Compounds

Information

  • Patent Grant
  • 11505547
  • Patent Number
    11,505,547
  • Date Filed
    Friday, November 30, 2018
    6 years ago
  • Date Issued
    Tuesday, November 22, 2022
    2 years ago
Abstract
Compounds of formula (I) and related aspects.
Description
RELATED APPLICATIONS

This application is a U.S. National Phase Application under 35 U.S.C. § 371 of International Application No. PCT/EP2018/083140, filed Nov. 30, 2018, which claims priority to, and the benefit of, European Application No. 17204796.1, filed Nov. 30, 2017, European Application No. 18163766.1, filed Mar. 23, 2018, and European Application No. 18175823.6, filed Jun. 4, 2018. The contents of each of these applications are incorporated herein by reference in their entirety.


FIELD OF THE INVENTION

The invention relates to novel benzamide compounds, processes for the manufacture of such compounds, related intermediates, compositions comprising such compounds and the use of such compounds as cytidine triphosphate synthase 1 inhibitors, particularly in the treatment or prophylaxis of disorders associated with cell proliferation.


BACKGROUND OF THE INVENTION

Nucleotides are a key building block for cellular metabolic processes such as deoxyribonucleic acid (DNA) and ribonucleic acid (RNA) synthesis. There are two classes of nucleotides, that contain either purine or pyrimidine bases, both of which are important for metabolic processes. Based on this, many therapies have been developed to target different aspects of nucleotide synthesis, with some inhibiting generation of purine nucleotides and some pyrimidine nucleotides or both.


The pyrimidine nucleotide cytidine 5′ triphosphate (CTP) is a precursor required not just for the metabolism of DNA and RNA but also phospholipids and sialyation of proteins. CTP originates from two sources: a salvage pathway and a de novo synthesis pathway that depends on two enzymes, the CTP synthases (or synthetases) 1 and 2 (CTPS1 and CTPS2) (Evans and Guy 2004; Higgins, et al. 2007; Ostrander, et al. 1998).


CTPS1 and CTPS2 catalyse the conversion of uridine triphosphate (UTP) and glutamine into cytidine triphosphate (CTP) and L-glutamate:




embedded image


Both enzymes have two domains, an N-terminal synthetase domain and a C-terminal glutaminase domain (Kursula, et al. 2006). The synthetase domain transfers a phosphate from adenosine triphosphate (ATP) to the 4-position of UTP to create an activated intermediate, 4-phospho-UTP. The glutaminase domain generates ammonia from glutamine, via a covalent thioester intermediate with a conserved active site cysteine, generating glutamate. This ammonium is transferred from the glutaminase domain to the synthetase domain via a tunnel or can be derived from external ammonium. This ammonium is then used by the synthetase domain to generate CTP from the 4-phospho-UTP (Lieberman, 1956).


Although CTPS exists as two isozymes in humans and other eukaryotic organisms, CTPS1 and CTPS2, functional differences between the two isozymes are not yet fully elucidated (van Kuilenburg, et al. 2000).


The immune system provides protection from infections and has therefore evolved to rapidly respond to the wide variety of pathogens that the individual may be exposed to. This response can take many forms, but the expansion and differentiation of immune populations is a critical element and is hence closely linked to rapid cell proliferation. Within this, CTP synthase activity appears to play an important role in DNA synthesis and the rapid expansion of lymphocytes following activation (Fairbanks, et al. 1995; van den Berg, et al. 1995).


Strong clinical validation that CTPS1 is the critical enzyme in human lymphocyte proliferation came with the identification of a loss-of-function homozygous mutation (rs145092287) in this enzyme that causes a distinct and life-threatening immunodeficiency, characterized by an impaired capacity of activated T- and B-cells to proliferate in response to antigen receptor-mediated activation. Activated CTPS1-deficient cells were shown to have decreased levels of CTP. Normal T-cell proliferation was restored in CTPS1-deficient cells by expressing wild-type CTPS1 or by addition of exogenous CTP or its nucleoside precursor, cytidine. CTPS1 expression was found to be low in resting lymphocytes, but rapidly upregulated following activation of these cells. Expression of CTPS1 in other tissues was generally low. CTPS2 seems to be ubiquitously expressed in a range of cells and tissues but at low levels, and the failure of CTPS2, which is still intact in the patients, to compensate for the mutated CTPS1, supports CTPS1 being the critical enzyme for the immune populations affected in the patients (Martin, et al. 2014).


Overall, these findings suggest that CTPS1 is a critical enzyme necessary to meet the demands for the supply of CTP required by several important immune cell populations.


Normally the immune response is tightly regulated to ensure protection from infection, whilst controlling any response targeting host tissues. In certain situations, the control of this process is not effective, leading to immune-mediated pathology. A wide range of human diseases are thought to be due to such inappropriate responses mediated by different elements of the immune system.


Given the role that cell populations, such as T and B lymphocytes, are thought to play in a wide range of autoimmune and other diseases, CTPS1 represents a target for a new class of immunosuppressive agents. Inhibition of CTPS1 therefore provides a novel approach to the inhibition of activated lymphocytes and selected other immune cell populations such as Natural Killer cells, Mucosal-Associated Invariant T (MAIT) and Invariant Natural Killer T cells, highlighted by the phenotype of the human mutation patients (Martin, et al. 2014).


Cancer can affect multiple cell types and tissues but the underlying cause is a breakdown in the control of cell division. This process is highly complex, requiring careful coordination of multiple pathways, many of which remain to be fully characterised. Cell division requires the effective replication of the cell's DNA and other constituents. Interfering with a cell's ability to replicate by targeting nucleic acid synthesis has been a core approach in cancer therapy for many years. Examples of therapies acting in this way are 6-thioguanine, 6-mecaptopurine, 5-fluorouracil, cytarabine, gemcitabine and pemetrexed.


As indicated above, pathways involved in providing the key building blocks for nucleic acid replication are the purine and pyrimidine synthesis pathways, and pyrimidine biosynthesis has been observed to be up-regulated in tumors and neoplastic cells.


CTPS activity is upregulated in a range of tumour types of both haematological and non-haematological origin, although heterogeneity is observed among patients. Linkages have also been made between high enzyme levels and resistance to chemotherapeutic agents.


Currently, the precise role that CTPS1 and CTPS2 may play in cancer is not completely clear. Several non-selective CTPS inhibitors have been developed for oncology indications up to phase I/II clinical trials, but were stopped due to toxicity and efficacy issues.


Most of the developed inhibitors are nucleoside-analogue prodrugs (3-deazauridine, CPEC, carbodine), which are converted to the active triphosphorylated metabolite by the kinases involved in pyrimidine biosynthesis: uridine/cytidine kinase, nucleoside monophosphate-kinase (NMP-kinase) and nucleoside diphosphatekinase (NDP-kinase). The remaining inhibitors (acivicin, DON) are reactive analogues of glutamine, which irreversibly inhibit the glutaminase domain of CTPS. Gemcitibine is also reported to have some inhibitory activity against CTPS (McClusky et al., 2016).


CTPS therefore appears to be an important target in the cancer field. The nature of all of the above compounds is such that effects on other pathways are likely to contribute to the efficacy they show in inhibiting tumours.


Selective CTPS inhibitors therefore offer an attractive alternative approach for the treatment of tumours. Compounds with different potencies against CTPS1 and CTPS2 may offer important opportunities to target different tumours depending upon their relative dependence on these enzymes.


CTPS1 has also been suggested to play a role in vascular smooth muscle cell proliferation following vascular injury or surgery (Tang et al., 2013).


As far as is known to date, no selective CTPS1 inhibitors have been developed. Recently, the CTPS1 selective inhibitory peptide CTpep-3 has been identified. The inhibitory effects of CTpep-3 however, were seen in cell free assays but not in the cellular context. This was not unexpected though, since the peptide is unlikely to enter the cell and hence is not easily developable as a therapeutic (Sakamoto, et al. 2017).


In summary, the available information and data strongly suggest that inhibitors of CTPS1 will reduce the proliferation of a number of immune and cancer cell populations, with the potential for an effect on other selected cell types such as vascular smooth muscle cells as well. Inhibitors of CTPS1 may therefore be expected to have utility for treatment or prophylaxis in a wide range of indications where the pathology is driven by these populations.


CTPS1 inhibitors represent a novel approach for inhibiting selected components of the immune system in various tissues, and the related pathologies or pathological conditions such as, in general terms, rejection of transplanted cells and tissues, Graft-related diseases or disorders, allergies and autoimmune diseases. In addition, CTPS1 inhibitors offer therapeutic potential in a range of cancer indications and in enhancing recovery from vascular injury or surgery and reducing morbidity and mortality associated with neointima and restenosis.


SUMMARY OF THE INVENTION

The invention provides a compound of formula (I):




embedded image


wherein

    • R1 is C1-5alkyl, C0-2alkyleneC3-5cycloalkyl which cycloalkyl is optionally substituted by CH3, C1-3alkyleneOC1-2alkyl, or CF3;
    • R3 is H, CH3, halo, OC1-2alkyl or CF3;
    • R4 and R5 are each independently H, C1-6alkyl, C0-2alkyleneC3-6cycloalkyl, C0-2alkyleneC3-6heterocycloalkyl, C1-3alkyleneOC1-3alkyl, C1-6alkylOH or C1-6haloalkyl,
      • or R4 and R5 together with the carbon atom to which they are attached form a C3-6cycloalkyl or C3-6heterocycloalkyl ring;
    • R6 is H or C1-3alkyl;
    • Ar1 is a 6-membered aryl or heteroaryl;
    • Ar2 is a 6-membered aryl or heteroaryl and is attached to Ar1 in the para position relative to the amide;
    • R10 is H, halo, C1-3alkyl, OC1-2alkyl, C1-2haloalkyl, OC1-2haloalkyl or CN;
    • R11 is H, F, Cl, CH3, ethyl, OCH3, CF3, OCF3 or CN;
    • R12 is attached to Ar2 in the meta or ortho position relative to Ar and R12 is H, halo, C1-4 alkyl, C2-4alkynyl, C(═O)C1-2alkyl, C0-2alkyleneC3-5cycloalkyl, OC1-4alkyl, C1-3alkyleneOC1-3alkyl, C1-4haloalkyl, OC1-4haloalkyl, CN, OC0-2alkyleneC3-5cycloalkyl, OCH2CH2N(CH3)2, OH, C1-4alkylOH, NR23R24, SO2CH3, C(O)N(CH3)2, NHC(O)C1-3alkyl, or a C3-6heterocycloalkyl comprising one nitrogen located at the point of attachment to Ar2, or R12 together with a nitrogen atom to which it is attached forms an N-oxide (N+—O);
    • R23 is H or C1-2alkyl; and
    • R24 is H or C1-2alkyl.


Suitably, there is provided a compound of formula (I):




embedded image




    • wherein

    • R1 is C1-4alkyl, C1-2alkyleneOC1-2alkyl or C0-1alkyleneC3-4cycloalkyl which cycloalkyl is optionally substituted by CH3;

    • R3 is H, CH3, F or Cl;

    • R4 and R5 are each independently H, C1-4alkyl, C0-2alkyleneC3-5cycloalkyl, C1-3 alkyleneOC1-3alkyl, C1-4alkylOH or C1-4haloalkyl;

    • R6 is H or C1-3alkyl;

    • Ar1 is a 6-membered aryl or heteroaryl;

    • Ar2 is a 6-membered aryl or heteroaryl and is attached to Ar1 in the para position relative to the amide;

    • R10 is H, halo, C1-3alkyl, OC1-2alkyl, C1-2haloalkyl, OC1-2haloalkyl or CN; and R12 is attached to Ar2 in the meta position relative to Ar1 and R12 is H, halo, C1-4alkyl, C2alkynyl, C(═O)C1-2alkyl, C0-2alkyleneC3-5cycloalkyl, OC1-4alkyl, C1-3alkyleneOC1-3alkyl, C1-4haloalkyl, OC1-4haloalkyl or CN.





A compound of formula (I) may be provided in the form of a salt and/or solvate thereof and/or derivative thereof. Suitably, the compound of formula (I) may be provided in the form of a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof. In particular, the compound of formula (I) may be provided in the form of a pharmaceutically acceptable salt and/or solvate, such as a pharmaceutically acceptable salt.


Also provided is a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof, for use as a medicament, in particular for use in the inhibition of CTPS1 in a subject or the prophylaxis or treatment of associated diseases or disorders, such as those in which a reduction in T-cell and/or B-cell proliferation would be beneficial.


Further, there is provided a method for the inhibition of CTPS1 in a subject or the prophylaxis or treatment of associated diseases or disorders, such as those in which a reduction in T-cell and/or B-cell proliferation would be beneficial, by administering to a subject in need thereof a compound of formula (I) or a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof.


