells were harvested by centrifuge, washed and suspended in RPMI 1640/1% human serum albumin. For cell adherence assays, 48-well plates were coated with 200 μl of Fibrinogen (10 μg/ml) overnight at 4° C. followed by 1 hour at 37° C. before blocking with 1% Polyvinylpyrrolidone (PVP 3600 kDa) for 45 minutes at 37° C. Subsequently, the cells were seeded 2×105/well in the presence or absence of Coa or Efb recombinant proteins or peptides and incubated at 37° C. for 25 minutes. Non-adherent cells were removed by washing gently three times with PBS/1% BSA. Adherent cells were quantitated with CyQuant kit according to the manufacturer's manual.


Bacterial strains, fluorescent labeling and supernatants—The present disclosure used the laboratory S. aureus strains Newman, SH1000, Reynolds and Wood 46 (with low expression of Protein A). The S. aureus strain KV27 and the S. epidermidis and E. coli strains were clinical isolates obtained within the UMCU. Targeted deletion (and complementation) of Efb in S. aureus Newman was described previously. All strains were cultured overnight on Tryptic Soy Blood Agar (BD) or Todd Hewitt Agar (with appropriate antibiotics) at 37° C. The capsule-expressing S. aureus strain Reynolds and its isogenic CP5-deficient mutant were a kind gift of Jean Lee (Harvard Medical School, Boston, USA). To optimize capsule expression, strain Reynolds was grown on Columbia Agar supplemented with 2% NaCl (CSA) for 24 hours at 37° C. For fluorescent labeling of strains, bacteria were resuspended in PBS and incubated with 0.5 mg/ml fluorescein isothiocyanate (FITC, Sigma) for 30 minutes on ice. Bacteria were washed twice with PBS, resuspended in RPMI medium 1o with HSA and stored at −20° C. until further use. For in vivo experiments, S. aureus Newman and the Efb mutant were transformed with the pCM29 plasmid (kindly provided by Alexander Horswill, University of Iowa) allowing constitutive expression of the superfolder green fluorescent protein (sGFP) via the sarAPI promoter. To isolate bacterial supernatants, WT and mutant strains were cultured overnight in Todd Hewitt Broth (THB) without antibiotics and subsequently sub-cultured in fresh THB for 4 hours or 20 hours. Cultures were centrifuged at 13,000 rpm and collected supernatants were stored at −20° C. until further use.


Protein expression and purification—Recombinant Efb proteins were generated in E. coli as described previously. Briefly, (parts of) the efb gene from S. aureus strain Newman (without the signal peptide) were amplified by PCR and ligated into either the pGEX-5x-1 vector or the pRSETB vector for N-terminal fusions with glutathione S-transferase (GST) or polyhistidine respectively. Mutations of the Fg and C3 binding domains were introduced in pGEX plasmids containing full-length GST-Efb as described previously. Recombinant proteins were expressed and purified according to the manufacturer's manual. In all studies where wild-type Efb was compared with mutants, GST-tagged Efb were used. Otherwise His-tagged Efb was used.


ELISA—Microtiter plates were coated with human C3b or Fg, blocked with 3% BSA-PBS, and incubated with 6 nM Efb for one hour at room temperature. Efb binding was detected using peroxidase-conjugated rabbit anti-GST polyclonal antibodies and quantified using 0-phenylenediamine dihydrochloride. To study formation of C3b-Efb-Fg complexes, C3b-coated plates were incubated with Efb for one hour at room temperature. After washing, human Fg (50 nM) was added and detected through incubation with peroxidase-conjugated anti-Fg antibodies.


Preparation of Fg-D fragments—D fragments of Fg were generated by digestion of human Fg (Enzyme research) with plasmin (Enzyme research, 10 μg/15 mg Fg) in TBS containing 10 mM CaCl2) for 4 hours at 37° C. as described earlier with modifications. D fragments (85 kD) were purified by gel filtration on SEPHACRYL® S-200 and analyzed by SDS-PAGE.


Purification of human blood products—For preparation of plasma, venous blood from healthy volunteers was collected in glass vacutainers (BD) containing the anticoagulant lepirudin (50 μg/ml). To prepare serum, blood was collected in glass vacutainers (BD) without anticoagulant and allowed to clot for 15 minutes at room temperature. Plasma and serum were collected after centrifugation for 10 minutes at 4000 rpm at 4° C., pooled and subsequently stored at −80° C. Complement-inactivated serum was prepared by incubation of serum for 30 min at 56° C. Human neutrophils were isolated freshly from heparinized blood using the Ficoll-Histopaque gradient method and used on the same day.


Mice—C57BL/6 female mice were purchased from Harlan-Winkelmann and used in studies when they were between 8 and 10 weeks of age. They were housed in microisolator cages and given food and water ad libitum.


Phagocytosis assays—Whole blood phagocytosis. FITC-labeled S. aureus KV27 (1×108/ml) was incubated with freshly isolated human lepirudin blood (50%) and buffer or Efb (0.5 μM) in RPMI-0.05% HSA for 25 minutes at 37° C. The reaction was stopped using FACS lysing solution; samples were washed with RPM1-0.05% HSA and analyzed by flow cytometry using a FACSCalibur (BD). Gating of cells occurred on basis of forward and side scatter; for each sample the fluorescence intensity of 10,000 gated neutrophils was measured. Phagocytosis was expressed as the percentage of neutrophils that became fluorescent.


Phagocytosis with purified neutrophils and plasma/serum—FITC-labeled bacteria (5×107/ml) were mixed with human serum or plasma for 2 minutes at 37° C. in the presence or absence of Efb. Freshly isolated neutrophils (5×106/ml) were added and phagocytosis was allowed for 15 minutes at 37° C. The reaction was stopped by formaldehyde fixation and analyzed by flow cytometry. Alternatively, phagocytosis mixtures were cytospinned on glass slides and stained using Giemsa-based Diff-Quick solution. To analyze killing, phagocytosis mixtures were not fixed but incubated for an additional 90 minutes before they were diluted into ice-cold water (pH 11) and incubated for 15 minutes on ice to enable neutrophil lysis. Viable bacteria were quantified by colony enumeration. For Fg supplementation, 5% serum was supplemented with 50-200 μg/ml human or mouse Fg (kindly provided by Dr. Jay L. Degen; purified from plasma of wild type and Fgγ390-396A mice). To analyze the influence of bacterial supernatants on phagocytosis, FITC-labeled S. aureus KV27 (2.5×107 cfu) was pre-incubated with human serum for 30 min at 37° C. in Veronal Buffered Saline containing Ca2+ and Mg2+ (VBS++). After washing in VBS++-0.5% BSA, bacteria were incubated with (2-fold) diluted culture supernatants or purified Efb (250 nM) for 1 hour at 37° C. After washing, bacteria were incubated with purified Fg (60 μg/ml, Invitrogen) in RPMI-HSA for 1 hour at 37° C. and subsequently, neutrophils were added (7.5×103 cells) and phagocytosis was allowed for 30 minutes at 37° C.


In vivo phagocytosis—S. aureus strain SH1000 was grown to mid-log phase, heat-inactivated for 60 minutes at 90° C., and fluorescently labeled with carboxyfluorescein. To induce infiltration of neutrophils within the peritoneal cavity, mice were intraperitoneally treated with 1 mg of carrageenan (Type IV1) 4 and 2 days prior to bacterial challenge. Subsequently, mice were intraperitoneally injected with 200 μl of a solution containing 108 heat-inactivated carboxyfluorescein-labeled S. aureus SH1000 and Efb (1 μM). To compare WT and Δ Efb strains, mice were directly inoculated in the peritoneal cavity with 300 μl of GFP-expressing WT or Δ Efb S. aureus cultures grown to a late exponential phase. Mice were sacrificed 1 hour thereafter, and their peritoneum was lavaged with sterile PBS. Lavage samples were centrifuged, and pelleted cells were incubated with purified anti-CD32 antibodies to block the FcR, followed by PE-conjugated anti-mouse Gr-1 antibodies. Cells were washed and quenched with trypan blue (2 mg/ml). Samples were immediately subjected to flow-cytometric analysis using a FACScan. Neutrophils were gated according to their expression of Gr-1 antigen (FL2). Phagocytosis was expressed as the percentage of neutrophils that became fluorescent.


Alternative pathway hemolysis assay—Human serum (5%) was incubated with buffer or Efb proteins (1 μM) in HEPES-MgEGTA (20 mM HEPES, 5 mM MgCl2, 10 mM EGTA) for 15 minutes at RT. Rabbit erythrocytes were added and incubated for 60 min at 37° C. Mixtures were centrifuged and hemolysis was determined by measuring the absorbance of supernatants at 405 nm.


Immunoblotting—To analyze C3b deposition on the bacterial surface, S. aureus strain Wood46 (3×108/ml) was incubated with 5% human plasma in the presence of Efb (0.5 μM), EDTA (5 mM) or buffer (HEPES++; 20 nM HEPES, 5 mM CaCl2), 2.5 mM MgCl2, pH 7.4) for 30 min at 37° C. shaking at 1100 rpm. Bacteria were washed twice with PBS-0.1% BSA and boiled in Laemmli sample buffer containing Dithiothreitol. Samples were subjected to SDS-PAGE and subsequently transferred to a nitrocellulose membrane. C3b was detected using a peroxidase-labeled polyclonal anti-human C3 antibody and developed using Enhanced Chemiluminescence. To quantify Efb in bacterial supernatants, His-Efb and supernatants were run together on an SDS-PAGE gel. After transfer, blots were developed using a polyclonal sheep anti-Efb antibody, peroxidase-labeled donkey anti-sheep antibodies (Fluka Analytical) and ECL.


Flow cytometry assays with S. aureus—S. aureus strain Wood46 (3×108/ml) was pre-incubated with human serum for 30 min at 37° C. in VBS++ buffer, washed with VBS++-0.5% BSA and incubated with Efb (0.5 μM) or 2-fold diluted culture supernatants for 1 hour at 37° C. shaking. After another washing step, bacteria were incubated with ALEXA FLUOR™ 488 conjugated Fg (60 μg/ml, Invitrogen) for 1 hour at 37° C. shaking. Washed bacteria were analyzed by flow cytometry using a FACSCalibur (BD). Bacteria were gated on the basis of forward and side scatter properties and fluorescence of 10,000 bacteria was analyzed. Alternatively, pre-opsonized bacteria were incubated with Efb (0.5 μM) and/or unlabeled Fg (200 μg/ml) for 1 hour at 37° C. shaking. Washed bacteria were incubated with soluble rCR1 (10 μg/ml), FITC-labeled F(ab′)2 anti-human C3 antibody or anti-human IgG antibody for 30 min at 37° C. CR1 was detected using PE-labeled anti-CD35 antibodies; the IgG antibody was detected using goat-anti-mouse PE antibodies. Capsule expression on strain Reynolds was analyzed by incubating bacteria with polyclonal anti-CP5 rabbit serum and Phycoerythrin (PE)-conjugated goat anti-rabbit antibody.


Confocal microscopy—Samples were transferred to glass slides and air-dried. Membrane dye FM 5-95 was added and slides were covered with a coverslip. Confocal images were obtained using a Leica TCS SP5 inverted microscope equipped with a HCX PL APO 406/0.85 objective.


Transmission Electron Microscopy—S. aureus strain Wood 46 (3×108) was incubated with human plasma (10%) in the presence or absence of Efb (0.5 μM) in HEPES' for 30 minutes at 37° C., washed once with PBS-1% BSA and adsorbed to 100 mesh hexagonal Formvar-carbon coated copper grids. Samples were contrasted with 0.4% uranyl acetate (pH 4.0) and 1.8% methylcellulose and analysed in a JEOL 1010 transmission electron microscope at 80 kV.