Additionally provided is the use of a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof, in the manufacture of a medicament for the inhibition of CTPS1 in a subject or the prophylaxis or treatment of associated diseases or disorders, such as those in which a reduction in T-cell and/or B-cell proliferation would be beneficial.


Suitably the disease or disorder is selected from: inflammatory skin diseases such as psoriasis or lichen planus; acute and/or chronic GVHD such as steroid resistant acute GVHD; acute lymphoproliferative syndrome (ALPS); systemic lupus erythematosus, lupus nephritis or cutaneous lupus; and transplantation. In addition, the disease or disorder may be selected from myasthenia gravis, multiple sclerosis, and scleroderma/systemic sclerosis.


Also provided is a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof, for use in the treatment of cancer.


Further, there is provided a method for treating cancer in a subject, by administering to a subject in need thereof a compound of formula (I) or a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof.


Additionally provided is the use of a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof, in the manufacture of a medicament for the treatment of cancer in a subject.


Also provided is a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof, for use in enhancing recovery from vascular injury or surgery and reducing morbidity and mortality associated with neointima and restenosis in a subject.


Further, there is provided a method for enhancing recovery from vascular injury or surgery and reducing morbidity and mortality associated with neointima and restenosis in a subject, by administering to a subject in need thereof a compound of formula (I) or a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof.


Additionally provided is the use of a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof, in the manufacture of a medicament for enhancing recovery from vascular injury or surgery and reducing morbidity and mortality associated with neointima and restenosis in a subject.


Also provided are pharmaceutical compositions containing a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof, and a pharmaceutically acceptable carrier or excipient.


Also provided are processes for preparing compounds of formula (I) and novel intermediates of use in the preparation of compounds of formula (I).







DETAILED DESCRIPTION OF THE INVENTION

The invention provides a compound of formula (I):




embedded image


wherein

    • R1 is C1-5alkyl, C0-2alkyleneC3-5cycloalkyl which cycloalkyl is optionally substituted by CH3, C1-3alkyleneOC1-2alkyl, or CF3;
    • R3 is H, CH3, halo, OC1-2alkyl or CF3;
    • R4 and R5 are each independently H, C1-6alkyl, C0-2alkyleneC3-6cycloalkyl, C0-2alkyleneC3-6heterocycloalkyl, C1-3alkyleneOC1-3alkyl, C1-6alkylOH or C1-6haloalkyl,
      • or R4 and R5 together with the carbon atom to which they are attached form a C3-6cycloalkyl or C3-6heterocycloalkyl ring;
    • R6 is H or C1-3alkyl;
    • Ar1 is a 6-membered aryl or heteroaryl;
    • Ar2 is a 6-membered aryl or heteroaryl and is attached to Ar1 in the para position relative to the amide;
    • R10 is H, halo, C1-3alkyl, OC1-2alkyl, C1-2haloalkyl, OC1-2haloalkyl or CN;
    • R11 is H, F, Cl, CH3, ethyl, OCH3, CF3, OCF3 or CN;
    • R12 is attached to Ar2 in the meta or ortho position relative to Ar1 and R12 is H, halo, C1-4 alkyl, C2-4alkynyl, C(═O)C1-2alkyl, C0-2alkyleneC3-5cycloalkyl, OC1-4alkyl, C1-3alkyleneOC1-3alkyl, C1-4haloalkyl, OC1-4haloalkyl, CN, OC0-2alkyleneC3-5cycloalkyl, OCH2CH2N(CH3)2, OH, C1-4alkylOH, NR23R24, SO2CH3, C(O)N(CH3)2, NHC(O)C1-3alkyl, or a C3-6heterocycloalkyl comprising one nitrogen located at the point of attachment to Ar2, or R12 together with a nitrogen atom to which it is attached forms an N-oxide (N+—O);
    • R23 is H or C1-2alkyl; and
    • R24 is H or C1-2alkyl;
    • or a salt and/or solvate thereof and/or derivative thereof.


Suitably, the invention provides a compound of formula (I):




embedded image


wherein

    • R1 is C1-4alkyl, C1-2alkyleneOC1-2alkyl or C0-1alkyleneC3-4cycloalkyl which cycloalkyl is optionally substituted by CH3;
    • R3 is H, CH3, F or C;
    • R4 and R5 are each independently H, C1-4alkyl, C0-2alkyleneC3-5cycloalkyl, C1-3 alkyleneOC1-3alkyl, C1-4alkylOH or C1-4haloalkyl;
    • R6 is H or C1-3alkyl;
    • Ar1 is a 6-membered aryl or heteroaryl;
    • Ar2 is a 6-membered aryl or heteroaryl and is attached to Ar1 in the para position relative to the amide;
    • R10 is H, halo, C1-3alkyl, OC1-2alkyl, C1-2haloalkyl, OC1-2haloalkyl or CN; and
    • R12 is attached to Ar2 in the meta position relative to Ar1 and R12 is H, halo, C1-4alkyl, C2alkynyl, C(═O)C1-2alkyl, C0-2alkyleneC3-5cycloalkyl, OC1-4alkyl, C1-3alkyleneOC1-3alkyl, C1-4haloalkyl, OC1-4haloalkyl or CN;
    • or a salt and/or solvate thereof and/or derivative thereof.


Suitably, the invention provides a compound of formula (I):




embedded image


wherein

    • R1 is C0-1alkyleneC3-4cycloalkyl;
    • R3 is H, CH3 or Cl;
    • R4 and R5 are each independently H, C1-4alkyl or C1-3alkyleneOC1-3alkyl;
      • or R4 together with R5 form a C3-6cycloalkyl ring
    • R6 is H or C1-3alkyl;
    • Ar1 is a 6-membered aryl or heteroaryl;
    • Ar2 is a 6-membered aryl or heteroaryl and is attached to Ar1 in the para position relative to the amide;
    • R10 is H, halo, C1-3alkyl, OC1-2alkyl or C1-2haloalkyl; and
    • R12 is attached to Ar2 in the meta position relative to Ar1 and R12 is H, halo, C1-4alkyl, C(═O)C1-2alkyl, OC1-4alkyl, C1-4haloalkyl, OC1-4haloalkyl or CN;
    • or a salt and/or solvate thereof and/or derivative thereof.


The term ‘alkyl’ as used herein, such as in C1-2alkyl, C1-3alkyl or C1-4alkyl, whether alone or forming part of a larger group such as an Oalkyl group (e.g. OC1-2alkyl, OC1-3alkyl or OC1-4alkyl), is a straight or a branched fully saturated hydrocarbon chain containing the specified number of carbon atoms. Examples of alkyl groups include the C1-4alkyl groups methyl, ethyl, n-propyl, iso-propyl, n-butyl, iso-butyl, sec-butyl and tert-butyl, in particular the C1-3alkyl groups methyl, ethyl, n-propyl and iso-propyl such as C1-2alkyl groups methyl and ethyl. Reference to “propyl” includes n-propyl and iso-propyl, and reference to “butyl” includes n-butyl, isobutyl, sec-butyl and tert-butyl. Examples of Oalkyl groups include the OC1-4alkyl groups methoxy, ethoxy, propoxy (which includes n-propoxy and iso-propoxy) and butoxy (which includes n-butoxy, iso-butoxy, sec-butoxy and tert-butoxy). C5alkyl groups as used herein, whether alone or forming part of a larger group such as an OC5alkyl group is a straight or a branched fully saturated hydrocarbon chain containing five carbon atoms. Examples of C5alkyl groups include n-pentyl, sec-pentyl, 3-pentyl, sec-isopentyl and active pentyl. C6alkyl groups as used herein, whether alone or forming part of a larger group such as an OC6alkyl group is a straight or a branched fully saturated hydrocarbon chain containing six carbon atoms. Examples of C6alkyl groups include n-hexyl, 2-methylpentyl, 3-methylpentyl, 2,2-dimethylbutyl and 2,3-dimethylbutyl.


The term ‘alkylene’ as used herein, such as in C0-2alkyleneC3-5cycloalkyl, C1-3alkyleneOC1-3alkyl, C1-2alkyleneOC1-2alkyl or C0-1alkyleneC3-4cycloalkyl is a bifunctional straight or a branched fully saturated hydrocarbon chain containing the specified number of carbon atoms. Examples of C0-2alkylene groups are where the group is absent (i.e. C0), methylene (C1) and ethylene (C2). Examples of C1-3alkylene groups are where the group is methylene (C1), ethylene (C2) and propylene (C3). Examples of C1-2alkylene groups are where the group is methylene (C1) and ethylene (C2). Examples of C0-1alkylene groups are where the group is absent (C0) and methylene (C1).


The term ‘cycloalkyl’ as used herein, such as in C3-6cycloalkyl, such as C3-5cycloalkyl or C3-4cycloalkyl, whether alone or forming part of a larger group such as C0-2alkyleneC3-6cycloalkyl such as C0-2alkyleneC3-5cycloalkyl or C0-1alkyleneC3-4cycloalkyl is a fully saturated hydrocarbon ring containing the specified number of carbon atoms. Examples of cycloalkyl groups include the C3-5cycloalkyl groups cyclopropyl, cyclobutyl and cyclopentyl. Examples of cycloalkyl groups also include the C6cycloalkyl group cyclohexyl.


Example ‘cycloalkyl’ groups are as follows:




embedded image


The term ‘heterocycloalkyl’ as used herein, such as in C3-6heterocycloalkyl or C0-2alkyleneC3-6heterocycloalkyl is a fully saturated hydrocarbon ring containing the specified number of ring atoms and includes the ring atom through which the heterocycloalkyl group is attached, wherein at least one of the atoms in the ring is a heteroatom such as O, N or S. As required by valency, the nitrogen atom(s) may be connected to a hydrogen atom to form an NH group. Alternatively the nitrogen atom(s) may be substituted (such as one nitrogen atom is substituted), for example by C1-4alkyl, C(O)H, C(O)C1-4alkyl, C(O)OC1-4alkyl, C(O)OC1-4alkylaryl such as C(O)OBz, C(O)NHC1-4alkyl, C(O)NHC1-4alkylaryl such as C(O)NHBz, an Fmoc group, C(O)C1-4haloalkyl, C(O)OC1-4haloalkyl or C(O)NHC1-4haloalkyl such as C(O)OtBu. Wherein a ring heteroatom is S, the term ‘heterocycloalkyl’ includes wherein the S atom(s) is substituted (such as one S atom is substituted) by one or two oxygen atoms (i.e. S(O) or S(O)2). Alternatively, any sulphur atom(s) in the C3-6heterocycloalkyl ring is not substituted.


Examples of C3-6heterocycloalkyl groups include those comprising one heteroatom such as containing one heteroatom (e.g. one oxygen atom or one nitrogen atom) or containing two heteroatoms (e.g. two oxygen atoms or one oxygen atom and one nitrogen atom or two nitrogen atoms). Particular examples of C3-6heterocycloalkyl comprising one oxygen atom include oxiranyl, oxetanyl, 3-dioxolanyl, morpholinyl, 1,4-oxathianyl, tetrahydropyranyl, 1,4-thioxanyl and 1,3,5-trioxanyl. Particular examples of C3-6heterocycloalkyl comprising one nitrogen atom include pyrrolidinyl, pyrazolidinyl, imidazolidinyl, thiazolidinyl, piperidinyl, piperazinyl, morpholinyl and thiomorpholinyl.


The heterocycloalkyl groups may have the following structures:




embedded image


embedded image


wherein each Q is independently selected from O, N or S, such as O or N. When Q is N, as required by valency, the nitrogen atom(s) may be connected to a hydrogen atom to form an NH group. Alternatively the nitrogen atom(s) may be substituted (such as one nitrogen atom is substituted), for example by C1-4alkyl, C(O)H, C(O)C1-4alkyl, C(O)OC1-4alkyl, C(O)OC1-4alkylaryl such as C(O)OBz, C(O)NHC1-4alkyl, C(O)NHC1-4alkylaryl such as C(O)NHBz, an Fmoc group, C(O)C1-4haloalkyl, C(O)OC1-4haloalkyl or C(O)NHC1-4haloalkyl such as C(O)OtBu. When any Q is S, the S atoms can be substituted (such as one S atom is substituted) by one or two oxygen atoms (i.e. S(O) or S(O)2). Alternatively, any sulphur atom(s) in the C3-6heterocycloalkyl ring is not substituted.


When the heterocycloalkyl is formed from R4 and R5 together with the carbon atom to which they are attached, suitably any heteroatom is not directly connected to the carbon to which R4 and R5 are attached. Thus suitably, when the heterocycloalkyl is formed from R4 and R5 together with the carbon atom to which they are attached, the heterocycloalkyl may be:




embedded image


wherein each Q is independently O, N or S such as O or N. When Q is N, as required by valency, the nitrogen atom(s) may be connected to a hydrogen atom to form an NH group. Alternatively the nitrogen atom (s) may be substituted (such as one nitrogen atom is substituted), for example by C1-4alkyl, C(O)H, C(O)C1-4alkyl, C(O)OC1-4alkyl, C(O)OC1-4alkylaryl such as C(O)OBz, C(O)NHC1-4alkyl, C(O)NHC1-4alkylaryl such as C(O)NHBz, an Fmoc group, C(O)C1-4haloalkyl, C(O)OC1-4haloalkyl or C(O)NHC1-4haloalkyl such as C(O)OtBu. When any Q is S, the S atom(s) can be substituted (such as one S atom is substituted) by one or two oxygen atoms (i.e. S(O) or S(O)2). Alternatively, any sulphur atom(s) in the C3-6heterocycloalkyl ring is not substituted.


When R4 and/or R5 is C0alkyleneC3-6heterocycloalkyl, any heteroatom in the heterocycloalkyl may not be directly connected to the carbon to which R4 and R5 are connected.


The term ‘alkynyl’ as used herein, such as in C2-4alkynyl such as in C2alkynyl is an unbranched hydrocarbon chain containing the specified number of carbons (e.g. 2, 3 or 4 carbons, such as two carbons), two of which carbon atoms are linked by a carbon-carbon triple bond.


The term ‘halo’ or ‘halogen’ as used herein, refers to fluorine, chlorine, bromine or iodine. Particular examples of halo are fluorine and chlorine, especially fluorine.


The term ‘haloalkyl’ as used herein, such as in C1-6haloalkyl, such as in C1-2haloalkyl or C1-4 haloalkyl, whether alone or forming part of a larger group such as an Ohaloalkyl group, such as in OC1-6haloalkyl, such as in OC1-2haloalkyl or OC1-4haloalkyl, is a straight or a branched fully saturated hydrocarbon chain containing the specified number of carbon atoms and at least one halogen atom, such as fluoro or chloro, especially fluoro. An example of haloalkyl is CF3.


Further examples of haloalkyl are CHF2 and CH2CF3. Examples of Ohaloalkyl include OCF3, OCHF2 and OCH2CF3.


The term ‘6-membered aryl’ as used herein refers to a phenyl ring.


The term ‘6-membered heteroaryl’ as used herein refers to 6-membered aromatic rings containing at least one heteroatom (e.g. nitrogen). Exemplary 6-membered heteroaryls include one nitrogen atom (pyridinyl), two nitrogen atoms (pyridazinyl, pyrimidinyl or pyrazinyl) and three nitrogen atoms (triazinyl).


The phrase ‘in the para position relative to the amide’ as used herein, such as in relation to the position of Ar2, means that compounds with the following substructure are formed:




embedded image


wherein W may be N, CH or CR10, and Y may be N, CH or CR12 as required by the definitions provided for compounds of formula (I). W may also be CR11 as allowed by the definitions provided for compounds of formula (I).


The term ‘meta’ as used herein, such as when used in respect of defining the position of R12 on Ar2 is with respect to Ar1 means:




embedded image


The term ‘ortho’ as used herein, such as when used in respect of defining the position of R12 on Ar2 is with respect to Ar1 means:




embedded image


In one embodiment of the invention R1 is C1-5alkyl such as C1-4alkyl. When R1 is C1-5alkyl, R1 is methyl, ethyl, propyl (n-propyl or isopropyl), butyl (n-butyl, isobutyl, sec-butyl or tert-butyl) or pentyl (e.g. n-pentyl, sec-pentyl, 3-pentyl, sec-isopentyl or active pentyl). When R1 is C1-4alkyl, R1 is methyl, ethyl, propyl (n-propyl or isopropyl) or butyl (n-butyl, isobutyl, sec-butyl or tert-butyl).


In a second embodiment of the invention R1 is C1-3alkyleneOC1-2alkyl such as C1-2alkyleneOC1-2 alkyl. R1 may be C1alkyleneOC1alkyl. R1 may be C1alkyleneOC2alkyl. R1 may be C2alkyleneOC1alkyl. R1 may be C2alkyleneOC2alkyl. R1 may be C3alkyleneOC1alkyl. R1 may be C3alkyleneOC2alkyl.


In a third embodiment of the invention R1 is C0-2alkyleneC3-5cycloalkyl which cycloalkyl is optionally substituted by CH3 such as C0-1alkyleneC3-4cycloalkyl which cycloalkyl is optionally substituted by CH3. In some embodiments, R1 is C0-2alkyleneC3-5cycloalkyl such as C0-1alkyleneC3-4cycloalkyl. In other embodiments, R1 is C0-2alkyleneC3-5cycloalkyl which cycloalkyl is substituted by CH3 such as C0-1alkyleneC3-4cycloalkyl which cycloalkyl is substituted by CH3. R1 may be C3-5cycloalkyl, which cycloalkyl is optionally substituted by CH3 such as C3-4cycloalkyl, which cycloalkyl is optionally substituted by CH3. R1 may be C1alkyleneC3-5cycloalkyl, which cycloalkyl is optionally substituted by CH3. R1 may be C1alkyleneC3-4cycloalkyl, which cycloalkyl is optionally substituted by CH3. R1 may be C2alkyleneC3-5cycloalkyl, which cycloalkyl is optionally substituted by CH3. R1 may be C2alkyleneC3-4cycloalkyl, which cycloalkyl is optionally substituted by CH3. R1 may be C0-2alkyleneC3cycloalkyl, which cycloalkyl is optionally substituted by CH3. R1 may be C0-1alkyleneC3cycloalkyl, which cycloalkyl is optionally substituted by CH3. R1 may be C0-2alkyleneC4cycloalkyl, which cycloalkyl is optionally substituted by CH3. R1 may be C0-1alkyleneC4cycloalkyl, which cycloalkyl is optionally substituted by CH3. R1 may be C0-2alkyleneC5cycloalkyl, which cycloalkyl is optionally substituted by CH3. R1 may be C0-1alkyleneC5cycloalkyl, which cycloalkyl is optionally substituted by CH3. Suitably, where C0-2alkyleneC3-5cycloalkyl such as C0-1alkyleneC3-4cycloalkyl is optionally substituted by CH3, the CH3 is at the point of attachment of the C3-5cycloalkyl to the C0-2alkylene such as at the point of attachment of the C3-4cycloalkyl to the C0-1alkylene.


Suitably R1 is cyclopropyl.


In a fourth embodiment of the invention, R1 is CF3.


In one embodiment R3 is H. In a second embodiment R3 is CH3. In a third embodiment, R3 is halo. In an example, R3 is F. In a second example, R3 is C. In a fourth embodiment, R3 is OC1-2 alkyl. Suitably R3 is OCH3. Suitably, R3 is OCH2CH3. In a fifth embodiment, R3 is CF3.


Suitably, R3 is H.


In one embodiment, R4 is H. In a second embodiment R4 is C1-6alkyl such as C1-4alkyl, i.e. methyl, ethyl, propyl (n-propyl or isopropyl) or butyl (n-butyl, isobutyl, sec-butyl or tert-butyl). R4 may also be pentyl (e.g. n-pentyl, sec-pentyl, 3-pentyl, sec-isopentyl or active pentyl) or hexyl (e.g. n-hexyl, 2-methylpentyl, 3-methylpentyl, 2,2-dimethylbutyl and 2,3-dimethylbutyl). In a third embodiment, R4 is C0-2alkyleneC3-6cycloalkyl such as C0-2alkyleneC3-5cycloalkyl, such as C0-2alkyleneC3cycloalkyl, C0-2alkyleneC4cycloalkyl, C0-2alkyleneC5cycloalkyl, C0alkyleneC3-5cycloalkyl, C1alkyleneC3-5cycloalkyl and C2alkyleneC3-5cycloalkyl. R4 may also be C0-2alkyleneC6cycloalkyl, C0alkyleneC3-6cycloalkyl, C1alkyleneC3-6cycloalkyl and C2alkyleneC3-6cycloalkyl. In a fourth embodiment R4 is C1-3alkyleneOC1-3alkyl, in particular C1-2alkyleneOC1-2 alkyl such as C1alkyleneOC1alkyl, C2alkyleneOC1alkyl, C1alkyleneOC2alkyl or C2alkyleneOC2alkyl. In a fifth embodiment R4 is C1-6alkylOH such as C1-4alkylOH such as C1alkylOH, C2alkylOH, C3alkylOH or C4alkylOH wherein C1-4alkyl is methyl, ethyl, propyl (n-propyl or isopropyl) and butyl (n-butyl, isobutyl, sec-butyl or tert-butyl). R4 may also be C5alkylOH or C6alkylOH. In a sixth embodiment, R4 is C1-6haloalkyl such as C1-4haloalkyl such as C1haloalkyl (e.g. CF3), C2haloalkyl (e.g. CH2CF3), C3haloalkyl (e.g. CH2CH2CF3) or C4haloalkyl (e.g. CH2CH2CH2CF3). R4 may also be C3haloalkyl (e.g. CH2CH2CH2CH2CF3) or C6haloalkyl (e.g. CH2CH2CH2CH2CH2CF3). In a seventh embodiment, R4 is C0-2alkyleneC3-6heterocycloalkyl such as C0-2alkyleneC3heterocycloalkyl, C0-2alkyleneC4heterocycloalkyl, C0-2alkyleneC5heterocycloalkyl, C0-2alkyleneC6heterocycloalkyl, C0alkyleneC3-6heterocycloalkyl, C1alkyleneC3-6heterocycloalkyl and C2alkyleneC3-6heterocycloalkyl. Suitably the heterocycloalkyl of a C0-2alkyleneC3-6heterocycloalkyl group is a heterocyclopropyl, heterocyclobutyl, heterocyclopentyl or heterocyclohexyl ring such as a heterocyclohexyl ring. Suitably, the heterocyclopentyl ring is tetrahydrofuranyl or pyrrolidinyl. Suitably, the heterocyclohexyl ring is tetrahydropyranyl or piperidinyl. Any nitrogen atom such as one nitrogen atom in the C3-6heterocycloalkyl ring may be substituted, for example by C1-4alkyl, C(O)H, C(O)C1-4alkyl, C(O)OC1-4alkyl, C(O)OC1-4alkylaryl such as C(O)OBz, C(O)NHC1-4alkyl, C(O)NHC1-4alkylaryl such as C(O)NHBz, an Fmoc group, C(O)C1-4haloalkyl, C(O)OC1-4haloalkyl or C(O)NHC1-4 haloalkyl such as C(O)OtBu. Suitably, any nitrogen atom in the C3-6heterocycloalkyl ring is not substituted. In an eighth embodiment, R4 and R5 together with the carbon atom to which they are attached form a C3-6cycloalkyl or C3-6heterocycloalkyl ring. Suitably R4 and R5 together with the carbon atom to which they are attached form a C3-6cycloalkyl ring, such as a cyclopropyl, cyclobutyl, cyclopentyl or cyclohexyl ring. Suitably R4 and R5 together with the carbon atom to which they are attached form a C3-6heterocycloalkyl ring, such as a heterocyclopropyl, heterocyclobutyl, heterocyclopentyl or heterocyclohexyl ring. Suitably, the heterocyclopentyl ring is tetrahydrofuranyl or pyrrolidinyl. Suitably, the heterocyclohexyl ring is tetrahydropyranyl or piperidinyl. Any nitrogen atom such as one nitrogen atom in the C3-6heterocycloalkyl ring may be substituted, for example by C1-4alkyl, C(O)H, C(O)C1-4alkyl, C(O)OC1-4alkyl, C(O)OC1-4alkylaryl such as C(O)OBz, C(O)NHC1-4alkyl, C(O)NHC1-4alkylaryl such as C(O)NHBz, an Fmoc group, C(O)C1-4haloalkyl, C(O)OC1-4haloalkyl or C(O)NHC1-4haloalkyl such as C(O)OtBu. Suitably, any nitrogen atom in the C3-6heterocycloalkyl ring is not substituted.


Suitably R4 is H, CH3 or ethyl, in particular CH3 or ethyl. Suitably, R4 and R5 together with the carbon atom to which they are attached form a C3-6cycloalkyl ring, such as a cyclopropyl ring.