Recombinant proteins—The recombinant P163 protein was based upon the Scl2.28 sequence from S. pyogenes with the DNA codon optimized for E. coli expression. A hexahistidine tag was introduced at the N-terminus for use in purification. The GFPGER-containing SEQ ID NO:230 variant described in Cosgriff-Hernandez, et al. and referred to as DC2 was utilized in these studies. The fibrinogen-binding DC2 variant (DC2-Fg) was generated using overlap extension polymerase chain reaction (PCR) with primers from Integrated DNA Technologies. The Fg binding motif Efb-O was inserted after position 301 Gln in DC2 shown in FIG. 16A. FIG. 16A is a Schematic representation of DC2-Fg with fibrinogen (Fg) binding motif Efb-O. The inserted Efb-O amino acid sequence is SEQ ID NO:1 KYLKFKHDYN ILEFNDGTFE YGARPQFNKP A. The insertion was verified by sequencing (GENEWIZ, South Plainfield, N.J.). Recombinant proteins were expressed in E. coli BL21 (Novagen). Purification was carried out by affinity chromatography on a StrepTrap HP column and subsequent dialysis against 20 mM acetic acid (regenerated cellulose, MWCO=12-14 kDa). Protein purity was assessed by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) followed by COOMASSIE® Blue staining. Protein concentrations were measured using the DC protein assay. Circular dichroism (CD) was utilized to confirm triple helix retention with the insertion as previously described.


Integrin interactions with DC2-Fg—A11 cell culture supplies were purchased from Life Technologies and used as received unless otherwise noted. To assess retention of integrin binding in DC2-Fg, adhesion of (i) C2C12 cells, which do not natively express integrin α1 or α2 subunits, (ii) C2C12 cells modified to stably express human integrin α1 subunits (C2C12-α1), and (iii) C2C12 cells modified to stably express human integrin α2 subunits (C2C12-α2) was measured. Mouse myoblast C2C12, C2C12-α1, and C2C12-α2 cells were cultured in Dulbecco's modified Eagle's medium (DMEM) with 10 vol % fetal bovine serum (FBS) and 1 vol % penicillin-streptomycin, 1 mg ml−1 geneticin, or 10 μg ml−1 puromycin, respectively. To assess C2C12 cell adhesion, 48 well tissue culture polystyrene (TCPS) plates were coated with 10 μg of DC1 (negative control—no integrin binding sites), DC2, DC2-Fg, or collagen type I (positive control) overnight at 4° C. Proteins were coated in triplicate for each cell type. Wells were blocked with 4 wt % bovine serum albumin (BSA) in PBS for 1 hour at room temperature and rinsed with sterile PBS. Cells were adapted to serum-free media (DMEM with 1 mM CaCl2, 1 mM MgCl2, and appropriate antibiotic) for 12 hours prior to trypsinization and seeding at 5,000 cells cm−1. After 1 hour, cells were washed three times with warm PBS and lysed with 1% TRITON™-X 100 for 30 minutes at 37° C. Lysates from samples and from known standards were transferred to a 96 well plate, and cell numbers were measured with the CYTOTOX 96® NON-RADIOACTIVE CYTOTOXICITY ASSAY. Briefly, 50 μl of samples were incubated with 50 μl of substrate solution for 30 min at room temperature. Then, 50 μl of stop solution was added to each well, and the absorbance was read at 490 nm. Cell numbers were quantified using standards of known cell numbers for each cell line.


Solid phase binding assay-: Microtiter wells were coated with 1 μg of DC2, DC2-Fg, or Efb overnight at 4° C. to assess fibrinogen adhesion to DC proteins. Coated wells were blocked with 4 wt % BSA in PBS for 1 hour at room temperature. Fibrinogen was added to each protein-coated well in a serial dilution from 100 to 0 μg/well (0.3 to 0 μM). After 1 hour of incubation at room temperature, a sheep anti-fibrinogen antibody was applied to the wells (1:1000 dilution) for 1 hour at room temperature. An HRP-labelled secondary antibody to sheep was applied to the wells for 1 hour at room temperature, and SIGMAFAST™ OPD was utilized to detect bound fibrinogen via an absorbance reading at 450 nm on a THERMOMAX™ plate reader. Studies were performed in triplicate, and plates were washed three times between each step with 200 μl of PBS with 0.1 vol % TWEEN® 20.



FIG. 16B is an image of a circular dichroism (CD) spectra of DC2 and DC2-Fg. Peak at 220 nm is indicative of triple helix. DC2-Fg was successfully expressed and purified. The CD spectrum of DC2-Fg indicates that the protein retains the triple helical conformation of DC2 with the insertion, as demonstrated by the positive peak at −220 nm. FIG. 16C is plot of the integrin α1 and α2 subunit expressing C2C12 cell adhesion to DC1 (no integrin binding site), DC2 (binding site for integrins α1 and α2), DC2-FN (DC2 with fibrinogen binding site), and collagen (multiple binding sites for integrins α1 and α2). Retention of integrin binding with the Fg-binding insertion was assessed using C2C12 cells that express integrin α1 or α2 subunits. DC2 demonstrated an increase in C2C12-α1 and C2C12-α2 adhesion relative to DC1 (non-integrin binding negative control), as expected. The insertion of the Fg-binding motif, Efb-O, did not interfere with integrin binding, as demonstrated by C2C12-α1 and C2C12-α2 adhesion. In fact, DC2-Fg had significantly increased C2C12-α1 and C2C12-α2 adhesion relative to DC2 (p<0.05). This could be due to cell production of fibrinogen and subsequent binding to the Fg-binding motif in addition to interacting with the integrin-binding site in DC2-Fg. FIG. 16D is a graph showing fibrinogen binding to DC2, DC2-Fg, and Efb, as determined by solid phase binding assay. Fibrinogen interactions with DC2 and DC2-Fg were assessed using a solid phase binding assay. DC2 exhibited minimal to no fibrinogen binding, with no saturation in binding within the tested range of concentrations. Insertion of the Fg-binding motif, Efb-O, provided a large increase in fibrinogen binding, with an apparent KD of ˜10 nM. This binding affinity approached that of Fg to Efb-O, with an apparent KD of ˜1 nM. These results indicate that the Efb-based fibrinogen binding site, Efb-O, was successfully inserted into DC2 to provide a triple helical protein with controlled integrin binding and fibrinogen interactions. Statistical analyses were performed using GRAPHPAD PRISM® 4.0 package and the differences between groups were analyzed for significance using the two-tailed Student's t-test.



FIG. 17 shows the binding of Coa and Efb fragments by FBE5 antibodies. The 11 monoclonal antibodies selected against Coa-C311-636 were tested on different portions of the C-terminal part of Coagulase, namely Coa-F311-505, Coa-R0474-505 and Coa-R506-636, and different fragments of Efb, namely Efb-N30-105, Efb-A30-67 and Efb-O68-98. These proteins were immobilized (200 ng/well) and probed with the indicated antibodies at a fixed concentration (0.5 μg/ml) in a solid-phase binding assay. Binding was clearly observed for all of them and it is noticeable that the antibodies displayed variable apparent affinities to the different Efb and Coa fragments. None of the FBE5 antibodies bound to Coa-R506-636.


Antibody generation and scFv-Fc production—Antibodies against Coa were selected in scFv-format from the human naïve antibody gene libraries HAL9 and HAL10 (Kügler et al., 2015). The selection and screening was performed as described before (Russo et al., 2018a). In brief, for antibody selection, scFv phage from HAL9 and HAL10 were mixed and incubated on Coa immobilized in Costar High Binding microtiter plates (SIGMA-ALDRICH® Chemie GmbH, Munich, Germany). Panning was performed at room temperature. After three rounds of panning, monoclonal soluble scFv were produced and screened for Coa binding by antigen-ELISA. DNA of binding candidates was isolated and sequenced. The unique scFv sequences were recloned into pCSE2.6-hIgG1-Fc-XP (Russo et al., 2018b) using NcoI/NotI (NEB) for mammalian production as scFv-Fc, an IgG-like antibody format. The production in HEK293-6E cells and subsequent protein A purification was performed as described before (Jager et al., 2013).



FIG. 18 shows the dose-dependent binding of Coa fragments by FBE5 antibodies. The 11 monoclonal antibodies selected against Coa-C311-636 were titrated on different portions of the C-terminal part of Coagulase, namely Coa-C311-636, Coa-F311-505, and Coa-R0474-505. Recombinant proteins Coa-C311-636, Coa-F311-505, and Coa-R0474-505 were immobilized (200 ng/well) and probed with the selected antibodies in a solid-phase binding assay. Dose dependent binding was clearly observed for all of them and it is noticeable that the antibodies display variable apparent affinities to the different proteins. An irrelevant isotype-matched antibody (isotype control) was tested. As shown, no binding was detectable for this latter antibody.



FIG. 19 is a table that shows the apparent Kd of anti-CoaC mAbs to Coa fragments determined through EC50 calculation in ELISA. Apparent affinity values were generated through analysis of the half maximum binding in ELISA, using GRAPHPAD PRISM® Version 6.01. In most cases, values in the range of 10−9-10−10 M were obtained for most antibodies against all three Coa fragments tested (Coa-C311-636, Coa-F311-505. Coa-R0474-505). FBE5-F11 resulted to show the highest affinity to all the three proteins tested and FBE5-C8, conversely was the weakest binder of the three fragments of Coa tested.



FIG. 20 shows the dose-dependent binding of Efb fragments by FBE5 antibodies. The 11 monoclonal antibodies selected against Coa-C311-636 were titrated on different portions of the N-terminal part of Efb protein, that has sequence and functional homology to Coagulase. Immobilized (200 ng/well) and probed for recognition in a solid-phase binding assay are Efb-N30-105, Efb-A30-67 and Efb-O68-98. These proteins were probed with different quantities of the selected antibodies. Dose dependent binding is observed for all of them and it is noticeable that the antibodies display variable apparent affinities to the different proteins. An irrelevant isotype-matched antibody (isotype control) was tested. As shown, no binding was detectable for this latter antibody.



FIG. 21 is a table with the apparent Kd of anti-CoaC mAbs to Efb fragments determined through EC50 calculation in ELISA. Apparent affinity values were generated through analysis of the half maximum binding in ELISA, using GRAPHPAD PRISM® Version 6.01. In most cases, values in the range of 10−8-10−9 M were obtained for most antibodies against all three Efb fragments tested (namely Efb-N30-105, Efb-A30-67 and Efb-O68-98). FBE5-F11 was the only exception, since it displayed apparent affinities in the range of 10−10 M against all three Efb fragments. Weak binders, FBE5-C1, FBE5-C8, FBE5-E5, showed very modest binding and in some cases an estimation of apparent affinities was not possible (ND, not determinable).