In one embodiment, R5 is H. In a second embodiment R5 is C1-6alkyl such as C1-4alkyl, i.e. methyl, ethyl, propyl (n-propyl or isopropyl) or butyl (n-butyl, isobutyl, sec-butyl or tert-butyl). R5 may also be pentyl (e.g. n-pentyl, sec-pentyl, 3-pentyl, sec-isopentyl and active pentyl) or hexyl (e.g. n-hexyl, 2-methylpentyl, 3-methylpentyl, 2,2-dimethylbutyl and 2,3-dimethylbutyl). In a third embodiment, R5 is C0-2alkyleneC3-6cycloalkyl such as C0-2alkyleneC3-5cycloalkyl, such as C0-2alkyleneC3cycloalkyl, C0-2alkyleneC4cycloalkyl, C0-2alkyleneC5cycloalkyl, C0alkyleneC3-5cycloalkyl, C1alkyleneC3-5cycloalkyl and C2alkyleneC3-5cycloalkyl. R5 may also be C0-2alkyleneC6cycloalkyl, C0alkyleneC3-6cycloalkyl, C1alkyleneC3-6cycloalkyl and C2alkyleneC3-6cycloalkyl. In a fourth embodiment R5 is C1-3alkyleneOC1-3alkyl, in particular C1-2alkyleneOC1-2 alkyl such as C1alkyleneOC1alkyl, C2alkyleneOC1alkyl, C1alkyleneOC2alkyl or C2alkyleneOC2alkyl. In a fifth embodiment R5 is C1-6alkylOH such as C1-4alkylOH such as C1alkylOH, C2alkylOH, C3alkylOH or C4alkylOH wherein C1-4alkyl is methyl, ethyl, propyl (n-propyl or isopropyl) and butyl (n-butyl, isobutyl, sec-butyl or tert-butyl). R5 may also be C5alkylOH or C6alkylOH. In a sixth embodiment, R5 is C1-6haloalkyl such as C1-4haloalkyl such as C1haloalkyl (e.g. CF3), C2haloalkyl (e.g. CH2CF3), C3haloalkyl (e.g. CH2CH2CF3), C4haloalkyl (e.g. CH2CH2CH2CF3). R5 may also be C3haloalkyl (e.g. CH2CH2CH2CH2CF3) or C6haloalkyl (e.g. CH2CH2CH2CH2CH2CF3). In a seventh embodiment, R5 is C0-2alkyleneC3-6heterocycloalkyl such as C0-2alkyleneC3heterocycloalkyl, C0-2alkyleneC4heterocycloalkyl, C0-2alkyleneC5heterocycloalkyl, C0-2alkyleneC6heterocycloalkyl, C0alkyleneC3-6heterocycloalkyl, C1alkyleneC3-6heterocycloalkyl and C2alkyleneC3-6heterocycloalkyl. Suitably the heterocycloalkyl is a heterocyclopropyl, heterocyclobutyl, heterocyclopentyl or heterocyclohexyl ring such as a heterocyclohexyl ring. Suitably, the heterocyclopentyl ring is tetrahydrofuranyl or pyrrolidinyl. Suitably, the heterocyclohexyl ring is tetrahydropyranyl or piperidinyl. Any nitrogen atom such as one nitrogen in the C3-6heterocycloalkyl ring may be substituted, for example by C1-4alkyl, C(O)H, C(O)C1-4alkyl, C(O)OC1-4alkyl, C(O)OC1-4alkylaryl such as C(O)OBz, C(O)NHC1-4alkyl, C(O)NHC1-4alkylaryl such as C(O)NHBz, an Fmoc group, C(O)C1-4haloalkyl, C(O)OC1-4haloalkyl or C(O)NHC1-4haloalkyl such as C(O)OtBu. Suitably, any nitrogen atom in the C3-6heterocycloalkyl ring is not substituted.


Suitably R5 is H, CH3 or ethyl, in particular CH3 or ethyl. Suitably, R4 and R5 together with the carbon atom to which they are attached form a C3-6cycloalkyl ring, such as a cyclopropyl ring. Suitably R4 is H, CH3 or ethyl and R5 is H, CH3 or ethyl, in particular R4 is CH3 or ethyl and R5 is CH3 or ethyl. For example, R4 and R5 are H, R4 and R5 are methyl or R4 and R5 are ethyl.


Suitably, R4 is CH2CH2OCH3 and R5 is H.


In one embodiment, R6 is H. In another embodiment, R6 is C1-3alkyl, in particular CH3.


In one embodiment Ar1 is a 6-membered aryl, i.e. phenyl. In a second embodiment Ar1 is a 6-membered heteroaryl, in particular containing one nitrogen atom (pyridyl) or two nitrogen atoms (pyridazinyl, pyrimidinyl or pyrazinyl).


In particular Ar1 is phenyl or 2-pyridyl, such as phenyl. The position numbering for Ar1 is in respect of the amide, with the carbon at the point of attachment designated position 1 and other numbers providing the relative location of the nitrogen atoms, for example:




embedded image


In one embodiment R10 is H. In a second embodiment R10 is halo, for example fluoro or chloro. In a third embodiment R10 is C1-3alkyl, i.e. CH3, ethyl or propyl (e.g. n-propyl or iso-propyl). In a fourth embodiment R10 is OC1-2alkyl, such as OCH3 or ethoxy. In a fifth embodiment, R10 is C1-2haloalkyl, such as CF3 or CH2CF3. In a sixth embodiment R10 is OC1-2haloalkyl, such as OCF3. In a seventh embodiment R10 is CN.


Suitably R10 is H, fluoro, OCH3, CH3 or CF3, in particular H or fluoro, especially H.


Suitably R10 is attached at the ortho position of Ar1 relative to the amide (i.e. proximal to the amide).


In one embodiment R11 is H. In a second embodiment R11 is F. In a third embodiment, R11 is Cl. In a fourth embodiment R11 is CH3. In a fifth embodiment R11 is CH2CH3. In a sixth embodiment R11 is OCH3. In a seventh embodiment R11 is CF3. In an eighth embodiment R11 is OCF3. In a ninth embodiment R11 is CN.


In one embodiment, R11 is in the ortho position relative to the amide. In another embodiment, R11 is in the meta position relative to the amide.


In one embodiment Ar2 is a 6-membered aryl, i.e. phenyl. In a second embodiment Ar2 is a 6-membered heteroaryl, in particular containing one nitrogen atom (pyridyl) or two nitrogen atoms (pyridazinyl, pyrimidinyl or pyrazinyl).


The position numbering for Ar2 is in respect of the point of attachment to Ar1, for example:




embedded image


In particular Ar2 is 3-pyridyl or 2,5-pyrazinyl, especially 2,5-pyrazinyl.


In one embodiment R12 is H. In a second embodiment R12 is halo, for example fluoro or chloro. In a third embodiment R12 is C1-4alkyl, i.e. methyl, ethyl, propyl (n-propyl or isopropyl) or butyl (n-butyl, isobutyl, sec-butyl or tert-butyl). In a fourth embodiment, R12 is C2-4alkynyl such as C2alkynyl (i.e. C≡CH). In a fifth embodiment, R12 is C(═O)C1-2alkyl, such as C(═O)C1alkyl or C(═O)C2alkyl. In a sixth embodiment R12 is OC0-2alkyleneC3-5cycloalkyl, such as OC3-5cycloalkyl (e.g. cyclopropoxy or cyclobutoxy), OC1alkyleneC3-5cycloalkyl or OC2alkyleneC3-5cycloalkyl. In a seventh embodiment R12 is OC1-4alkyl, such as OCH3, ethoxy, iso-propoxy or n-propoxy. In an eighth embodiment, R12 is C1-3alkyleneOC1-3alkyl in particular C1-2alkyleneOC1-2alkyl such as C1alkyleneOC1alkyl, C2alkyleneOC1alkyl, C1alkyleneOC2alkyl or C2alkyleneOC2alkyl. In a ninth embodiment R12 is C1-4haloalkyl, such as CF3. In a tenth embodiment R12 is OC1-4haloalkyl, such as OCF3, OCHF2 or OCH2CF3. In an eleventh embodiment R12 is CN. In an eleventh embodiment R12 is OC0-2alkyleneC3-5cycloalkyl, such as OC3-5cycloalkyl (e.g. cyclopropoxy or cyclobutoxy), OC1alkyleneC3-5cycloalkyl or OC2alkyleneC3-5cycloalkyl. In a twelfth embodiment R12 is OCH2CH2N(CH3)2. In a thirteenth embodiment R12 is OH. In a fourteenth embodiment R12 is C1-4alkylOH, such as CH2OH or C(CH3)2OH. In a fifteenth embodiment R12 is NR23R24. In a sixteenth embodiment R12 is SO2CH3. In a seventeenth embodiment R12 is C(O)N(CH3)2. In an eighteenth embodiment R12 is NHC(O)C1-3alkyl such as NHC(O)CH3. In a nineteenth embodiment R12 is a C3-6heterocycloalkyl comprising (such as containing) one nitrogen located at the point of attachment to Ar2, such as a C5heterocycloalkyl, in particular pyrrolidinyl, or a C6heterocycloalkyl such as morpholinyl. In a twentieth embodiment, R12 together with a nitrogen atom to which it is attached forms an N-oxide (N+—O).


In one embodiment, R23 is H. In another embodiment, R23 is C1-2alkyl i.e. CH3 or CH2CH3.


In one embodiment, R24 is H. In another embodiment, R24 is C1-2alkyl i.e. CH3 or CH2CH3.


R12 is suitably H, fluoro, chloro, CH3, Et, OCH3, OEt, OiPr, CF3 or OCH2CF3. In particular, R12 is fluoro, chloro, CH3, OCH3, OEt, OiPr or CF3, for example chloro, OEt, OiPr or CF3 such as chloro, OEt or CF3.


R12 is suitably attached at the meta position of Ar2. Alternatively, R12 is attached at the ortho position of Ar2.


The present invention provides N-oxides of the compound of formula (I). Suitably, when R12 together with a nitrogen atom to which it is attached forms an N-oxide (N+—O), the example following structures are formed:




embedded image


Throughout the specification Ar1 and Ar2 may be depicted as follows:




embedded image


Ar1 may also be depicted as follows:




embedded image


All depictions with respect to Ar1 are equivalent and all depictions with respect to Ar2 are equivalent, unless the context requires otherwise, depictions of Ar1 and Ar2 should not be taken to exclude the presence of heteroatoms or substitutions.


The present invention provides the compounds described in any one of Examples R1 to R71.


The present invention also provides the compounds described in any one of Examples R72 to R93.


The present invention provides the following compounds:

  • N-((2-(cyclopropanesulfonamido)thiazol-4-yl)methyl)-5-phenylpicolinamide;
  • N-((2-(cyclopropanesulfonamido)thiazol-4-yl)methyl)-4-(pyridin-3-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(5-(trifluoromethyl)pyridin-3-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(5-(trifluoromethyl)pyridin-3-yl)benzamide (R enantiomer);
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(5-(trifluoromethyl)pyridin-3-yl)benzamide (S enantiomer);
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(6-ethoxypyrazin-2-yl)-2-fluorobenzamide;
  • N-(2-(2-(cyclopropanesuIfonamido)thiazol-4-yl)propan-2-yl)-4-(6-ethoxypyrazin-2-yl)-2-methoxybenzamide;
  • N-((2-(cyclopropanesulfonamido)thiazol-4-yl)methyl)-[1,1′-biphenyl]-4-carboxamide;
  • N-((2-(cyclopropanesulfonamido)thiazol-4-yl)methyl)-2-fluoro-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • N-((2-(cyclopropanesuIfonamido)thiazol-4-yl)methyl)-4-(6-ethoxypyrazin-2-yl)-2-fluorobenzamide;
  • N-((2-(cyclopropanesulfonamido)thiazol-4-yl)methyl)-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • N-((2-(cyclopropanesulfonamido)thiazol-4-yl)methyl)-4-(6-isopropoxypyrazin-2-yl)benzamide;
  • N-((2-(cyclopropanesulfonamido)thiazol-4-yl)methyl)-4-(6-ethoxypyrazin-2-yl)benzamide;
  • N-(3-(2-(cyclopropanesulfonamido)thiazol-4-yl)pentan-3-yl)-4-(5-(trifluoromethyl)pyridin-3-yl)benzamide;
  • N-(3-(2-(cyclopropanesulfonamido)thiazol-4-yl)pentan-3-yl)-4-(5-fluoropyridin-3-yl)benzamide;
  • N-(3-(2-(cyclopropanesulfonamido)thiazol-4-yl)pentan-3-yl)-4-(5-methylpyridin-3-yl)benzamide;
  • N-(3-(2-(cyclopropanesulfonamido)thiazol-4-yl)pentan-3-yl)-4-(pyridin-3-yl)benzamide;
  • N-(3-(2-(cyclopropanesulfonamido)thiazol-4-yl)pentan-3-yl)-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • 4-(6-chloropyrazin-2-yl)-N-(3-(2-(cyclopropanesulfonamido)thiazol-4-yl)pentan-3-yl)benzamide;
  • N-(3-(2-(cyclopropanesulfonamido)thiazol-4-yl)pentan-3-yl)-4-(6-methylpyrazin-2-yl)benzamide;
  • N-(3-(2-(cyclopropanesulfonamido)thiazol-4-yl)pentan-3-yl)-4-(pyrazin-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesuIfonamido)thiazol-4-yl)propan-2-yl)-5-(6-ethoxypyrazin-2-yl)-3-fluoropicolinamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-5-(6-(trifluoromethyl)pyrazin-2-yl)picolinamide;
  • 5-(6-chloropyrazin-2-yl)-N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)picolinamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-5-(6-ethoxypyrazin-2-yl)picolinamide;
  • N-(2-(2-(cyclopropanesuIfonamido)thiazol-4-yl)propan-2-yl)-[2,2′-bipyridine]-5-carboxamide;
  • 4-(5-chloropyridin-3-yl)-N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-2-fluoro-4-(5-(trifluoromethyl)pyridin-3-yl)benzamide;
  • 4-(5-chloropyridin-3-yl)-N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-2-fluorobenzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-2-fluoro-4-(5-fluoropyridin-3-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-2-methoxy-4-(5-(trifluoromethyl)pyridin-3-yl)benzamide;
  • 4-(5-acetylpyridin-3-yl)-N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(5-(trifluoromethyl)pyridin-3-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(5-fluoropyridin-3-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(5-methylpyridin-3-yl)benzamide;
  • N-(2-(2-(cyclopropanesuIfonamido)thiazol-4-yl)propan-2-yl)-4-(5-methoxypyridin-3-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(pyridin-3-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-3′-(trifluoromethyl)-[1,1′-biphenyl]-4-carboxamide;
  • N-(2-(2-(cyclopropanesuIfonamido)thiazol-4-yl)propan-2-yl)-4-(6-ethylpyrazin-2-yl)-2-fluorobenzamide;
  • N-(2-(2-(cyclopropanesuIfonamido)thiazol-4-yl)propan-2-yl)-2-fluoro-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-2-fluoro-4-(6-isopropoxypyrazin-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesuIfonamido)thiazol-4-yl)propan-2-yl)-2-fluoro-4-(6-(2,2,2-trifluoroethoxy)pyrazin-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-2-methyl-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesuIfonamido)thiazol-4-yl)propan-2-yl)-4-(6-ethoxypyrazin-2-yl)-2-methylbenzamide;
  • N-(2-(2-(cyclopropanesuIfonamido)thiazol-4-yl)propan-2-yl)-4-(6-ethoxypyrazin-2-yl)-2-(trifluoromethyl)benzamide;
  • N-(2-(2-(cyclopropanesuIfonamido)thiazol-4-yl)propan-2-yl)-2-methoxy-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • 4-(6-chloropyrazin-2-yl)-N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-2-methoxybenzamide;
  • 4-(6-cyanopyrazin-2-yl)-N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-2-methoxybenzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • 4-(6-chloropyrazin-2-yl)-N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(6-methylpyrazin-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(6-methoxypyrazin-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(6-ethoxypyrazin-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(6-isopropoxypyrazin-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesuIfonamido)thiazol-4-yl)propan-2-yl)-4-(6-(2,2,2-trifluoroethoxy)pyrazin-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(pyrazin-2-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(5-fluoropyridin-3-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(5-methylpyridin-3-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(pyridin-3-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(6-ethoxypyrazin-2-yl)-2-fluorobenzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(6-ethoxypyrazin-2-yl)-2-fluoro-N-methylbenzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-2-fluoro-4-(6-isopropoxypyrazin-2-yl)benzamide;
  • 4-(6-chloropyrazin-2-yl)-N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(6-methylpyrazin-2-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(pyrazin-2-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(5-fluoropyridin-3-yl)benzamide (R enantiomer);
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(5-fluoropyridin-3-yl)benzamide (S enantiomer);
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(6-ethoxypyrazin-2-yl)-2-fluorobenzamide (R enantiomer); and
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(6-ethoxypyrazin-2-yl)-2-fluorobenzamide (S enantiomer);


or a salt and/or solvate thereof and/or derivative thereof.


The invention also provides the following compounds:

  • N-(2-(2-(cyclopropanesuIfonamido)-5-methylthiazol-4-yl)propan-2-yl)-5-(6-ethoxypyrazin-2-yl)picolinamide;
  • N-(2-(5-chloro-2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-5-(6-ethoxypyrazin-2-yl)picolinamide;
  • N-(2-(2-(cyclopropanesulfonamido)-5-methylthiazol-4-yl)propan-2-yl)-4-(6-ethoxypyrazin-2-yl)-2-fluorobenzamide;
  • N-(2-(5-chloro-2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(6-ethoxypyrazin-2-yl)-2-fluorobenzamide;
  • N-(2-(2-(cyclopropanesuIfonamido)-5-methylthiazol-4-yl)propan-2-yl)-2-methyl-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • N-(2-(5-chloro-2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-2-methyl-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • N-(2-(2-(cyclopropanesuIfonamido)-5-methylthiazol-4-yl)propan-2-yl)-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • N-(2-(5-chloro-2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)cyclopropyl)-5-(6-ethoxypyrazin-2-yl)picolinamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)cyclopropyl)-4-(pyridin-3-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)cyclopropyl)-4-(6-ethoxypyrazin-2-yl)-2-fluorobenzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)cyclopropyl)-2-methyl-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)cyclopropyl)-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)-3-methoxypropyl)-4-(5-fluoropyridin-3-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)-3-methoxypropyl)-4-(6-ethylpyrazin-2-yl)-2-fluorobenzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)-3-methoxypropyl)-2-fluoro-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)-3-methoxypropyl)-4-(6-ethoxypyrazin-2-yl)-2-fluorobenzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)-3-methoxypropyl)-2-fluoro-4-(6-isopropoxypyrazin-2-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)-3-methoxypropyl)-4-(6-ethoxypyrazin-2-yl)benzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)ethyl)-4-(6-ethoxypyrazin-2-yl)-2-fluorobenzamide;
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)-3-methoxypropyl)-4-(6-ethoxypyrazin-2-yl)-2-fluorobenzamide (R enantiomer); and
  • N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)-3-methoxypropyl)-4-(6-ethoxypyrazin-2-yl)-2-fluorobenzamide (S enantiomer);


or a salt and/or solvate thereof and/or derivative thereof.


The compounds of the invention may be provided in the form of a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof. In particular, the compound of formula (I) may be provided in the form of a pharmaceutically acceptable salt and/or solvate, such as a pharmaceutically acceptable salt.


Compounds of the invention of particular interest are those demonstrating an IC50 of 1 uM or lower, especially 100 nM or lower, in respect of CTPS1 enzyme, using the methods of the examples (or comparable methods).


Compounds of the invention of particular interest are those demonstrating a selectivity for CTPS1 over CTPS2 of 2-30 fold, suitably>30-60 fold or more suitably>60 fold, using the methods of the examples (or comparable methods).


It will be appreciated that for use in medicine the salts of the compounds of formula (I) should be pharmaceutically acceptable. Non-pharmaceutically acceptable salts of the compounds of formula (I) may be of use in other contexts such as during preparation of the compounds of formula (I). Suitable pharmaceutically acceptable salts will be apparent to those skilled in the art. Pharmaceutically acceptable salts include those described by Berge et al. (1977). Such pharmaceutically acceptable salts include acid and base addition salts. Pharmaceutically acceptable acid additional salts may be formed with inorganic acids e.g. hydrochloric, hydrobromic, sulfuric, nitric or phosphoric acid and organic acids e.g. succinic, maleic, acetic, fumaric, citric, tartaric, benzoic, p-toluenesulfonic, methanesulfonic or naphthalenesulfonic acid. Other salts e.g. oxalates or formates, may be used, for example in the isolation of compounds of formula (I) and are included within the scope of this invention.


Certain compounds of formula (I) form acid or base addition salts with one or more equivalents of the acid or base. The present invention includes within its scope all possible stoichiometric and non-stoichiometric forms.


The compounds of formula (I) may be prepared in crystalline or non-crystalline form and, if crystalline, may optionally be solvated, e.g. as the hydrate. This invention includes within its scope stoichiometric solvates (e.g. hydrates) as well as compounds containing variable amounts of solvent (e.g. water).


It will be understood that the invention includes pharmaceutically acceptable derivatives of compounds of formula (I) and that these are included within the scope of the invention.


As used herein “pharmaceutically acceptable derivative” includes any pharmaceutically acceptable prodrug such as an ester or salt of such ester of a compound of formula (I) which, upon administration to the recipient is capable of providing (directly or indirectly) a compound of formula (I) or an active metabolite or residue thereof.


It is to be understood that the present invention encompasses all isomers of formula (I) and their pharmaceutically acceptable derivatives, including all geometric, tautomeric and optical forms, and mixtures thereof (e.g. racemic mixtures). Where additional chiral centres are present in compounds of formula (I), the present invention includes within its scope all possible diastereoisomers, including mixtures thereof. The different isomeric forms may be separated or resolved one from the other by conventional methods, or any given isomer may be obtained by conventional synthetic methods or by stereospecific or asymmetric syntheses.


The present disclosure includes all isotopic forms of the compounds of the invention provided herein, whether in a form (i) wherein all atoms of a given atomic number have a mass number (or mixture of mass numbers) which predominates in nature (referred to herein as the “natural isotopic form”) or (ii) wherein one or more atoms are replaced by atoms having the same atomic number, but a mass number different from the mass number of atoms which predominates in nature (referred to herein as an “unnatural variant isotopic form”). It is understood that an atom may naturally exist as a mixture of mass numbers. The term “unnatural variant isotopic form” also includes embodiments in which the proportion of an atom of given atomic number having a mass number found less commonly in nature (referred to herein as an “uncommon isotope”) has been increased relative to that which is naturally occurring e.g. to the level of >20%, >50%, >75%, >90%, >95% or >99% by number of the atoms of that atomic number (the latter embodiment referred to as an “isotopically enriched variant form”). The term “unnatural variant isotopic form” also includes embodiments in which the proportion of an uncommon isotope has been reduced relative to that which is naturally occurring. Isotopic forms may include radioactive forms (i.e. they incorporate radioisotopes) and non-radioactive forms. Radioactive forms will typically be isotopically enriched variant forms.


An unnatural variant isotopic form of a compound may thus contain one or more artificial or uncommon isotopes such as deuterium (2H or D), carbon-11 (11C), carbon-13 (13C), carbon-14 (14C), nitrogen-13 (13N), nitrogen-15 (15N), oxygen-15 (15O), oxygen-17 (17O), oxygen-18 (18O), phosphorus-32 (32P), sulphur-35 (35S), chlorine-36 (36Cl), chlorine-37 (37Cl), fluorine-18 (18F) iodine-123 (123I), iodine-125 (125I) in one or more atoms or may contain an increased proportion of said isotopes as compared with the proportion that predominates in nature in one or more atoms.


Unnatural variant isotopic forms comprising radioisotopes may, for example, be used for drug and/or substrate tissue distribution studies. The radioactive isotopes tritium, i.e. 3H, and carbon-14, i.e. 14C, are particularly useful for this purpose in view of their ease of incorporation and ready means of detection. Unnatural variant isotopic forms which incorporate deuterium i.e 2H or D may afford certain therapeutic advantages resulting from greater metabolic stability, for example, increased in vivo half-life or reduced dosage requirements, and hence may be preferred in some circumstances. Further, unnatural variant isotopic forms may be prepared which incorporate positron emitting isotopes, such as 11C, 18F, 15O and 13N, and would be useful in Positron Emission Topography (PET) studies for examining substrate receptor occupancy.


In one embodiment, the compounds of the invention are provided in a natural isotopic form.


In one embodiment, the compounds of the invention are provided in an unnatural variant isotopic form. In a specific embodiment, the unnatural variant isotopic form is a form in which deuterium (i.e. 2H or D) is incorporated where hydrogen is specified in the chemical structure in one or more atoms of a compound of the invention. In one embodiment, the atoms of the compounds of the invention are in an isotopic form which is not radioactive. In one embodiment, one or more atoms of the compounds of the invention are in an isotopic form which is radioactive. Suitably radioactive isotopes are stable isotopes. Suitably the unnatural variant isotopic form is a pharmaceutically acceptable form.


In one embodiment, a compound of the invention is provided whereby a single atom of the compound exists in an unnatural variant isotopic form. In another embodiment, a compound of the invention is provided whereby two or more atoms exist in an unnatural variant isotopic form.


Unnatural isotopic variant forms can generally be prepared by conventional techniques known to those skilled in the art or by processes described herein e.g. processes analogous to those described in the accompanying Examples for preparing natural isotopic forms. Thus, unnatural isotopic variant forms could be prepared by using appropriate isotopically variant (or labelled) reagents in place of the normal reagents employed in the Examples. Since the compounds of formula (I) are intended for use in pharmaceutical compositions it will readily be understood that they are each preferably provided in substantially pure form, for example at least 60% pure, more suitably at least 75% pure and preferably at least 85%, especially at least 98% pure (% are on a weight for weight basis). Impure preparations of the compounds may be used for preparing the more pure forms used in the pharmaceutical compositions.