FIG. 22 shows the FBE5 mAbs that efficiently inhibit binding to Fg of Coa and Efb in a dose-dependent manner. To assess the inhibitory activity of anti-Coa scFv-Fc antibodies, 0.5 μg/well of human Fg was immobilized at 4° C. overnight in 50 mM Carbonate Buffer, pH 9.6. Indicated amounts (0, 0.5, 5, and 50 μg/ml) of scFv-Fcs were pre-incubated for 1 hour with a constant concentration of Coa or Efb fragments. Specifically, Coa-F, Coa-R0, Efb-N and Efb-O were at a fixed concentration of 10 nM; whereas Efb-A was at 750 nM. Fg-binding activity of each protein alone was also checked (no mAb control—0 μg/ml). The Fg-coated plate was blocked with 2% BSA-PBST and washed with PBST. The pre-incubated mixture of Coa/Efb and anti-Coa scFv-Fc was transferred on the Fg-coated plate. Residual bound Coa and Efb fragments were detected with HRP-conjugated (HorseRadish Peroxidase-conjugated) α-GST-tag antibody, except for Efb-N, where an HRP-conjugated α-HIS-tag was used. Binding of Coa and Efb fragments to Fg (no mAb control) was set to 100% and residual binding to Fg of Coa and Efb fragments in the presence of different concentrations of antibodies was calculated and represented. FBE5-A12, FBE5-D10, FBE5-F9 and FBE5-F11 did show a dose dependent inhibition of all proteins tested. In particular FBE5-F11 showed a marked inhibition against all fragments of Coa and Efb. FBE5-A12, FBE5-D10 and FBE5-F9 showed a clear inhibition of CoaF, CoaRO and EfbA, being less efficient in inhibiting EfbN and EfbO.



FIG. 23 shows that Peptide CoaRO, but not peptide CoaRI, inhibits FBE 5 mAbs binding to CoaC. To investigate if FBE5 mAbs could be inhibited by CoaRO and CoaRI peptides, CoaC (200 ng/well) was immobilized at 4° C. overnight in 50 mM Carbonate Buffer, pH 9.6. A fixed concentration of mAbs (0.5 μg/ml) was added to the wells along with indicated amounts of CoaRO and CoaRI peptides. Incubation for 1 hour at room temperature and 250 rpm shaking followed. After washing, towels were incubated with a polyclonal α-human IgG HRP-conjugated Ab. An irrelevant, isotype-matched scFv-Fc served as a control (FBE3-X). All FBE5 antibodies were inhibited by peptide CoaRO in a fashion dependent of the peptide concentration. Instead, peptide CoaRI was unable to affect FBE5 mAbs binding to CoaC.



FIG. 24 shows the dose-dependent binding of Coa and Efb fragments by LIG40 antibodies. The 2 monoclonal antibodies (LIG40-A11 and LIG40-D8) selected against Coa-R506-636 were titrated on different portions of the N-terminal part of Efb protein (Efb-N30-105, Efb-A30-67 and Efb-O68-98), that, as reported in the parent patent, has sequence and functional homology to Coagulase. As well, binding was tested against Coa fragments, namely Coa-C311-636, Coa-F311-505. Coa-R0474-505 and Coa-R505-636. Recombinant proteins Efb-N30-105, Efb-A30-67, Efb-O68-98, Coa-C311-636. Coa-F311-505. Coa-R0474-505 and Coa-R506-636 were immobilized (200 ng/well) in a 96 well plate and probed for recognition in a solid-phase binding assay with different quantities of LIG40 antibodies. Dose dependent binding was observed for all of them. These 2 antibodies bound only Coa fragments. LIG40-A11 recognized specifically Coa-R506-636 and, reasonably, Coa-C311-636. even though the latter with lower apparent affinity. No binding to all other proteins has been detectable for LIG40-A11. LIG40-D8 also bound Coa-R506-636 and Coa-C311-636 but also binding of Coa-F311-505 and Coa-R0474-505 was detected to a minor extent. Both antibodies did not show binding to BSA and an irrelevant isotype-matched antibody (isotype control) did not show non-specific binding to the immobilized proteins.



FIG. 25 shows that LIG40-A11 mAb inhibits binding to Fg of Coa-C311-636 and Coa-R506-636 in a dose-dependent manner. To assess the inhibitory activity of anti-CoaR scFv-Fc antibody, 0.5 μg/well of human Fg was immobilized at 4° C. overnight in 50 mM Carbonate Buffer, pH 9.6. Indicated amounts of scFv-Fc were pre-incubated for 1 hour with a constant concentration of CoaC or CoaR (10 nM). Fg-binding activity of each protein at 10 nM in the absence of antibody was also checked, and referred as CTRL+(CoaC) and CTRL+(CoaR) in the figure (no mAb control—CTRL+). The Fg-coated plate was blocked with 2% BSA-PBST and washed with PBST. The pre-incubated mixture of CoaC/CoaR and anti-Coa scFv-Fc was transferred on the Fg-coated plate. Residual bound CoaC and CoaR was detected with an HRP-conjugated α-GST-tag antibody. Binding of 10 mM CoaC and CoaR to Fg in the absence of antibody, referred as CTRL+(CoaC) and CTRL+(CoaR) in the figure (no mAb control—CTRL+) was set to 100% and residual binding to Fg of CoaC and CoaR in the presence of different concentrations of antibodies was calculated and represented. LIG40-A11 showed a dose-dependent inhibition of CoaC and CoaR, being more potent against CoaR.



FIG. 26 shows that peptides CoaRO and CoaRI differentially inhibit LIG40 mAbs binding to CoaC and CoaR. To investigate if LIG40 mAbs could be inhibited by CoaRO and CoaRI peptides, CoaC and CoaR (200 ng/well) was immobilized at 4° C. overnight in 50 mM Carbonate Buffer, pH 9.6. A fixed concentration of mAbs (0.5 μg/ml) was added to the wells along with, indicated amounts of CoaRO and CoaRI peptides. Incubation for 1 hour, room temperature, 250 rpm shaking followed. After washing, towels were incubated with polyclonal α-human IgG HRP-conjugated Ab. Surprisingly, LIG40-A11 and LIG40-D8 behaved differently in the presence of the two peptides. First, to achieve appreciable inhibition high concentration of peptides needed to be used (above 100 μM). Secondly and most importantly, LIG40-A11 was inhibited only by CoaRI peptide, both when mAb binding was tested against CoaC and CoaR. In symmetrical opposite way, LIG40-D8 was only impaired in its binding activity by CoaRO peptide, suggesting that the differential role of the two repeats.



FIG. 27 is a table that shows the apparent Kd of anti-Coa-R506-636 mAbs to Coa fragments determined through EC50 calculation in ELISA. Apparent affinity values were generated through analysis of the half maximum binding in ELISA, using GRAPHPAD PRISM® Version 6.01. For both antibodies, values in the range of 10−10-10−11 M were obtained. LIG40-A11 showed the highest apparent affinity for CoaR (7.05×10−11 M) whereas LIG40-D8 was the one that showed the highest half-maximum binding to CoaC (9.39×10−11 M). Only LIG40-D8 showed minor binding to CoaRO and CoaF, instead for LIG40-A11 there was no detectable binding (apparent affinity not determinable, ND).












FBE5 antibodies, raised against COA-C(311-636), shown in scFv-Fc format











Antibody






name
VH amino acid sequence
SEQ ID NO
VL amino acid sequence
SEQ ID NO





FBE5-A5
EVQLVQSGGGVVQPGRSLRLSCAASGFTF
VH: 71
QSVLTQPPSASGTPGQRVTISCSGSSSN
VL: 101




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

IGSNTVNWYQQLPGTAPKLLIYSNNQRPS

CDR1: 166



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
GVPDRFSGSKSGTSASLAISGLQSEDEAD
CDR2: 185



AEDTAVYYCcustom character WGQGTT
CDR3: 139
YYCcustom character FGGGTKLTVL
CDR3: 202



VTVSS








FBE5-A6
QVQLVQSGGGVVQPGRSLRLSCAASGFTF
VH: 72
QAGLTQPPSASGTPGQGVTISCSGSSSNI
VL: 102




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GSNTVNWYQQLPGTAPKLLIYSNNQRPSG

CDR1: 166



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
VPDRFSGSKSGTSASLAISGLQSEDEADY
CDR2: 185



AEDTAVYYCcustom character WGQGTL
CDR3: 140
YCcustom character FGGGTKLTVL
CDR3: 202



VTVSS








FBE5-A12
QVQLVESGGGVVQPGRSLRLSCAASGFTF
VH: 73
QAVLTQPPSASGTPGQRVTISCSGSDFNV
VL: 103




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GTNYVNWYQQLPGGSAPKLLIYRNNQRPS

CDR1: 167



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
GVPDRFSGSKSGTSATLGITGLQTGDEAD
CDR2: 186



GEDTAVYYCcustom character WGQGTLV
CDR3: 141
YYCcustom character FGGGTKLTVL
CDR3: 203



TVSS








FBE5-B9
EVQLVESRGGVVQPGRSLRLSCAASGFTF
VH: 74
QSVLTQPPSVSAAPGQKVTISCSGSSSNI
VL: 104




SSYGMHWVRQAPGRGLEWVAVISYDGSNK

CDR1: 131

GNNYVSWYQQLPGTAPKLLIYDNNKRPSG

CDR1: 168



YYADSVKGRFTISRDNSKNTLYLQMNGLR
CDR2: 135
IPDRFSGSKSGTSATLGITGLQTGDEADY
CDR2: 187



SDDTAVYYCcustom character WGQGTLV
CDR3: 142
YCcustom character FGGGTKLTVL
CDR3: 204



TVSS








FBE5-C1
EVQLVETRGGVVQPGRSLRLSCAASGFTF
VH: 75
QSVLTQPPSASGTPGQRVTISCSGSSSNI
VL: 105




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GSGPVNWYQQLPGTAPKLLIYSDTRRPSG

CDR1: 169



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
IPDRLSGSKSGTSASLGISGLQSEDEADY
CDR2: 188



AEDTAVYYCcustom character
CDR3: 143
YCcustom character FGSGTKVTVL
CDR3: 205



WGQGTLVTVSS








FBE5-C8
QMQLVQSGGGVVQPGRSLRLSCAASGFIF
VH: 76
QSVLTQPPSVSAAPGQKVTISCSGSSSNI
VL: 106




SNYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 132

GNNSVSWYQQLPGTAPKLLIYDNNKRPSG

CDR1: 



YYADSVKGRFTISRDNSKNTLYLQMDSLR
CDR2: 135
IPDRFSGSKSGTSATLGITGLQTGDEADY
CDR2: 



AEDTAVYYC
CDR3: 144
YCcustom character FGGGTKLTVL
CDR3: 




custom character







WGQGTTVTVSS








FBE5-D9
QVQLVESGGGVVQPGRSLRLSCAASGFTF
VH: 77
QSALTQPASVSGSPGQSITISCTGTSSDV
VL: 107




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GGYNYVSWYQQHPGKAPKLMIYDVSNRPS

CDR1: 171



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
GVSNRFSGSKSGNTASLTISGLQAEDEAD
CDR2: 189



AEDTAVYYCcustom character WGQGTLVTV
CDR3: 145
YYCcustom character FGGGTKLTVL
CDR3: 207



SS








FBE5-D10
QVQLVQSGGGVVQPGRSLRLSCAASGFTF
VH: 78
QSVLTQPPSASGTPGQRVTISCSASSSNI
VL: 108




SNYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 133

GSNTVNWYQQLPGTAPKLLIYSNNQRPSG

CDR1: 166



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
VPDRFSGSRSGTSASLAISGLQSEDEADY
CDR2: 185



AEDTAVYYCcustom character WGQGTLVTV
CDR3: 146
YCcustom character FGGGTKLTVL
CDR3: 208



SS








FBE5-E5
QMQLVQSGGGVVQPGRSLRLSCAASGFTF
VH: 79
QSVLTQPPSVSAAPGQKVTISCSGSSSNI
VL: 109




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GNNYVSWYQQLPGTAPKLLIYDNNKRPSG

CDR1: 168



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
IPDRFSGSKSGTSATLGITGLQTGDEADY
CDR2: 187



GEDTAVYYCcustom character WGQGTLV
CDR3: 141
YCcustom character FGGGTKLTVL
CDR3: 203



TVSS








FBE5-F9
QMQLVQSGGGVVQPGRSLRLSCAASGFTF
VH: 80
QSVLTQPPSVSAAPGQKVTISCSGSSSNI
VL: 110




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

EKNYVSWYQQLPGTAPKLLIYDNNKRPSG

CDR1: 172



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
IPDRFSGSKSGTSATLGITGLQTGDEADY
CDR2: 187



AEDTAVYYCcustom character WGQGTL
CDR3: 147
YCcustom character FGGGTKLTVL
CDR3: 209



VTVSS








FBE5-F11
QVQLQESGGGVVQPGRSLRLSCAASGFTF
VH: 81
QSVLTQPPSVSAAPGQKVTISCSGSSSNI
VL: 111




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GNNYVSWYQQLPGTAPKLLIYDNNKRPSG

CDR1: 168



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
IPDRFSGSKSGTSATLGITGLQTGDEADY
CDR2: 187



AEDTAVYYCcustom character WGQGTLVTV
CDR3: 148
YCcustom character FGGGTKLTVL
CDR3: 203



SS








FBE5-A7
QVQLVESGGGVVQPGRSLRLSCAASGFTF
VH: 82
QPVLTQSSSASGTPGQRVTISCSGSSSNI
VL: 112




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GSNTVNWYQQVPGTAPKLLIYGNNQRPSG

CDR1: 166



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
VPDRFSGSKSGTSASLAISGLQSEDEADY
CDR2: 190



AEDTAVYYCcustom character WGQGTL
CDR3: 149
YCcustom character FGGGTKLTVL
CDR3: 202



VTVSS








FBE5-A11
QVQLVESGGGVVQPGRSLRLSCAASGFTF
VH: 83
QTVVTQEPSVSAAPGQKVTISCSGSSSNI
VL: 113




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GNNYVSWYQQLPGTAPKLLIYDNNRRPSG

CDR1: 168



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
IPDRFSGSKSGTSATLGITGLQTGDEADY
CDR2: 187



AEDTAVYYCcustom character WGQGTMVT
CDR3: 150
YCcustom character FGGGTKLTVL
CDR3: 209



VSS








FBE5-B2
QVQLVQSGGGVVQPGRSLRLSCAASGFTF
VH: 84
QSVLTQPPSASGTPGQRVTISCSGSSSNI
VL: 114




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GSNTVNWYQQLPGTAPRLVIHGDNRRPSG

CDR1: 166



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
VSGRFSGSKSGASASLAISGLQSEDEADY
CDR2: 191



AEDTAVYYCcustom character WGQGTLVTV
CDR3: 151
YCcustom character FGGGTRLTVL
CDR3: 210



SS








FBE5-C5
QVQLVQSGGGVVQPGRSLRLSCAASGFTF
VH: 85
QSVLTQPPSVSAASGQKVTISCSGSSSNI
VL: 115




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GNNYVSWYQQLPGTAPKLLIYDNNKRPSG

CDR1: 168



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
IPDRFSGSKSGTSATLGITGLQTGDEADY
CDR2: 187



AEDTAVYYCcustom character WGQGTMV
CDR3: 152
YCcustom character FGGGTKLTVL
CDR3: 203



TVSS








FBE5-D1
QVQLQESGGGVVQPGRSLRLSCAASGFTF
VH: 86
QSVLTQPPSVSEAPGQRVTISCTGSSSNI
VL: 116




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GAGYDVHWYQQLPGTAPKLLIYGNSNRPS

CDR1: 173



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
GVPDRFSGSKSGTSASLAISGLRSEDEAD
CDR2: 192



AEDTAVYYCcustom character WGQGTTVT
CDR3: 153
YYCcustom character FGGGTKLTVL
CDR3: 211



VSS








FBE5-D4
QMQLVQSGGGVVQPGRSLRLSCAASGFTF
VH: 87
QPVLTQPPSVSVAPRQTARITCGGNNIGR
VL: 117




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

KTVHWYQQKPGQAPVLVVYDDSDRPSGIP

CDR1: 174



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
ERFSGSNSGNTATLIISGVEAGDEADYYC
CDR2: 193



AEDTAVYYCcustom character WGQGTMVT
CDR3: 154

custom character FGGGTKVTVL

CDR3: 212



VSS








FBE5-E3
QVQLVESGGGVVQPGRSLRLSCAASGFTF
VH: 88
QSVLTQPPSVSEAPRQRVTISCSGSSSNI
VL: 118




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 1131

GNNAVNWYQHLPGKAPKLLIEHDDHLPSG

CDR1: 175



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
VSDRFSGSKSGTSASLAISGLQPEDEADY
CDR2: 194



AEDTAVYYCcustom character WGQGTL
CDR3: 155
YCcustom character FGGGTKLTVL
CDR3: 213



VTVSS








FBE5-E9
EVQLVESGGGVVQPGRSLRLSCAASGFTF
VH: 89
SYVLTQPPSASGTPGQRVTISCSGSISNI
VL: 119




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GSNTVNWYQQLPGTAPKLLIYSNNQRPSG

CDR1: 176



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
GVPDRFSGSRSGTSASLAISGLQSEDEAD
CDR2: 185



AEDTAVYYCcustom character WGQGTLV
CDR3: 156
YYCcustom character FGGGTKLTVL
CDR3: 214



TVSS








FBE5-F2
QVQLVQSGGGVVQPGRSLRLSCAASGFTF
VH: 90
WSVLTQPPSVSAAPGQKVTISCSGSSSNI
VL: 120




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131 

GNNYVSWYQQLPGTAPKLLIYDNNKRPSG

CDR1: 168



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
IPDRFSGSKSGTSATLGITGLQTGDEADY
CDR2: 187



AEDTAVYYCcustom character WGQGTTVTVS
CDR3: 157
YCcustom character FGGGTKLTVL
CDR3: 209



S








FBE5-F8
QVQLVQSGGGVVQPGRSLRLSCAASGFTF
VH: 91
QSVLTQPPSVSAAPGQKVTISCSGSSSNI
VL: 121




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GNNYVSWYQQLPGTAPKLLIYDNNKRPSG

CDR1: 168



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
IPDRFSGSKSGTSATLGIPGLQTGDEADY
CDR2: 187



AEDTAVYYCcustom character WGQGTLVT
CDR3: 158
YCcustom character FGGGTKLTVL
CDR3: 209



VSS








FBE5-G1
QVQLVQSGGGVVQPGRSLRLSCAASGFTF
VH: 92
QSVLTQPPSLSAAPGQKVTISCSGTSSNI
VL: 122




SNYGMHWVRQAPGKGLEWVVVISYDESNK

CDR1: 133

GGNYVSWYQQLPGEAPKKLIYDNNKRPSG

CDR1: 177



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 136
IPDRFSGSKSGTSATLGITGLHTGDEADY
CDR2: 187



AEDTAVYYCcustom character WGQGTMV
CDR3: 159
YCcustom character FGGGTKLTV
CDR3: 215



AVSL








FBE-G5
QVQLVQSGGGVVQPGRSLRLSCAASGFTF
VH: 93
QSVLTQPPSVSAAPGQKVTISCSGSSSNI
VL: 123




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GNNYVSWYQQLPGTAPKLLIYENNKRPSG

CDR1: 168



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
IPDRFSGSKSGTSATLGITGLQTGDEADY
CDR2: 195



AEDTAVYYCcustom character WGQGTLVTVS
CDR3: 160
YCcustom character FGGGTKLTVL
CDR3: 209



S








FBE5-G7
EVQLVQSGGGVVQPGRSLRLSCAASGFIF
VH: 94
QSVLTQPPSVSAAPGQKVTISCSGSSSNI
VL: 124




SNYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 132

GRNFVSWYQQFPETAPKLLIFDNDNRPSG

CDR1: 178



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
IPDRFSGSKSGTSVTLGITGLQTGDEADY
CDR2: 196



AEDTAVYYC
CDR3: 144
YCcustom character FGGGTKLTVL
CDR3: 216




custom character







WGQGTTVTVSS








FBE5-H1
QVQLVQSGGGVVQPGRSLRLSCAASGFTF
VH: 95
QSVLTQPPSASGTPGQRVTISCSGSSSNI
VL: 125




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GNDPVNWYQQLPGTAPKLLIYSNDQPRSG

CDR1: 179



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
VPDRFSGSKSGTSGSLAISGLQSEDEADY
CDR2: 197



AEDTAVYYCcustom character WGQGTTVT
CDR3: 161
YCcustom character FGGGTKLTVL
CDR3: 217



VSS








FBE5-H6
QVQLQESGGGVVQPGRSLRLSCAASGFTF
VH: 96
WAGLTQPPSASGTPGQRVTISCSGSSSNI
VL: 126




SSYGMHWVRQAPGKGLEWVAVISYGDSNK

CDR1: 131

GTNYVYWYQQLPGTAPKLLMYGNDQRPSG

CDR1: 180



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
VPDRFSGSKSGTSVSLAISGLRSEDEADY
CDR2: 198



AEDTAVYYCcustom character WGQGTL
CDR3: 149
YCcustom character FGGGTKLTVL
CDR3: 218



VTVSS








FBE5-H7
QVLQVQSGGGVVQPGRSLRLSCAASGFTF
VH: 97
QSVLTQPPSVSVAPGKTASVTCGGDNIGS
VL: 127




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

QSVHWYQQKPGQAPVLVVYDDSDRPSGIP

CDR1: 181



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
ERFSGSNSGNTATLTISRVEAGDEADYYC
CDR2: 193



AEDTAVYYCcustom character WGQGTLVTV
CDR3: 162

custom character FGGGTKLTVL

CDR3: 219



SS








FBE5-H8
QVQLVQSGGGVVQPGRSLRLSCAASGFTF
VH: 98
LPVLTQPPSASGTPGQRVTISCSGSSSNI
VL: 128




SSYGMHWVRQAPGKGLEWVAVISYDGSNK

CDR1: 131

GSDTVDWYQQLPGTAPKIIIYSDYRRASG

CDR1: 182



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 135
GPDRFSGSKSGTSASLAISGLQSEDEADY
CDR2: 199



AEDTAVYYCcustom character WGQGTMVT
CDR3: 163
YCcustom character FGTGTKVTVL
CDR3: 220



VSS








LIG40-A11
QVQLVESGGVVVQPGGSLRLSCAASGFTF
VH: 99
KIVLTQSPLSLPVTPGEPASISCRSSQSL
VL: 129




DDYAMHWVRQAPGKGLEWVSLISWDGGST

CDR1: 134

LYSNGNNYLDWYLQKPGQSPQLLIYLGSN

CDR1: 183



YYADSVKGRFTISRDNSKNSLYLQMNSLR
CDR2: 137
RAPGVPDRFSGSGSGTDFTLRISRVEAED
CDR2: 200



AEDTALYYCcustom character WGQGTTVTVSS
CDR3: 134
VGVYYCcustom character FGPGTKVDIK
CDR3: 221





LIG40-D8
EVQLVESGGGVVQPGRSLRLSCAASGFTF
VH: 100
DIQMTQSPSSLSASVGDTVTITCRASQDI
VL: 130




SSYGMHWVRQAPGKGLEWVAVIWYDGSNK

CDR1: 131

NNYLAWFQQKPGKAPKSLISAASLQNGVP

CDR1: 184



YYADSVKGRFTISRDNSKNTLYLQMNSLR
CDR2: 138
LRFSGSASGADFTLTISGLQPEDSGTYYC
CDR2: 201



AEDTAVYYCcustom character WGQGTLVT
CDR3: 165

custom character FGPGTKVDIK

CDR3: 222



VSS





CDR1 is Bold; CDR2 is bold and uderlined; CDR3 is bold italicized






This table includes the sequences broken out for sake of clarity:















Sequence No.
VH amino acid sequence
Antibody name
Other Ref: 







SEQ ID NO: 71
EVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-A5
VH: 71



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKAGPDSYGYGMDVW





GQGTTVTVSS







SEQ ID NO: 72
QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-A6
VH: 72



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKAGDDDYGHYFDYW





GQGTLVTVSS







SEQ ID NO: 73
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-Al2
VH: 73



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRGEDTAVYYCAREGGWEPNGLDYWG





QGTLVTVSS







SEQ ID NO: 74
EVQLVESRGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-B9
VH: 74



RQAPGRGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNGLRSDDTAVYYCARGGDDYGDYFDYWG





QGTLVTVSS







SEQ ID NO: 75
EVQLVETRGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-C1
VH: 75



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAREGTYYYDSSGYYE






GGFDYWGQGTLVTVSS








SEQ ID NO: 76
QMQLVQSGGGVVQPGRSLRLSCAASGFIFSNYGMHWV
FBE5-C8
VH: 76



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMDSLRAEDTAVYYCAREGVGGDYGDLPTG






PYYYYGMDVWGQGTTVTVSS








SEQ ID NO: 77
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-D9
VH: 77



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKNQEWLVPGYWGQG





TLVTVSS







SEQ ID NO: 78
QVQLVQSGGGVVQPGRSLRLSCAASGFTFSNYGMHWV
FBE5-D10
VH: 78



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKDSREQWLAHWGQG





TLVTVSS







SEQ ID NO: 79
QMQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-E5
VH: 79



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRGEDTAVYYCAREGGWEPNGLDYWG





QGTLVTVSS







SEQ ID NO: 80
QMQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-F9
VH: 80



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKEGDGDYGGVLDYW





GQGTLVTVSS







SEQ ID NO: 81
QVQLQESGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-F11
VH: 81



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKDLASSGFDYWGQG





TLVTVSS







SEQ ID NO: 82
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-A7
VH: 82



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKGSGYDGGRAFDYW





GQGTLVTVSS







SEQ ID NO: 83
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-A11
VH: 83



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKEIEWDGAFDIWGQ





GTMVTVSS







SEQ ID NO: 84
QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-B2
VH: 84



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCATEPSRSGTGYWGQG





TLVTVSS







SEQ ID NO: 85
QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-C5
VH: 85



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKEAPGATGAFDIWG





QGTMVTVSS







SEQ ID NO: 86
QVQLQESGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-D1
VH: 86



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKEGDGGSGMDVWGQ





GTTVTVSS







SEQ ID NO: 87
QMQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-D4
VH: 87



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKVGESEGAFDIWGQ





GTMVTVSS







SEQ ID NO: 88
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-E3
VH: 88



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCARVGYGDYGVLADYW





GQGTLVTVSS







SEQ ID NO: 89
EVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-E9
VH: 89



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKTGYGDEGEFDYWG





QGTLVTVSS







SEQ ID NO: 90
QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-F2
VH: 90



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKDGGDGMDVWGQGT





TVTVSS







SEQ ID NO: 91
QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-F8
VH: 91



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCATSGDSSSPFDYWGQ





GTLVTVSS







SEQ ID NO: 92
QVQLVQSGGGVVQPGRSLRLSCAASGFTFSNYGMHWV
FBE5-G1
VH: 92



RQAPGKGLEWVVVISYDESNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKDRSGHGDAFDIWG





QGTMVAVSL







SEQ ID NO: 93
QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-G5
VH: 93



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKEGDGYLDYWGQGT





LVTVSS







SEQ ID NO: 94
EVQLVQSGGGVVQPGRSLRLSCAASGFIFSNYGMHWV
FBE5-G7
VH: 94



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAREGVGGDYGDLPTG






PYYYYGMDVWGQGTTVTVSS








SEQ ID NO: 95
QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMEIW
FBE5-H1
VH: 95



VRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRD





NSKNTLYLQMNSLRAEDTAVYYCAKVYAGEEGMDVWG





QGTTVTVSS







SEQ ID NO: 96
QVQLQESGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-H6
VH: 96



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKGSGYDGGRAFDYW





GQGTLVTVSS







SEQ ID NO: 97
QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-H7
VH: 97



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKNSAGDAFDYWGQG





TLVTVSS







SEQ ID NO: 98
QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
FBE5-H8
VH: 98



RQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCAKSHPYHDAFDIWGQ





GTMVTVSS







SEQ ID NO: 99
QVQLVESGGVVVQPGGSLRLSCAASGFTFDDYAMHWV
LIG40-A11
VH: 99



RQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDN





SKNSLYLQMNSLRAEDTALYYCVAARRGMDVWGQGTT





VTVSS







SEQ ID NO: 100
EVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWV
LIG40-D8
VH: 100



RQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDN





SKNTLYLQMNSLRAEDTAVYYCARDYHGDGFDYWGQG





TLVTVSS







SEQ ID NO: 101
QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWY
FBE5-A5
VL: 101



QQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASL





AISGLQSEDEADYYCAAWDDSLNGVVFGGGTKLTVL







SEQ ID NO: 102
QAGLTQPPSASGTPGQGVTISCSGSSSNIGSNTVNWY
FBE5-A6
VL: 102



QQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASL





AISGLQSEDEADYYCAAWDDSLNGVVFGGGTKLTVL







SEQ ID NO: 103
QAVLTQPPSASGTPGQRVTISCSGSDFNVGTNYVNWY
FBE5-Al2
VL: 103



QQLPGSAPKLLIYRNNQRPSGVPDRFSGSKSGTSATL





GITGLQTGDEADYYCGTWDSSLSAEVFGGGTKLTVL







SEQ ID NO: 104
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWY
FBE5-B9
VL: 104



QQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATL





GITGLQTGDEADYYCGTWDSSLSAAVFGGGTKLTVL







SEQ ID NO: 105
QSVLTQPPSASGTPGQRVTISCSGSSSNIGSGPVNWY
FBE5-C1
VL: 105



QQLPGTAPKLLIYSDTRRPSGIPDRLSGSKSGTSASL





GISGLQSEDEADYYCAAWDDSLNGYAFGSGTKVTVL







SEQ ID NO: 106
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNSVSWY
FBE5-C8
VL: 106



QQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATL





GITGLQTGDEADYYCETWDSSLSAVVFGGGTKLTVL







SEQ ID NO: 107
QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSW
FBE5-D9
VL: 107



YQQHPGKAPKLMIYDVSNRPSGVSNRFSGSKSGNTAS





LTISGLQAEDEADYYCSSYTSSSTLVFGGGTKLTVL







SEQ ID NO: 108
QSVLTQPPSASGTPGQRVTISCSASSSNIGSNTVNWY
FBE5-D10
VL: 108



QQLPGTAPKLLIYSNNQRPSGVPDRFSGSRSGTSASL





AISGLQSEDEADYYCAAWDDSLNALVFGGGTKLTVL







SEQ ID NO: 109
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWY
FBE5-E5
VL: 109



QQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATL





GITGLQTGDEADYYCGTWDSSLSAEVFGGGTKLTVL







SEQ ID NO: 110
QSVLTQPPSVSAAPGQKVTISCSGSSSNIEKNYVSWY
FBE5-F9
VL: 110



QQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATL





GITGLQTGDEADYYCGTWDSSLSAVVFGGGTKLTVL







SEQ ID NO: 111
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWY
FBE5-F11
VL: 111



QQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATL





GITGLQTGDEADYYCGTWDSSLSAEVFGGGTKLTVL







SEQ ID NO: 112
QPVLTQSSSASGTPGQRVTISCSGSSSNIGSNTVNWY
FBE5-A7
VL: 112



QQVPGTAPKLLIYGNNQRPSGVPDRFSGSKSGTSASL





AISGLQSEDEADYYCAAWDDSLNGVVFGGGTKLTVL







SEQ ID NO: 113
QTVVTQEPSVSAAPGQKVTISCSGSSSNIGNNYVSWY
FBE5-Al1
VL: 113



QQLPGTAPKLLIYDNNRRPSGIPDRFSGSKSGTSATL





GITGLQTGDEADYYCGTWDSSLSAVVFGGGTKLTVL







SEQ ID NO: 114
QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWY
FBE5-B2
VL: 114



QQLPGTAPRLVIHGDNRRPSGVSGRFSGSKSGASASL





AISGLQSEDEADYYCTVWDSDLNGVVFGGGTRLTVL







SEQ ID NO: 115
QSVLTQPPSVSAASGQKVTISCSGSSSNIGNNYVSWY
FBE5-C5
VL: 115



QQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATL





GITGLQTGDEADYYCGTWDSSLSAEVFGGGTKLTVL







SEQ ID NO: 116
QSVLTQPPSVSEAPGQRVTISCTGSSSNIGAGYDVHW
FBE5-D1
VL: 116



YQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSAS





LAISGLRSEDEADYYCAAWDDSLSGREVFGGGTKLTV





L







SEQ ID NO: 117
QPVLTQPPSVSVAPRQTARITCGGNNIGRKTVHWYQQ
FBE5-D4
VL: 117



KPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLII





SGVEAGDEADYYCQVWDSSSDHVIFGGGTKVTVL







SEQ ID NO: 118
QSVLTQPPSVSEAPRQRVTISCSGSSSNIGNNAVNWY
FBE5-E3
VL: 118



QHLPGKAPKLLIEHDDHLPSGVSDRFSGSKSGTSASL





AISGLQPEDEADYYCAAWDDSVKGVIFGGGTKLTVL







SEQ ID NO: 119
SYVLTQPPSASGTPGQRVTISCSGSISNIGSNTVNWY
FBE5-E9
VL: 119



QQLPGTAPKLLIYSNNQRPSGVPDRFSGSRSGTSASL





AISGLQSEDEADYYCATWDGSLNGVVFGGGTKLTVL







SEQ ID NO: 120
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWY
FBE5-F2
VL: 120



QQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATL





GITGLQTGDEADYYCGTWDSSLSAVVFGGGTKLTVL







SEQ ID NO: 121
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWY
FBE5-F8
VL: 121



QQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATL





GIPGLQTGDEADYYCGTWDSSLSAVVFGGGTKLTVL







SEQ ID NO: 122
QSVLTQPPSLSAAPGQKVTISCSGTSSNIGGNYVSWY
FBE5-G1
VL: 122



QQLPGEAPKLLIYDNNKRPSGIPDRFSGSKSGTSATL





GITGLHTGDEADYYCGTWDSGLSAGVFGGGTKLTV







SEQ ID NO: 123
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWY
FBE5-G5
VL: 123



QQLPGTAPKLLIYENNKRPSGIPDRFSGSKSGTSATL





GITGLQTGDEADYYCGTWDSSLSAVVFGGGTKLTVL







SEQ ID NO: 124
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGRNFVSWY
FBE5-G7
VL: 124