In general, the compounds of formula (I) may be made according to the organic synthesis techniques known to those skilled in this field, as well as by the representative methods set forth below, those in the Examples, and modifications thereof.


General Routes


Generic routes by which compound examples of the invention may be conveniently prepared are summarised below.




embedded image


The thiazol-4-yl(propan-2-yl)benzamide derivatives of formula (I) in which R1, R3, R4, R5, Ar1 and Ar2 are defined above may be prepared as shown in Scheme 1 by sulfonation of the commercial amine such as (VII) followed by double Grignard addition to ethyl 2-(cyclopropanesulfonamido)thiazole-4-carboxylate (VI) in an aprotic solvent such as THE to form intermediates of formula (V). A Ritter type reaction may then be undertaken using an alkylnitrile, such as 2-chloroacetonitrile in the presence of an acid such as H2SO4. This intermediate of formula (IV) can be deprotected by reaction with thiourea in a protic solvent such as ethanol in the presence of acetic acid and heated under reflux to yield the free benzylamine derivative (II). A carboxylic acid precursor (Ill) (commercially available or prepared in two steps, as in Scheme 4) is reacted with an activating agent such as HATU, T3P or Ghosez's reagent (1-chloro-N,N,2-trimethylprop-1-en-1-amine), to generate a reactive, electrophilic carboxylic acid derivative, followed by subsequent reaction with benzylamine of formula (II), to yield the desired amide derivative of general formula (I).




embedded image


The thiazol-4-yl(propan-2-yl)benzamide derivatives of formula (I) in which R1, R3, R4, Ar1 and Ar2 are defined above may be prepared by two different routes as shown in Scheme 2. The two routes then converge at compounds of general formula (IX) where they are then taken on to the final analogues by a two-step process.


ROUTE A: Reduction of the ester of general formula (VI) using a reducing agent such as DIBAL-H yields the aldehyde of general formula (IX) (R4 is H). It will be understood by persons skilled in the art that such reactions need to be carefully controlled to avoid over-reduction.


ROUTE B: The alkyl ester of formula (VI) may be conveniently hydrolysed by exposure to a suitable inorganic base, for example lithium hydroxide, in an aqueous mixture of aprotic and protic solvents, such as THF:methanol:water. The carboxylic acid derivative (XI) can then be converted to the Weinreb amide by employing a coupling agent, for example, HATU in the presence of a suitable base, such as DIPEA in a solvent such as DMF. The Weinreb amide derivative (X) can then be exposed to a nucleophile such as EtMgBr in an aprotic solvent such as THE to yield the corresponding ketone of the general formula (IX).


A reductive amination may be undertaken using (2,4-dimethoxyphenyl)methanamine and a reducing agent such as sodium triacetoxyborohydride (STAB). This reaction can be carried out on the ketone of general formula (IX) (when R4 is other than H) or the aldehyde of general formula (IX) (when R4 is H), if the des-alkyl linker is desired. The intermediate of formula (VIII) may then be deprotected using a strong acid, such as TFA. Such reactions may be heated to 70° C. to yield the free benzylamine derivative (11). An amide coupling can then be undertaken as in Scheme 1.




embedded image


Compounds of formula (XIII) may be obtained by a general process as shown in Scheme 3 whereby a carboxylic acid precursor (XIV) is reacted with an activating agent such as HATU, T3P or Ghosez's reagent, to generate a reactive, electrophilic carboxylic acid derivative, followed by subsequent reaction with an amine of formula (II). Intermediates of formula (XIII) are then converted to a compound of general formula (I) by coupling under Suzuki conditions with an aromatic halide of general formula (XII), of which X is defined in Scheme 3 and represents a dihydroxyboryl or dialkyloxyboryl group, such as a 4,4,5,5-tetramethyl-1,3,3,2-dioxaborolan-2-yl group. The couplings according to the Suzuki method are performed, for example, by heating in the presence of a catalyst such as bis(diphenylphosphino)ferrocene]dichloropalladium(II).CH2Cl2 adduct and an inorganic base such as potassium carbonate in a solvent mixture of dioxane and water under an inert atmosphere such as a nitrogen atmosphere. It will be understood by persons skilled in the art that many catalysts and conditions can be employed for such couplings.




embedded image


Intermediates of formula (III) where Ar2 is an unsubstituted or substituted 2-pyrazine ring or 3-pyridyl ring, may be synthesised as shown in Scheme 4 by coupling under Suzuki conditions of an aromatic halide of general formula (XII), of which R10 and R12 are defined above and Z represents a halide such as Br or Cl, to a boronate of general formula (XVI) where X denotes a dihydroxyboryl or dialkyloxyboryl group, such as a 4,4,5,5-tetramethyl-1,3,3,2-dioxaborolan-2-yl group. The couplings according to the Suzuki method are performed, for example, by heating in the presence of a catalyst such as [1,1′-bis(diphenylphosphino)ferrocene]dichloropalladium(II).CH2Cl2 adduct and an inorganic base such as cesium carbonate in a solvent mixture of dioxane and water under an inert atmosphere such as a nitrogen atmosphere. The carboxylic acids of general formula (III) are obtained by either deprotection of the t-butyl ester using a strong acid, such as TFA in a solvent of CH2Cl2, hydrolysis of the methyl ester using an alkali metal hydroxide such as NaOH in a solvent mixture such as THF/MeOH or hydrolysis of the nitrile using a strong acid such as concentrated HCl. Compounds of formula (Ill-A) may also be made using this method.




embedded image


The thiazol-4-yl(propan-2-yl)benzamide derivatives of formula (I) in which R1, R3, R4, R5, Ar1 and Ar2 are defined above may be prepared by the route as shown in Scheme 5. Intermediate 2-bromthiazole esters of general formula (XVII) can be mono or bis-alkylated by alkyl halides such as 1-bromo-2-methoxyethane in the presence of a strong base such as sodium hydride to yield esters of general formula (XVIII) which may be conveniently hydrolysed by exposure to a suitable inorganic base, for example lithium hydroxide, in an aqueous mixture of aprotic and protic solvents, such as THF:methanol:water. The intermediate acyl azide, which may be formed from carboxylate (XIX) and diphenylphosphoryl azide in toluene and tert-butanol in the presence of a weak base such as trimethylamine undergoes a Curtius rearrangement at elevated temperatures such as 100° C. to yield an isocyanate that reacts with the alcohol present to give the carbamate protected amines of formula (XX). Palladium catalysed sulfonamidation of intermediate (XX) may be achieved using a catalytic system such as [Pd(allyl)Cl]2 and a phosphine mono-dentate ligand such as t-BuXPhos in the presence of a primary sulphonamide to obtain compounds of the formula (XXI).


The intermediate of formula (XXI) may then be deprotected using a strong acid, such as HCl to yield the free benzylamine derivatives of formula (II) or salts thereof such as HCl salts. An amide coupling can then be undertaken as in Scheme 1 to give compounds of formula (I).


Intermediates of the Invention


The present invention also relates to novel intermediates in the synthesis of compounds of formula (I) such as compounds of formula (II)-(XXI) such as (II)-(XVI). Particular intermediates of interest are those of the following general formulae, wherein the variable groups and associated preferences are as defined previously for compounds of formula (I):

    • a compound of formula (II):




embedded image




    • a compound of formula (III):







embedded image



and

    • a compound of formula (VIII):




embedded image


Also of interest are compounds of formula (III-A):




embedded image


Suitably, the intermediate is not:




embedded image


Suitably, at least one of R10, R11 and R12 is other than H.


Included as an aspect of the invention are all novel intermediates described in the examples, including:

    • Intermediates INTE1 to INTE20; and
    • Intermediates INTF1 to INTF53.


Also included as an aspect of the invention are all novel intermediates described in the examples, including:

    • Intermediates INTE21 to INTE39.


Included as an aspect of the invention are salts such as pharmaceutically acceptable salts of any one of the intermediates disclosed herein, such as any one of compounds of formulae (II)-(XXI).


Therapeutic Methods


Compounds of formula (I) of the present invention have utility as inhibitors of CTPS1.


Suitably, the compounds of formula (I) of the present invention are selective for CTPS1 over CTPS2.


Therefore, the invention also provides a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate (e.g. salt) and/or derivative thereof, for use as a medicament, in particular in the treatment or prophylaxis of a disease or disorder wherein an inhibitor of CTPS1 is beneficial, for example those diseases and disorders mentioned herein below.


The invention provides a method for the treatment or prophylaxis of a disease or disorder wherein an inhibitor of CTPS1 is beneficial, for example those diseases and disorders mentioned herein below, which comprises administering to a subject in need thereof an effective amount of a compound of formula (I) or a pharmaceutically acceptable salt and/or solvate (e.g. salt) and/or derivative thereof.


The invention also provides the use of a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate thereof (e.g. salt) and/or derivative, in the manufacture of a medicament for the treatment or prophylaxis of a disease or disorder wherein an inhibitor of CTPS1 is beneficial, for example those diseases and disorders mentioned herein below.


More suitably, the disease or disorder wherein an inhibitor of CTPS1 is beneficial is a disease or disorder wherein a reduction in T-cell and/or B-cell proliferation would be beneficial.


The invention also provides a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate (e.g. salt) and/or derivative thereof, for use in the inhibition of CTPS1 in a subject.


The invention provides a method for the inhibition of CTPS1 in a subject, which comprises administering to the subject an effective amount of a compound of formula (I) or a pharmaceutically acceptable salt and/or solvate (e.g. salt) and/or derivative thereof.


The invention also provides the use of a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate thereof (e.g. salt) and/or derivative, in the manufacture of a medicament for the inhibition of CTPS1 in a subject.


The invention also provides a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate (e.g. salt) and/or derivative thereof, for use in the reduction of T-cell and/or B-cell proliferation in a subject.


The invention provides a method for the reduction of T-cell and/or B-cell proliferation in a subject, which comprises administering to the subject an effective amount of a compound of formula (I) or a pharmaceutically acceptable salt and/or solvate (e.g. salt) and/or derivative thereof.


The invention also provides the use of a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate thereof (e.g. salt) and/or derivative, in the manufacture of a medicament for the reduction of T-cell and/or B-cell proliferation in a subject.


More suitably, the disease or disorder wherein an inhibitor of CTPS1 is beneficial is a disease or disorder wherein a reduction in T-cell and/or B-cell proliferation would be beneficial.


The term ‘treatment’ or ‘treating’ as used herein includes the control, mitigation, reduction, or modulation of the disease state or its symptoms.


The term ‘prophylaxis’ or ‘preventing’ is used herein to mean preventing symptoms of a disease or disorder in a subject or preventing recurrence of symptoms of a disease or disorder in an afflicted subject and is not limited to complete prevention of an affliction.


Suitably, the disease or disorder is selected from rejection of transplanted cells and tissues, Graft-related diseases or disorders, allergies and autoimmune diseases.


In one embodiment the disease or disorder is the rejection of transplanted cells and tissues. The subject may have been transplanted with a graft selected from the group consisting of heart, kidney, lung, liver, pancreas, pancreatic islets, brain tissue, stomach, large intestine, small intestine, cornea, skin, trachea, bone, bone marrow (or any other source of hematopoietic precursor cells and stem cells including hematopoietic cells mobilized from bone marrow into peripheral blood or umbilical cord blood cells), muscle, or bladder. The compounds of the invention may be of use in preventing or suppressing an immune response associated with rejection of a donor tissue, cell, graft or organ transplant in a subject.


In a further embodiment the disease or disorder is a Graft-related disease or disorder. Graft-related diseases or disorders include graft versus host disease (GVHD), such as GVHD associated with bone marrow transplantation, and immune disorders resulting from or associated with rejection of organ, tissue, or cell graft transplantation (e.g., tissue or cell allografts or xenografts), including, e.g., grafts of skin, muscle, neurons, islets, organs, parenchymal cells of the liver, etc, and Host-Versus-Graft-Disease (HVGD). The compounds of the invention may be of use in preventing or suppressing acute rejection of such transplant in the recipient and/or for long-term maintenance therapy to prevent rejection of such transplant in the recipient (e.g., inhibiting rejection of insulin-producing islet cell transplant from a donor in the subject recipient suffering from diabetes). Thus the compounds of the invention have utility in preventing Host-Versus-Graft-Disease (HVGD) and Graft-Versus-Host-Disease (GVHD).


A CTPS1 inhibitor may be administered to the subject before, after transplantation and/or during transplantation. In some embodiments, the CTPS1 inhibitor may be administered to the subject on a periodic basis before and/or after transplantation.


In another embodiment, the disease or disorder is an allergy.


In additional embodiments the immune related disease or disorder is an autoimmune disease. As used herein, an “autoimmune disease” is a disease or disorder directed at a subject's own tissues. Examples of autoimmune diseases include, but are not limited to Addison's Disease, Adult-onset Still's disease, Alopecia Areata, Alzheimer's disease, Anti-neutrophil Cytoplasmic Antibodies (ANCA)-Associated Vasculitis, Ankylosing Spondylitis, Anti-phospholipid Syndrome (Hughes' Syndrome), Aplastic Anemia, Arthritis, Asthma, Atherosclerosis, Atherosclerotic plaque, Atopic Dermatitis, Autoimmune Hemolytic Anemia, Autoimmune Hepatitis, Autoimmune Hypophysitis (Lymphocytic Hypophysitis), Autoimmune Inner Ear Disease, Autoimmune Lymphoproliferative Syndrome, Autoimmune Myocarditis, Autoimmune Neutropenia, Autoimmune Oophoritis, Autoimmune Orchitis, Auto-Inflammatory Diseases requiring an immunosuppressive treatment, Azoospermia, Bechet's Disease, Berger's Disease, Bullous Pemphigoid, Cardiomyopathy, Cardiovascular disease, Celiac disease including Refractory Celiac Disease (type I and type II), Chronic Fatigue Immune Dysfunction Syndrome (CFIDS), Chronic Idiopathic Polyneuritis, Chronic Inflammatory Demyelinating Polyneuropathy (CIPD), Chronic Relapsing Polyneuropathy (Guillain-Barre syndrome), Churg-Strauss Syndrome (CSS), Cicatricial Pemphigoid, Cold Agglutinin Disease (CAD), chronic obstructive pulmonary disease (COPD), CREST Syndrome, Cryoglobulin Syndromes, Cutaneous Lupus, Dermatitis Herpetiformis, Dermatomyositis, Eczema, Epidermolysis Bullosa Acquisita, Essential Mixed Cryoglobulinemia, Evan's Syndrome, Exophthalmos, Fibromyalgia, Goodpasture's Syndrome, Grave's disease, Hemophagocytic Lymphohistiocytosis (HLH) (including Type 1 Hemophagocytic Lymphohistiocytosis), Histiocytosis/Histiocytic Disorders, Hashimoto's Thyroiditis, Idiopathic Pulmonary Fibrosis, Idiopathic Thrombocytopenia Purpura (ITP), IgA Nephropathy, Immunoproliferative Diseases or Disorders, Inflammatory Bowel Disease (IBD), Interstitial Lung Disease, Juvenile Arthritis, Juvenile Idiopathic Arthritis (JIA), Kawasaki's Disease, Lambert-Eaton Myasthenic Syndrome, Lichen Planus, Localized Scleroderma, Lupus Nephritis, Menibre's Disease, Microangiopathic Hemoytic Anemia, Microscopic Polyangitis, Miller Fischer Syndrome/Acute Disseminated Encephalomyeloradiculopathy, Mixed Connective Tissue Disease, Multiple Sclerosis (MS), Muscular Rheumatism, Myalgic Encephalomyelitis (ME), Myasthenia Gravis, Ocular Inflammation, Pemphigus Foliaceus, Pemphigus Vulgaris, Pernicious Anemia, Polyarteritis Nodosa, Polychondritis, Polyglandular Syndromes (Whitaker's syndrome), Polymyalgia Rheumatica, Polymyositis, Primary Agammaglobulinemia, Primary Biliary Cirrhosis/Autoimmune Cholangiopathy, Primary Glomerulonephritis, Primary Sclerosing Cholangitis, Psoriasis, Psoriatic Arthritis, Pure Red Cell Anemia, Raynaud's Phenomenon, Reiter's Syndrome/Reactive Arthritis, Relapsing Polychondritis, Restenosis, Rheumatic Fever, Rheumatic Disease, Rheumatoid Arthritis, Sarcoidosis, Schmidt's Syndrome, Scleroderma/Systemic Sclerosis, Sjörgen's Syndrome, Stiff-Man Syndrome, The Sweet Syndrome (Febrile Neutrophilic Dermatosis), Systemic Lupus Erythematosus (SLE), Systemic Scleroderma, Takayasu Arteritis, Temporal Arteritis/Giant Cell Arteritis, Thyroiditis, Type 1 diabetes, Type 2 diabetes, Uveitis, Vasculitis, Vitiligo, Wegener's Granulomatosis, and X-linked lymphoproliferative disease.


Of particular interest are diseases and disorders which are mainly driven by T-cell activation and proliferation, including:

    • diseases and disorders which are not linked to alloreactivity including:
      • Alopecia areata, atopic dermatitis, eczema, psoriasis, lichen planus, psoriatic arthritis, vitiligo;
      • Uveitis;
      • Ankylosing spondylitis, Reiter's syndrome/reactive arthritis;
      • Aplastic anemia, autoimmune lymphoproliferative syndrome/disorders, hemophagocytic lymphohistiocytosis;
      • Type 1 diabetes; and
      • Refractory celiac disease;
    • Acute rejection of grafted tissues and transplanted organs; acute graft versus host disease (GVHD) after transplantation of bone marrow cells or any other source of allogenic cells including hematopoietic precursors cells and/or stem cells.


Also of interest are diseases and disorders which are driven by both T- and B-cell activation and proliferation, with an important involvement of B-cells, including:

    • diseases and disorders for which the involvement of pathogenic auto-antibodies is well characterized, including:
      • Allergy;
      • Cicatricial pemphigoid, bullous pemphigoid, epidermolysis bullosa acquisita, pemphigus foliaceus, pemphigus vulgaris, dermatitis herpetiformis;
      • ANCA-associated vasculitis and microscopic polyangitis, vasculitis, Wegener's granulomatosis; Churg-Strauss syndrome (CSS), polyarteritis nodosa, cryoglobulin syndromes and essential mixed cryglobulinemia;
      • Systemic lupus erythematosus (SLE), antiphospholipid syndrome (Hughes' syndrome), cutaneous lupus, lupus nephritis, mixed connective tissue disease;
      • Thyroiditis, Hashimoto thyroiditis, Grave's disease, exophthalmos;
      • Autoimmune hemolytic anemia, autoimmune neutropenia, ITP, pernicious anaemia, pure red cell anaemia, micro-angiopathic hemolytic anemia;
      • Primary glomerulonephritis, Berger's disease, Goodpasture's syndrome, IgA nephropathy; and
      • Chronic idiopathic polyneuritis, chronic inflammatory demyelinating polyneuropathy (CIPD), chronic relapsing polyneuropathy (Guillain-Barre syndrome), Miller Fischer syndrome, Stiff man syndrome, Lambert-Eaton myasthenic syndrome, myasthenia gravis.
    • diseases and disorders for which the involvement of B-cells is less clearly characterized (although sometimes illustrated by the efficacy of anti-CD20 monoclonal antibodies or intravenous immunoglobulin infusions) and may not correspond or be limited to the production of pathogenic antibodies (nevertheless, non-pathogenic antibodies are sometimes described or even often present and used as a diagnosis biomarker), including:
      • Addison's disease, autoimmune oophoritis and azoospermia, polyglandular syndromes (Whitaker's syndrome), Schmidt's syndrome;
      • Autoimmune myocarditis, cardiomyopathy, Kawasaki's disease;
      • Rheumatoid arthritis, Sjögren's syndrome, mixed connective tissue disease, polymyositis and dermatomyositis; polychondritis;
      • Primary glomerulonephritis;
      • Multiple sclerosis;
      • Autoimmune hepatitis, primary biliary cirrhosis/autoimmune cholangiopathy,
      • Hyper acute rejection of transplanted organs;
      • Chronic rejection of graft or transplants;
      • Chronic Graft versus Host reaction/disease after transplantation of bone marrow cells or hematopoietic precursor cells.


Additionally of interest are diseases and disorders for which the mechanism is shared between activation/proliferation of T-cells and activation/proliferation of innate immune cells and other inflammatory cellular subpopulations (including myeloid cells such as macrophages or granulocytes) and resident cells (such as fibroblasts and endothelial cells), including:

    • COPD, idiopathic pulmonary fibrosis, interstitial lung disease, sarcoidosis;
    • Adult onset Still's disease, juvenile idiopathic arthritis, Systemic sclerosis, CREST syndrome where B cells and pathogen antibodies may also play a role; the Sweet syndrome; Takayasu arteritis, temporal arteritis/giant cell arteritis;
    • Ulcerative cholangitis, inflammatory bowel disease (IBD) including Crohn's disease and ulcerative colitis, primary sclerosing cholangitis.


Also of interest are diseases and disorders for which the mechanism remains poorly characterized but involves the activation and proliferation of T-cells, including:

    • Alzheimer's disease, cardiovascular syndrome, type 2 diabetes, restenosis, chronic fatigue immune dysfuntion syndrome (CFIDS).
    • Autoimmune Lymphoproliferative disorders, including:
    • Autoimmune Lymphoproliferative Syndrome and X-linked lymphoproliferative disease.


Suitably the disease or disorder is selected from: inflammatory skin diseases such as psoriasis or lichen planus; acute and/or chronic GVHD such as steroid resistant acute GVHD; acute lymphoproliferative syndrome; systemic lupus erythematosus, lupus nephritis or cutaneous lupus; or transplantation. In addition, the disease or disorder may be selected from myasthenia gravis, multiple sclerosis, and scleroderma/systemic sclerosis.


The compounds of formula (I) may be used in the treatment of cancer.


Thus, in one embodiment there is provided is a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof, for use in the treatment of cancer.


Further, there is provided a method for treating cancer in a subject, by administering to a subject in need thereof a compound of formula (I) or a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof.


Additionally provided is the use of a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate thereof and/or derivative thereof, in the manufacture of a medicament for the treatment of cancer in a subject.


Suitably the cancer is a haematological cancer, such as Acute myeloid leukemia, Angioimmunoblastic T-cell lymphoma, B-cell acute lymphoblastic leukemia, Sweet Syndrome, T-cell Non-Hodgkins lymphoma (including natural killer/T-cell lymphoma, adult T-cell leukaemia/lymphoma, enteropathy type T-cell lymphoma, hepatosplenic T-cell lymphoma and cutaneous T-cell lymphoma), T-cell acute lymphoblastic leukemia, B-cell Non-Hodgkins lymphoma (including Burkitt lymphoma, diffuse large B-cell lymphoma, Follicular lymphoma, Mantle cell lymphoma, Marginal Zone lymphoma), Hairy Cell Leukemia, Hodgkin lymphoma, Lymphoblastic lymphoma, Lymphoplasmacytic lymphoma, Mucosa-associated lymphoid tissue lymphoma, Multiple myeloma, Myelodysplastic syndrome, Plasma cell myeloma, Primary mediastinal large B-cell lymphoma, chronic myeloproliferative disorders (such as chronic myeloid leukemia, primary myelofibrosis, essential thrombocytemia, polycytemia vera) or chronic lymphocytic leukemia.


Alternatively, the cancer is a non-haematological cancer, such as selected from the group consisting of bladder cancer, breast cancer, melanoma, neuroblastoma, malignant pleural mesothelioma and sarcoma, such as breast cancer and melanoma.


In addition, compounds of formula (I) may be used in enhancing recovery from vascular injury or surgery and reducing morbidity and mortality associated with neointima and restenosis in a subject. Vascular injury may occur in any vessel in the subject, such as a coronary artery, a renal artery, a carotid artery, a dialysis fistulae artery or a peripheral artery.


The compounds of formula (I) may be used in preventing, reducing, or inhibiting neointima formation. The compounds of formula (I) may be used in preventing or reducing the occurrence of restenosis, for example following surgery.


Furthermore, the compounds of formula (I) may be used in conjunction with a medical device. A medical device may be treated prior to insertion or implantation with an effective amount of a compound of formula (I) or a composition comprising a compound of formula (I) in order to prevent, reduce, or inhibit neointima formation following insertion or implantation of the device or graft into the subject. The device can be a device that is inserted into the subject transiently, or a device that is implanted permanently. In some embodiments, the device is a surgical device. Examples of medical devices include, but are not limited to, needles, cannulas, catheters, shunts, balloons, and implants such as stents and valves.


Suitably, the compound of formula (I) may be used in conjunction with angioplasty. The medical device may be a balloon.


Suitably the subject is a mammal, in particular the subject is a human.


Pharmaceutical Compositions


For use in therapy the compounds of the invention are usually administered as a pharmaceutical composition. The invention also provides a pharmaceutical composition comprising a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate (e.g. salt) and/or derivative thereof, and a pharmaceutically acceptable carrier or excipient.


In one embodiment, there is provided a pharmaceutical composition comprising a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate (e.g. salt) and/or derivative thereof, for use in the treatment or prophylaxis of a disease or disorder as described herein.


In a further embodiment, there is provided a method for the prophylaxis or treatment of a disease or disorder as described herein, which comprises administering to a subject in need thereof an effective amount of a pharmaceutical composition comprising a compound of formula (I) or a pharmaceutically acceptable salt and/or solvate (e.g. salt) and/or derivative thereof.