QQFPETAPKLLIFDNDNRPSGIPDRFSGSKSGTSVTL





GITGLQTGDEADYYCETWDSSLNAVVFGGGTKLTVL







SEQ ID NO: 125
QSVLTQPPSASGTPGQRVTISCSGSSSNIGNDPVNWY
FBE5-H1
VL: 125



QQLPGTAPKLLIYSNDQRPSGVPDRFSGSKSGTSGSL





AISGLQSEDEADYYCEAWDASLNGRVFGGGTKLTVL







SEQ ID NO: 126
QAGLTQPPSASGTPGQRVTISCSGSSSNIGTNYVYWY
FBE5-H6
VL: 126



QQLPGTAPKLLMYGNDQRPSGVPDRFSGSKSGTSVSL





AISGLRSEDEADYYCSAWDDSLSGVVFGGGTKLTVL







SEQ ID NO: 127
QSVLTQPPSVSVAPGKTASVTCGGDNIGSQSVHWYQQ
FBE5-H7
VL: 127



KPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTI





SRVEAGDEADYYCQVWDSRSDHVVFGGGTKLTVL







SEQ ID NO: 128
LPVLTQPPSASGTPGQRVTISCSGSSSNIGSDTVDWY
FBE5-H8
VL: 128



QQLPGTAPKIIIYSDYRRASGVPDRFSGSKSGTSASL





AISGLQSEDEADYYCATWDASLNGYVFGTGTKVTVL







SEQ ID NO: 129
KIVLTQSPLSLPVTPGEPASISCRSSQSLLYSNGNNY
LIG40-Al1
VL: 129



LDWYLQKPGQSPQLLIYLGSNRAPGVPDRFSGSGSGT





DFTLRISRVEAEDVGVYYCMQGRQPPFTFGPGTKVDI





K







SEQ ID NO: 130
DIQMTQSPSSLSASVGDTVTITCRASQDINNYLAWFQ
LIG40-D8
VL: 130



QKPGKAPKSLISAASSLQNGVPLRFSGSASGADFTLT





ISGLQPEDSGTYYCQQYDVFPITFGPGTKVDIK







SEQ ID NO: 131
GFTFSSYG
FBE5-A5
CDR1: 131




FBE5-A6





FBE5-A12





FBE5-B9





FBE5-C1





FBE5-D9





FBE5-E5





FBE5-F9





FBE5-F11





FBE5-A7





FBE5-A11





FBE5-B2





FBE5-C5





FBE5-D1





FBE5-D4





FBE5-E3





FBE5-E9





FBE5-F2





FBE5-F8





FBE5-G5





FBE5-H1





FBE5-H6





FBE5-H7





FBE5-H8





LIG40-D8






SEQ ID NO: 132
GFIFSNYG
FBE5-C8
CDR1: 132




FBE5-G7






SEQ ID NO: 133
GFTFSNYG
FBE5-D10
CDR1: 133




FBE5-G1






SEQ ID NO: 134
GFTFDDYA
LIG40-A 11
CDR1: 134





SEQ ID NO: 135

ISYDGSNK

FBE5-A5
CDR2: 135




FBE5-A6





FBE5-A12





FBE5-B9





FBE5-C1





FBE5-C8





FBE5-D9





FBE5-D10





FBE5-E5





FBE5-F9





FBE5-F11





FBE5-A7





FBE5-A11





FBE5-B2





FBE5-C5





FBE5-D1





FBE5-D4





FBE5-E3





FBE5-E9





FBE5-F2





FBE5-F8





FBE5-G5





FBE5-G7





FBE5-H1





FBE5-H6





FBE5-H7





FBE5-H8






SEQ ID NO: 136

ISYDESNK

FBE5-G1
CDR2: 136





SEQ ID NO: 137

ISWDGGST

LIG40-A11
CDR2: 137





SEQ ID NO: 138

IWYDGSNK

LIG40-D8
CDR2: 138





SEQ ID NO: 139
AKAGPDSYGYGMDV
FBE5-A5
CDR3: 139





SEQ ID NO: 140

AKAGDDDYGHYFD

FBE5-A6
CDR3: 140





SEQ ID NO: 141

AREGGWEPNGLDY

FBE5-A12
CDR3: 141




FBE5-E5






SEQ ID NO: 142

ARGGDDYGDYFDY

FBE5-B9
CDR3: 142





SEQ ID NO: 143

AREGTYYYDSSGYYEGGFDY

FBE5-C1
CDR3: 143





SEQ ID NO: 144

AREGVGGDYGDLPTGPYYYYGMDV

FBE5-C8
CDR3: 144




FBE5-G7






SEQ ID NO: 145

AKNQEWLVPGY

FBE5-D9
CDR3: 145





SEQ ID NO: 146

AKDSREQWLAH

FBE5-D10
CDR3: 146





SEQ ID NO: 147

AKEGDGDYGGVLDY

FBE5-F9
CDR3: 147





SEQ ID NO: 148

AKDLASSGFDY

FBE5-F11
CDR3: 148





SEQ ID NO: 149

AKGSGYDGGRAFDY

FBE5-A7
CDR3: 149




FBE5-H6






SEQ ID NO: 150

AKEIEWDGAFDI

FBE5-A11
CDR3: 150





SEQ ID NO: 151

ATEPSRSGTGY

FBE5-B2
CDR3: 151





SEQ ID NO: 152

AKEAPGATGAFDI

FBE5-C5
CDR3: 152





SEQ ID NO: 153

AKEGDGGSGMDV

FBE5-D1
CDR3: 153





SEQ ID NO: 154

AKVGESEGAFDI

FBE5-D4
CDR3: 154





SEQ ID NO: 155

ARVGYGDYGVLADY

FBE5-E3
CDR3: 155





SEQ ID NO: 156

AKTGYGDEGEFDY

FBE5-E9
CDR3: 156





SEQ ID NO: 157

AKDGGDGMDV

FBE5-F2
CDR3: 157





SEQ ID NO: 158

ATSGDSSSPFDY

FBE5-F8
CDR3: 158





SEQ ID NO: 159

AKDRSGHGDAFDI

FBE5-G1
CDR3: 159





SEQ ID NO: 160

AKEGDGYLDY

FBE5-G5
CDR3: 160





SEQ ID NO: 161

AKVYAGEEGMDV

FBE5-H1
CDR3: 161





SEQ ID NO: 162

AKNSAGDAFDY

FBE5-H7
CDR3: 162





SEQ ID NO: 163

AKSHPYHDAFDI

FBE5-H8
CDR3: 163





SEQ ID NO: 164

VAARRGMDV

LIG40-A11
CDR3: 164





SEQ ID NO: 165

ARDYHGDGFDY

LIG40-D8
CDR3: 165





SEQ ID NO: 166
SSNIGSNT
FBE5-A5
CDR1: 166




FBE5-A6





FBE5-D10





FBE5-A7





FBE5-B2






SEQ ID NO: 167
DFNVGTNY
FBE5-A12
CDR1: 167





SEQ ID NO: 168
SSNIGNNY
FBE5-B9
CDR1: 168




FBE5-E5





FBE5-F11





FBE5-A11





FBE5-C5





FBE5-F2





FBE5-F8





FBE5-G5






SEQ ID NO: 169
SSNIGSGP
FBE5-C1
CDR1: 169





SEQ ID NO: 170
SSNIGNNS
FBE5-C8
CDR1: 170





SEQ ID NO: 171
SSDVGGYNY
FBE5-D9
CDR1: 171





SEQ ID NO: 172
SSNIEKNY
FBE5-F9
CDR1: 172





SEQ ID NO: 173
SSNIGAGYD
FBE5-D1
CDR1: 173





SEQ ID NO: 174
NIGRKT
FBE5-D4
CDR1: 174





SEQ ID NO: 175
SSNIGNNA
FBE5-E3
CDR1: 175





SEQ ID NO: 176
ISNIGSNT
FBE5-E9
CDR1: 176





SEQ ID NO: 177
SSNIGGNY
FBE5-G1
CDR1: 177





SEQ ID NO: 178
SSNIGRNF
FBE5-G7
CDR1: 178





SEQ ID NO: 179
SSNIGNDP
FBE5-H1
CDR1: 179





SEQ ID NO: 180
SSNIGTNY
FBE5-H6
CDR1: 180





SEQ ID NO: 181
NIGSQS
FBE5-H7
CDR1: 181





SEQ ID NO: 182
SSNIGSDT
FBE5-H8
CDR1: 182





SEQ ID NO: 183
QSLLYSNGNNY
LIG40-A11
CDR1: 183





SEQ ID NO: 184
QDINNY
LIG40-D8
CDR1: 184





SEQ ID NO: 185

SNN

FBE5-A5
CDR2: 185




FBE5-A6





FBE5-D10





FBE5-E9






SEQ ID NO: 186

RNN

FBE5-A12
CDR2: 186





SEQ ID NO: 187

DNN

FBE5-B9
CDR2: 187




FBE5-C8





FBE5-E5





FBE5-F9





FBE5-F11





FBE5-A11





FBE5-C5





FBE5-F2





FBE5-F8





FBE5-G1






SEQ ID NO: 188

SDT

FBE5-C1
CDR2: 188





SEQ ID NO: 189

DVS

FBE5-D9
CDR2: 189





SEQ ID NO: 190

GNN

FBE5-A7
CDR2: 190





SEQ ID NO: 191

GDN

FBE5-B2
CDR2: 191





SEQ ID NO: 192

GNS

FBE5-D1
CDR2: 192





SEQ ID NO: 193

DDS

FBE5-D4
CDR2: 193




FBE5-H7






SEQ ID NO: 194

HDD

FBE5-E3
CDR2: 194





SEQ ID NO: 195

ENN

FBE5-G5
CDR2: 195





SEQ ID NO: 196

DND

FBE5-G7
CDR2: 196





SEQ ID NO: 197

SND

FBE5-H1
CDR2: 197





SEQ ID NO: 198

GND

FBE5-H6
CDR2: 198





SEQ ID NO: 199

SDY

FBE5-H8
CDR2: 199





SEQ ID NO: 200

LGS

LIG40-A11
CDR2: 200





SEQ ID NO: 201

AAS

LIG40-D8
CDR2: 201





SEQ ID NO: 202

AAWDDSLNGVV

FBE5-A5
CDR3: 202




FBE5-A6





FBE5-A7






SEQ ID NO: 203

GTWDSSLSAEV

FBE5-A12
CDR3: 203




FBE5-E5





FBE5-F11





FBE5-C5






SEQ ID NO: 204

GTWDSSLSAAV

FBE5-B9
CDR3: 204





SEQ ID NO: 205

AAWDDSLNGYA

FBE5-C1
CDR3: 205





SEQ ID NO: 206

ETWDSSLSAVV

FBE5-C8
CDR3: 206





SEQ ID NO: 207

SSYTSSSTLV

FBE5-D9
CDR3: 207





SEQ ID NO: 208

AAWDDSLNALV

FBE5-D10
CDR3: 208





SEQ ID NO: 209

GTWDSSLSAVV

FBE5-F9
CDR3: 209




FBE5-A11





FBE5-F2





FBE5-F8





FBE5-G5






SEQ ID NO: 210

TVWDSDLNGVV

FBE5-B2
CDR3: 210





SEQ ID NO: 211

AAWDDSLSGREV

FBE5-D1
CDR3: 211





SEQ ID NO: 212

QVWDSSSDHVI

FBE5-D4
CDR3: 212





SEQ ID NO: 213

AAWDDSVKGVI

FBE5-E3
CDR3: 213





SEQ ID NO: 214

ATWDGSLNGVV

FBE5-E9
CDR3: 214





SEQ ID NO: 215

GTWDSGLSAGV

FBE5-G1
CDR3: 215





SEQ ID NO: 216

ETWDSSLNAVV

FBE5-G7
CDR3: 216





SEQ ID NO: 217

EAWDASLNGRV

FBE5-H1
CDR3: 217





SEQ ID NO: 218

SAWDDSLSGVV

FBE5-H6
CDR3: 218





SEQ ID NO: 219

QVWDSRSDHVV

FBE5-H7
CDR3: 219





SEQ ID NO: 220

ATWDASLNGYV

FBE5-H8
CDR3: 220





SEQ ID NO: 221

MQGRQPPFT

LIG40-A11
CDR3: 221





SEQ ID NO: 222

QQYDVFPIT

LIG40-D8
CDR3: 222









In one embodiment, the present invention includes an antibody or antigen binding fragment thereof that specifically binds an extracellular fibrinogen binding protein, wherein the antibody or antigen binding fragment thereof comprises, consists essentially of, or consists of: (a) a heavy chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:131-134; a heavy chain CDR2 comprising the amino acid sequences selected from SEQ ID NOS:135-138; and a heavy chain CDR3 comprising the amino acid sequences selected from SEQ ID NOS:139-165); and (b) a light chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:166-184; a light chain CDR2 comprising the amino acid sequence selected from SEQ ID NOS:185-201; and a light chain CDR3 comprising the amino acid sequence selected from SEQ ID NOS:202-222. In one aspect, the antibody or antigen binding fragment thereof is a full-length antibody. In another aspect, the antibody or antigen binding fragment thereof is a humanized antibody. In another aspect, the antibody or antigen binding fragment thereof is an antigen binding fragment, wherein the antigen binding fragment comprises an Fab, a Fab′, a F(ab′)2, a single chain Fv (scFv), a disulfide linked Fv, an IgG-CH2, a F(ab′)3, a tetrabody, a triabody, a diabody, a (scFv)2, or a scFv-Fc. In another aspect, the extracellular fibrinogen binding protein is selected from Efb, Coa or both. In another aspect, the antibody or antigen binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence selected from SEQ ID NOS: 71-100 and a light chain variable domain comprising the amino acid sequence selected from SEQ ID NOS:101-130. In another aspect, the antibody or antigen binding fragment further comprises a collagen-like domain, a globular domain, or both. In another aspect, the antibody or antigen binding fragment further comprises a label selected from the group consisting of: a radiolabel, a fluorophore, a chromophore, an imaging agent and a metal ion, wherein the labeled antibody is a diagnostic reagent. In another aspect, the antibody or antigen binding fragment further comprises a therapeutic agent selected from an analgesic, an anti-histamine, an anti-inflammatory agent, an antibiotic, a chemotherapeutic, an immunosuppressant, a cytokine, an anti-proliferative, an antiemetic, or a cytotoxin. In one example, the variable heavy chain and variable light chain comprise, respectively SEQ ID NOS:71 and 101, 72 and 102, 73 and 103, 74 and 104, 75 and 105, 76 and 106, 77 and 107, 78 and 108, 79 and 109, 80 and 110, 81 and 111, 82 and 112, 83 and 113, 84 and 114, 85 and 115, 86 and 116, 87 and 117, 88 and 118, 89 and 110, 90 and 120, 91 and 121, 92 and 122, 93 and 123, 94 and 124, 95 and 125, 96 and 126, 97 and 127, 98 and 128, 99 and 129, or 100 and 130.


In another embodiment, the present invention includes a method of making the antibody or antigen binding fragment thereof comprising, consisting essentially of, or consisting of: (a) culturing a cell expressing said antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a heavy chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:131-134; a heavy chain CDR2 comprising the amino acid sequences selected from SEQ ID NOS:135-138; and a heavy chain CDR3 comprising the amino acid sequences selected from SEQ ID NOS:139-165); and (b) a light chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:166-184; a light chain CDR2 comprising the amino acid sequence selected from SEQ ID NOS:185-201; and a light chain CDR3 comprising the amino acid sequence selected from SEQ ID NOS:202-222; and (b) isolating the antibody or antigen binding fragment thereof from the cultured cell, wherein the cell is a eukaryotic cell. In another aspect, the antibody or antigen binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence selected from SEQ ID NOS: 71-100 and a light chain variable domain comprising the amino acid sequence selected from SEQ ID NOS:101-130. In one example, the variable heavy chain and variable light chain comprise, respectively SEQ ID NOS:71 and 101, 72 and 102, 73 and 103, 74 and 104, 75 and 105, 76 and 106, 77 and 107, 78 and 108, 79 and 109, 80 and 110, 81 and 111, 82 and 112, 83 and 113, 84 and 114, 85 and 115, 86 and 116, 87 and 117, 88 and 118, 89 and 110, 90 and 120, 91 and 121, 92 and 122, 93 and 123, 94 and 124, 95 and 125, 96 and 126, 97 and 127, 98 and 128, 99 and 129, or 100 and 130.


In another embodiment, the present invention includes an immunoconjugate having the formula (A)-(L)-(C), wherein: (A) is the antibody or antigen binding fragment of claim 1; (L) is a linker; and (C) is a cytotoxic agent; wherein the linker (L) links (A) to (C) wherein the antibody or antigen binding fragment thereof comprises, consists essentially of, or consists of: a heavy chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS: SEQ ID NOS:131-134; a heavy chain CDR2 comprising the amino acid sequences selected from SEQ ID NOS:135-138; and a heavy chain CDR3 comprising the amino acid sequences selected from SEQ ID NOS:139-165); and (b) a light chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:166-184; a light chain CDR2 comprising the amino acid sequence selected from SEQ ID NOS:185-201; and a light chain CDR3 comprising the amino acid sequence selected from SEQ ID NOS:202-222. In one aspect, the linker is selected from the group consisting of a cleavable linker, a non-cleavable linker, a hydrophilic linker, and a dicarboxylic acid based linker. In another aspect, the linker is selected from the group consisting: N-succinimidyl 4-(2-pyridyldithio)pentanoate (SPP) or N-succinimidyl 4-(2-pyridyldithio)-2-sulfopentanoate (sulfo-SPP); N-succinimidyl 4-(2-pyridyldithio)butanoate (SPDB) or N-succinimidyl 4-(2-pyridyldithio)-2-sulfobutanoate (sulfo-SPDB); N-succinimidyl 4-(maleimidomethyl) cyclohexanecarboxylate (SMCC); N-sulfosuccinimidyl 4-(maleimidomethyl) cyclohexanecarboxylate (sulfoSMCC); N-succinimidyl-4-(iodoacetyl)-aminobenzoate (SIAB); and N-succinimidyl-[(N-maleimidopropionamido)-tetraethyleneglycol] ester (NHS-PEG4-maleimide). In another aspect, the immunoconjugate further comprises a therapeutic agent selected from an analgesic, an anti-histamine, an anti-inflammatory agent, an antibiotic, a chemotherapeutic, an immunosuppressant, a cytokine, an anti-proliferative, an antiemetic, or a cytotoxin. In another aspect, the immunoconjugate comprises 2-6 (C), 3-4 (C), or has an average of about 3 to about 4 (C) per (A) or an average of about 3.5+/−0.5 (C) per (A). In another aspect, the immunoconjugate further comprises a pharmaceutically acceptable carrier. In another aspect, the antibody or antigen binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence selected from SEQ ID NOS: 71-100 and a light chain variable domain comprising the amino acid sequence selected from SEQ ID NOS:101-130. In one example, the variable heavy chain and variable light chain comprise, respectively SEQ ID NOS:71 and 101, 72 and 102, 73 and 103, 74 and 104, 75 and 105, 76 and 106, 77 and 107, 78 and 108, 79 and 109, 80 and 110, 81 and 111, 82 and 112, 83 and 113, 84 and 114, 85 and 115, 86 and 116, 87 and 117, 88 and 118, 89 and 110, 90 and 120, 91 and 121, 92 and 122, 93 and 123, 94 and 124, 95 and 125, 96 and 126, 97 and 127, 98 and 128, 99 and 129, or 100 and 130.


In another embodiment, the present invention includes a pharmaceutical composition comprising, consisting essentially of, or consisting of: an antibody or antigen binding fragment thereof that specifically binds an extracellular fibrinogen binding protein, wherein the antibody or antigen binding fragment thereof comprises: (a) a heavy chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:131-134; a heavy chain CDR2 comprising the amino acid sequences selected from SEQ ID NOS:135-138; and a heavy chain CDR3 comprising the amino acid sequences selected from SEQ ID NOS:139-165); and (b) a light chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:166-184; a light chain CDR2 comprising the amino acid sequence selected from SEQ ID NOS:185-201; and a light chain CDR3 comprising the amino acid sequence selected from SEQ ID NOS:202-222; and a pharmaceutically acceptable carrier. In another aspect, the antibody or antigen binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence selected from SEQ ID NOS: 71-100 and a light chain variable domain comprising the amino acid sequence selected from SEQ ID NOS:101-130. In one example, the variable heavy chain and variable light chain comprise, respectively SEQ ID NOS:71 and 101, 72 and 102, 73 and 103, 74 and 104, 75 and 105, 76 and 106, 77 and 107, 78 and 108, 79 and 109, 80 and 110, 81 and 111, 82 and 112, 83 and 113, 84 and 114, 85 and 115, 86 and 116, 87 and 117, 88 and 118, 89 and 110, 90 and 120, 91 and 121, 92 and 122, 93 and 123, 94 and 124, 95 and 125, 96 and 126, 97 and 127, 98 and 128, 99 and 129, or 100 and 130.


In another embodiment, the present invention includes a method for making a monoclonal antibody comprising, consisting essentially of, or consisting of: providing an effective amount of a composition comprising a modified extracellular fibrinogen binding protein having a N-terminus modified fibrinogen binding protein that does not bind fibrinogen, a C-terminus modified complement binding protein that does not bind a complement protein or both; producing an antibody pool of the modified extracellular fibrinogen binding protein, the C-terminus modified complement binding protein, or both; screening the antibody pool to detect active antibodies; wherein the active antibodies inhibit the fibrinogen binding to extracellular fibrinogen binding protein, wherein the antibody or antigen binding fragment thereof comprises: a heavy chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:131-134; a heavy chain CDR2 comprising the amino acid sequences selected from SEQ ID NOS:135-138; and a heavy chain CDR3 comprising the amino acid sequences selected from SEQ ID NOS:139-165); and (b) a light chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:166-184; a light chain CDR2 comprising the amino acid sequence selected from SEQ ID NOS:185-201; and a light chain CDR3 comprising the amino acid sequence selected from SEQ ID NOS:202-222; separating the active antibodies; and adding the active antibodies to a pharmaceutically acceptable carrier. In another aspect, the antibody or antigen binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence selected from SEQ ID NOS: 71-100 and a light chain variable domain comprising the amino acid sequence selected from SEQ ID NOS:101-130. In one example, the variable heavy chain and variable light chain comprise, respectively SEQ ID NOS:71 and 101, 72 and 102, 73 and 103, 74 and 104, 75 and 105, 76 and 106, 77 and 107, 78 and 108, 79 and 109, 80 and 110, 81 and 111, 82 and 112, 83 and 113, 84 and 114, 85 and 115, 86 and 116, 87 and 117, 88 and 118, 89 and 110, 90 and 120, 91 and 121, 92 and 122, 93 and 123, 94 and 124, 95 and 125, 96 and 126, 97 and 127, 98 and 128, 99 and 129, or 100 and 130.


In another embodiment, the present invention includes a method of treating of a staphylococcus bacterium infection comprising consisting essentially of, or consisting of: providing a pharmacologically effective amount of a monoclonal and/or polyclonal antibody or antigen-binding fragment thereof that can specifically bind to a portion of a extracellular fibrinogen binding protein comprising antibody or antigen binding fragment thereof that specifically binds an extracellular fibrinogen binding protein, wherein the antibody or antigen binding fragment thereof comprises: (a) a heavy chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:131-134; a heavy chain CDR2 comprising the amino acid sequences selected from SEQ ID NOS:135-138; and a heavy chain CDR3 comprising the amino acid sequences selected from SEQ ID NOS:139-165); and (b) a light chain CDR1 comprising the amino acid sequence selected from SEQ ID NOS:166-184; a light chain CDR2 comprising the amino acid sequence selected from SEQ ID NOS:185-201; and a light chain CDR3 comprising the amino acid sequence selected from SEQ ID NOS:202-222, that inhibits fibrinogen binding, complement protein binding, inhibition of the shielding of the staphylococcus bacterium from recognition by a phagocytic receptor, or a combination thereof. In another aspect, the antibody or antigen binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence selected from SEQ ID NOS: 71-100 and a light chain variable domain comprising the amino acid sequence selected from SEQ ID NOS:101-130. In one example, the variable heavy chain and variable light chain comprise, respectively SEQ ID NOS:71 and 101, 72 and 102, 73 and 103, 74 and 104, 75 and 105, 76 and 106, 77 and 107, 78 and 108, 79 and 109, 80 and 110, 81 and 111, 82 and 112, 83 and 113, 84 and 114, 85 and 115, 86 and 116, 87 and 117, 88 and 118, 89 and 110, 90 and 120, 91 and 121, 92 and 122, 93 and 123, 94 and 124, 95 and 125, 96 and 126, 97 and 127, 98 and 128, 99 and 129, or 100 and 130.


It is contemplated that any embodiment discussed in this specification can be implemented with respect to any method, kit, reagent, or composition of the invention, and vice versa. Furthermore, compositions of the invention can be used to achieve methods of the invention.


It will be understood that particular embodiments described herein are shown by way of illustration and not as limitations of the invention. The principal features of this invention can be employed in various embodiments without departing from the scope of the invention. Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific procedures described herein. Such equivalents are considered to be within the scope of this invention and are covered by the claims.


All publications and patent applications mentioned in the specification are indicative of the level of skill of those skilled in the art to which this invention pertains. All publications and patent applications are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.


The use of the word “a” or “an” when used in conjunction with the term “comprising” in the claims and/or the specification may mean “one,” but it is also consistent with the meaning of “one or more,” “at least one,” and “one or more than one.” The use of the term “or” in the claims is used to mean “and/or” unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive, although the disclosure supports a definition that refers to only alternatives and “and/or.” Throughout this application, the term “about” is used to indicate that a value includes the inherent variation of error for the device, the method being employed to determine the value, or the variation that exists among the study subjects.


As used in this specification and claim(s), the words “comprising” (and any form of comprising, such as “comprise” and “comprises”), “having” (and any form of having, such as “have” and “has”), “including” (and any form of including, such as “includes” and “include”) or “containing” (and any form of containing, such as “contains” and “contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps. In embodiments of any of the compositions and methods provided herein, “comprising” may be replaced with “consisting essentially of” or “consisting of”. As used herein, the phrase “consisting essentially of” requires the specified integer(s) or steps as well as those that do not materially affect the character or function of the claimed invention. As used herein, the term “consisting” is used to indicate the presence of the recited integer (e.g., a feature, an element, a characteristic, a property, a method/process step or a limitation) or group of integers (e.g., feature(s), element(s), characteristic(s), property(ies), method/process steps or limitation(s)) only.


The term “or combinations thereof” as used herein refers to all permutations and combinations of the listed items preceding the term. For example, “A, B, C, or combinations thereof” is intended to include at least one of: A, B, C, AB, AC, BC, or ABC, and if order is important in a particular context, also BA, CA, CB, CBA, BCA, ACB, BAC, or CAB. Continuing with this example, expressly included are combinations that contain repeats of one or more item or term, such as BB, AAA, AB, BBC, AAABCCCC, CBBAAA, CABABB, and so forth. The skilled artisan will understand that typically there is no limit on the number of items or terms in any combination, unless otherwise apparent from the context.


As used herein, words of approximation such as, without limitation, “about”, “substantial” or “substantially” refers to a condition that when so modified is understood to not necessarily be absolute or perfect but would be considered close enough to those of ordinary skill in the art to warrant designating the condition as being present. The extent to which the description may vary will depend on how great a change can be instituted and still have one of ordinary skill in the art recognize the modified feature as still having the required characteristics and capabilities of the unmodified feature. In general, but subject to the preceding discussion, a numerical value herein that is modified by a word of approximation such as “about” may vary from the stated value by at least ±1, 2, 3, 4, 5, 6, 7, 10, 12 or 15%.


All of the compositions and/or methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.


To aid the Patent Office, and any readers of any patent issued on this application in interpreting the claims appended hereto, applicants wish to note that they do not intend any of the appended claims to invoke paragraph 6 of 35 U.S.C. § 112, U.S.C. § 112 paragraph (f), or equivalent, as it exists on the date of filing hereof unless the words “means for” or “step for” are explicitly used in the particular claim.


For each of the claims, each dependent claim can depend both from the independent claim and from each of the prior dependent claims for each and every claim so long as the prior claim provides a proper antecedent basis for a claim term or element.


REFERENCES



  • Kügler, J., Wilke, S., Meier, D., Tomszak, F., Frenzel, A., Schirrmann, T., Dübel, S., Garritsen, H., Hock, B., Toleikis, L., Schütte, M. and Hust, M. (2015). Generation and analysis of the improved human HAL9/10 antibody phage display libraries. BMC Biotechnol. 15, 10.

  • Russo, G., Meier, D., Helmsing, S., Wenzel, E., Oberle, F., Frenzel, A. and Hust, M. (2018a). Parallelized Antibody Selection in Microtiter Plates. Methods Mol. Biol. 1701, 273-284.

  • Russo, G., Theisen, U., Fahr, W., Helmsing, S., Hust, M., Köster, R. W. and Dübel, S. (2018b). Sequence defined antibodies improve the detection of cadherin 2 (N-cadherin) during zebrafish development. New Biotechnology 45, 98-112.

  • Jäger, V., Büssow, K., Wagner, A., Weber, S., Hust, M., Frenzel, A. and Schirrmann, T. (2013). High level transient production of recombinant antibodies and antibody fusion proteins in HEK293 cells. BMC Biotechnol. 13, 52.



Additional Embodiments

In some embodiments, the present disclosure pertains to a method of making the antibody or antigen binding fragment thereof including: (a) culturing a cell expressing said antibody or antigen binding fragment thereof, where the antibody or antigen binding fragment thereof includes: a heavy chain CDR1 having the amino acid sequence selected from SEQ ID NOS:131-134; a heavy chain CDR2 having the amino acid sequences selected from SEQ ID NOS:135-138; and a heavy chain CDR3 having the amino acid sequences selected from SEQ ID NOS:139-165); and a light chain CDR1 having the amino acid sequence selected from SEQ ID NOS:166-184; a light chain CDR2 having the amino acid sequence selected from SEQ ID NOS:185-201; and a light chain CDR3 having the amino acid sequence selected from SEQ ID NOS:202-222; and (b) isolating the antibody or antigen binding fragment thereof from the cultured cell, where the cell is a eukaryotic cell.


In some embodiments, the variable heavy chain and the variable light chain include, respectively SEQ ID NOS:71 and 101, 72 and 102, 73 and 103, 74 and 104, 75 and 105, 76 and 106, 77 and 107, 78 and 108, 79 and 109, 80 and 110, 81 and 111, 82 and 112, 83 and 113, 84 and 114, 85 and 115, 86 and 116, 87 and 117, 88 and 118, 89 and 110, 90 and 120, 91 and 121, 92 and 122, 93 and 123, 94 and 124, 95 and 125, 96 and 126, 97 and 127, 98 and 128, 99 and 129, or 100 and 130.


In some embodiments, the antibody or the antigen binding fragment thereof includes a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 81 and a light chain variable domain having the amino acid sequence of SEQ ID NO: 111.

Claims
  • 1. An isolated antibody or antigen binding fragment thereof that specifically binds to a staphylococcal extracellular fibrinogen binding protein, wherein the antibody or the antigen binding fragment thereof comprises: (a) a heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 131, a heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and a heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 148, and(b) a light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 168, a light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 187, and a light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 203.
  • 2. The antibody or the antigen binding fragment thereof of claim 1, wherein the antibody is a full-length antibody, is a humanized antibody, or both.
  • 3. The antibody or the antigen binding fragment thereof of claim 2, wherein the antibody binds to SEQ ID NO: 32 and SEQ ID NO: 63.
  • 4. The antibody or the antigen binding fragment thereof of claim 1, wherein the extracellular fibrinogen binding protein is Coa protein of Staphylococcus aureus.
  • 5. The antibody or the antigen binding fragment thereof of claim 1, wherein the antibody or the antigen binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 81 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 111.
  • 6. An immunoconjugate having the formula (A)-(L)-(C), wherein (A) is the antibody or the antigen binding fragment thereof of claim 1, (L) is a linker, and (C) is a cytotoxic agent.
  • 7. The immunoconjugate of claim 6, wherein the linker is selected from the group consisting of a cleavable linker, a non-cleavable linker, a hydrophilic linker, and a dicarboxylic acid based linker, or is selected from the group consisting of N-succinimidyl 4-(2-pyridyldithio)pentanoate (SPP) or N-succinimidyl 4-(2-pyridyldithio)-2-sulfopentanoate (sulfo-SPP); N-succinimidyl 4-(2-pyridyldithio)butanoate (SPDB) or N-succinimidyl 4-(2-pyridyldithio)-2-sulfobutanoate (sulfo-SPDB); N-succinimidyl 4-(maleimidomethyl) cyclohexanecarboxylate (SMCC); N-sulfosuccinimidyl 4-(maleimidomethyl) cyclohexanecarboxylate (sulfoSMCC); N-succinimidyl-4-(iodoacetyl)-aminobenzoate (STAB); and N-succinimidyl-[(N-maleimidopropionamido)-tetraethyleneglycol] ester (NHS-PEG4-maleimide).
  • 8. The immunoconjugate of claim 6, further comprising a therapeutic agent selected from an analgesic, an anti-histamine, an anti-inflammatory agent, an antibiotic, a chemotherapeutic, an immunosuppressant, a cytokine, an anti-proliferative, an antiemetic, a cytotoxin, or a pharmaceutically acceptable carrier.
  • 9. The immunoconjugate of claim 6, wherein the immunoconjugate comprises 2-6 (C), 3-4 (C), or has an average of about 3 to about 4 (C) per (A), or an average of about 3.5+/−0.5 (C) per (A).
  • 10. A method of making the antibody or the antigen binding fragment thereof of claim 1, the method comprising: (a) culturing a cell expressing the antibody or the antigen binding fragment thereof, and(b) isolating the antibody or the antigen binding fragment thereof from the cultured cell, wherein the cell is a eukaryotic cell.
  • 11. The method of claim 10, wherein the antibody or the antigen binding fragment thereof comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 81 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 111.
CROSS-REFERENCE TO RELATED APPLICATIONS

The present application is a Continuation-in-Part of U.S. 371 patent application Ser. No. 15/029,896, filed Apr. 15, 2016, now abandoned, which is a National Stage of International Application No. PCT/US2014/060772, filed Oct. 15, 2014, which claims the benefit of U.S. Provisional Application No. 61/891,233, filed Oct. 15, 2013. The contents of each of which are incorporated by reference in their entirety.

Related Publications (1)
Number Date Country
20200283508 A1 Sep 2020 US
Provisional Applications (1)
Number Date Country
61891233 Oct 2013 US
Continuation in Parts (1)
Number Date Country
Parent 15029896 US
Child 16879272 US