The invention also provides the use of a pharmaceutical composition comprising a compound of formula (I), or a pharmaceutically acceptable salt and/or solvate thereof (e.g. salt) and/or derivative thereof, in the manufacture of a medicament for the treatment or prophylaxis of a disease or disorder as described herein.


The compounds of formula (I) or their pharmaceutically acceptable salts and/or solvates and/or derivatives thereof may be administered by any convenient method, e.g. by oral, parenteral, buccal, sublingual, nasal, rectal or transdermal administration, and the pharmaceutical compositions adapted accordingly.


The compounds of formula (I) or their pharmaceutically acceptable salts and/or solvates and/or derivatives thereof may be administered topically, for example to the eye, gut or skin. Thus, in an embodiment there is provided a pharmaceutical composition comprising a compound of the invention optionally in combination with one or more topically acceptable diluents or carriers.


A pharmaceutical composition of the invention may be delivered topically to the skin. Compositions suitable for transdermal administration include ointments, gels and patches. Such a pharmaceutical composition may also suitably be in the form of a cream, lotion, foam, powder, paste or tincture.


The pharmaceutical composition may suitably include vitamin D3 analogues (e.g calcipotriol and maxacalcitol), steroids (e.g. fluticasone propionate, betamethasone valerate and clobetasol propionate), retinoids (e.g. tazarotene), coal tar and dithranol. Topical medicaments are often used in combination with each other (e.g. a vitamin D3 and a steroid) or with further agents such as salicylic acid.


A pharmaceutical composition of the invention may be delivered topically to the eye. Such a pharmaceutical composition may suitably be in the form of eye drops or an ointment.


A pharmaceutical composition of the invention may be delivered topically to the gut. Such a pharmaceutical composition may suitably be delivered orally, such as in the form of a tablet or a capsule, or rectally, such as in the form of a suppository.


Suitably, delayed release formulations are in the form of a capsule.


The compounds of formula (I) or their pharmaceutically acceptable salts and/or solvates and/or derivatives thereof which are active when given orally can be formulated as liquids or solids, e.g. as syrups, suspensions, emulsions, tablets, capsules or lozenges.


A liquid formulation will generally consist of a suspension or solution of the active ingredient (such as a compound of formula (I) or a pharmaceutically acceptable salt and/or solvate (e.g. salt) and/or derivative thereof) in a suitable liquid carrier(s) e.g. an aqueous solvent such as water, ethanol or glycerine, or a non-aqueous solvent, such as polyethylene glycol or an oil.


The formulation may also contain a suspending agent, preservative, flavouring and/or colouring agent.


A composition in the form of a tablet can be prepared using any suitable pharmaceutical carrier(s) routinely used for preparing solid formulations, such as magnesium stearate, starch, lactose, sucrose and cellulose.


A composition in the form of a capsule can be prepared using routine encapsulation procedures, e.g. pellets containing the active ingredient (such as a compound of formula (I) or a pharmaceutically acceptable salt and/or solvate (e.g. salt) and/or derivative thereof) can be prepared using standard carriers and then filled into a hard gelatin capsule; alternatively a dispersion or suspension can be prepared using any suitable pharmaceutical carrier(s), e.g. aqueous gums, celluloses, silicates or oils and the dispersion or suspension then filled into a soft gelatin capsule.


Typical parenteral compositions consist of a solution or suspension of the active ingredient (such as a compound of formula (I) or a pharmaceutically acceptable salt and/or solvate (e.g. salt) and/or derivative thereof) in a sterile aqueous carrier or parenterally acceptable oil, e.g. polyethylene glycol, polyvinyl pyrrolidone, lecithin, arachis oil or sesame oil. Alternatively, the solution can be lyophilised and then reconstituted with a suitable solvent just prior to administration.


Compositions for nasal administration may conveniently be formulated as aerosols, drops, gels and powders. Aerosol formulations typically comprise a solution or fine suspension of the active ingredient in a pharmaceutically acceptable aqueous or non-aqueous solvent and are usually presented in single or multidose quantities in sterile form in a sealed container which can take the form of a cartridge or refill for use with an atomising device. Alternatively the sealed container may be a disposable dispensing device such as a single dose nasal inhaler or an aerosol dispenser fitted with a metering valve. Where the dosage form comprises an aerosol dispenser, it will contain a propellant which can be a compressed gas e.g. air, or an organic propellant such as a fluoro-chloro-hydrocarbon or hydrofluorocarbon. Aerosol dosage forms can also take the form of pump-atomisers.


Compositions suitable for buccal or sublingual administration include tablets, lozenges and pastilles where the active ingredient is formulated with a carrier such as sugar and acacia, tragacanth, or gelatin and glycerin.


Compositions for rectal administration are conveniently in the form of suppositories containing a conventional suppository base such as cocoa butter.


Suitably, the composition is in unit dose form such as a tablet, capsule or ampoule.


The composition may for example contain from 0.1% to 100% by weight, for example from 10 to 60% by weight, of the active material, depending on the method of administration. The composition may contain from 0% to 99% by weight, for example 40% to 90% by weight, of the carrier, depending on the method of administration. The composition may contain from 0.05 mg to 2000 mg, for example from 1.0 mg to 500 mg, of the active material, depending on the method of administration. The composition may contain from 50 mg to 1000 mg, for example from 100 mg to 400 mg of the carrier, depending on the method of administration. The dose of the compound used in the treatment or prophylaxis of the aforementioned disorders will vary in the usual way with the seriousness of the disorders, the weight of the sufferer, and other similar factors. However, as a general guide suitable unit doses may be 0.05 mg to 1000 mg, more suitably 1.0 mg to 500 mg, and such unit doses may be administered more than once a day, for example two or three a day. Such therapy may extend for a number of weeks or months.


The invention provides, in a further aspect, a combination comprising a compound of formula (I) or a pharmaceutically acceptable, salt, solvate and/or derivative thereof (e.g. a combination comprising a compound of formula (I) or a pharmaceutically acceptable derivative thereof) together with a further pharmaceutically acceptable active ingredient or ingredients.


The invention provides a compound of formula (I), for use in combination with a further pharmaceutically acceptable active ingredient or ingredients.


When the compounds are used in combination with other therapeutic agents, the compounds may be administered separately, sequentially or simultaneously by any convenient route.


Optimal combinations may depend on the disease or disorder. Possible combinations include those with one or more active agents selected from the list consisting of: 5-aminosalicylic acid, or a prodrug thereof (such as sulfasalazine, olsalazine or bisalazide); corticosteroids (e.g. prednisolone, methylprednisolone, or budesonide); immunosuppressants (e.g. cyclosporin, tacrolimus, sirolimus, methotrexate, azathioprine mycophenolate mofetil, leflunomide, cyclophosphamide, 6-mercaptopurine or anti-lymphocyte (or thymocyte) globulins); anti-TNF-alpha antibodies (e.g., infliximab, adalimumab, certolizumab pegol or golimumab); anti-IL12/IL23 antibodies (e.g., ustekinumab); anti-IL6 or anti-IL6R antibodies, anti-IL17 antibodies or small molecule IL12/lL23 inhibitors (e.g., apilimod); Anti-alpha-4-beta-7 antibodies (e.g., vedolizumab); MAdCAM-1 blockers (e.g., PF-00547659); antibodies against the cell adhesion molecule alpha-4-integrin (e.g., natalizumab); antibodies against the IL2 receptor alpha subunit (e.g., daclizumab or basiliximab); JAK inhibitors including JAK1 and JAK3 inhibitors (e.g., tofacitinib, baricitinib, R348); Syk inhibitors and prodrugs thereof (e.g., fostamatinib and R-406); Phosphodiesterase-4 inhibitors (e.g., tetomilast); HMPL-004; probiotics; Dersalazine; semapimod/CPSI-2364; and protein kinase C inhibitors (e.g. AEB-071).


For cancer, the further pharmaceutically acceptable active ingredient may be selected from anthracyclins such as doxorubicin; anti-mitotic agents such as vinblastine, paclitaxel and docetaxel; alkylating agents, for example cisplatin, carboplatin, dacarbazine and cyclophosphamide; antimetabolites, for example 5-fluorouracil, cytosine arabinoside and hydroxyurea; intercalating agents for example adriamycin and bleomycin; topoisomerase inhibitors for example etoposide, topotecan and irinotecan; thymidylate synthase inhibitors for example raltitrexed; PI3 kinase inhibitors for example idelalisib; mTor inhibitors for example everolimus and temsirolimus; proteasome inhibitors for example bortezomib; histone deacetylase inhibitors for example panobinostat or vorinostat; and hedgehog pathway blockers such as vismodegib.


The further pharmaceutically acceptable active ingredient may be selected from tyrosine kinase inhibitors such as, for example, axitinib, dasatinib, erlotinib, imatinib, nilotinib, pazopanib and sunitinib.


Anticancer antibodies may be included in a combination therapy and may be selected from the group consisting of olaratumab, daratumumab, necitumumab, dinutuximab, traztuzumab emtansine, pertuzumab, obinutuzumab, brentuximab, ofatumumab, panitumumab, catumaxomab, bevacizumab, cetuximab, tositumomab, traztuzumab, gentuzumab ozogamycin and rituximab.


Compounds or pharmaceutical compositions of the invention may also be used in combination with radiotherapy.


Some of the combinations referred to above may conveniently be presented for use in the form of a pharmaceutical formulation and thus pharmaceutical formulations comprising a combination as defined above together with a pharmaceutically acceptable carrier or excipient comprise a further aspect of the invention. The individual components of such combinations may be administered either sequentially or simultaneously in separate or combined pharmaceutical formulations. The individual components of combinations may also be administered separately, through the same or different routes.


When a compound of formula (I) or a pharmaceutically acceptable derivative thereof is used in combination with a second therapeutic agent active against the same disease state the dose of each compound may differ from that when the compound is used alone. Appropriate doses will be readily appreciated by those skilled in the art.


Medical Devices


In an embodiment, compounds of the invention or pharmaceutical compositions comprising said compounds may be formulated to permit incorporation into the medical device, thus providing application of the compound or composition directly to the site to prevent or treat conditions disclosed herein.


In an embodiment, the compounds of the invention or pharmaceutical composition thereof is formulated by including it within a coating onto the medical device. There are various coatings that can be utilized such as, for example, polymer coatings that can release the compound over a prescribed time period. The compound, or a pharmaceutical composition thereof, can be embedded directly within the medical device. In some embodiments, the compound is coated onto or within the device in a delivery vehicle such as a microparticle or liposome that facilitates its release and delivery. In some embodiments, the compound or pharmaceutical composition is miscible in the coating.


In some embodiments, the medical device is a vascular implant such as a stent. Stents are utilized in medicine to prevent or eliminate vascular restrictions. The implants may be inserted into a restricted vessel whereby the restricted vessel is widened. Excessive growth of the adjacent cells following vascular implantation results in a restriction of the vessel particularly at the ends of the implants which results in reduced effectiveness of the implants. If a vascular implant is inserted into a human artery for the elimination of for example an arteriosclerotic stenosis, intimahyperplasia can occur within a year at the ends of the vascular implant and results in renewed stenosis (“restenosis”).


Accordingly, in some embodiments, the stents are coated or loaded with a composition including a compound of the invention or pharmaceutical composition thereof and optionally a targeting signal, a delivery vehicle, or a combination thereof. Many stents are commercially available or otherwise know in the art.


In some embodiments, the stent is a drug-eluting stent. Various drug eluting stents that simultaneously deliver a therapeutic substance to the treatment site while providing artificial radial support to the wall tissue are known in the art. Endoluminal devices including stents are sometimes coated on their outer surfaces with a substance such as a drug releasing agent, growth factor, or the like. Stents have also been developed having a hollow tubular structure with holes or ports cut through the sidewall to allow drug elution from a central lumen. Although the hollow nature of the stent allows the central lumen to be loaded with a drug solution that is delivered via the ports or holes in the sidewall of the stent, the hollow tubular structure may not have suitable mechanical strength to provide adequate scaffolding in the vessel.


In some embodiments, the devices are also coated or impregnated with a compound of the invention, or pharmaceutical composition thereof and one or more additional therapeutic agents, including, but not limited to, antiplatelet agents, anticoagulant agents, anti-inflammatory agents, antimicrobial agents, antimetabolic agents, additional anti-neointima agents, additional antiproliferative agents, immunomodulators, antiproliferative agents, agents that affect migration and extracellular matrix production, agents that affect platelet deposition or formation of thrombis, and agents that promote vascular healing and re-endothelialization, such as those and others described in Sousa et al. (2003) and Salu et al. (2004).


Examples of antithrombin agents include, but are not limited to, Heparin (including low molecular heparin), R-Hirudin, Hirulog, Argatroban, Efegatran, Tick anticoagulant peptide, and Ppack.


Examples of antiproliferative agents include, but are not limited to, Paclitaxel (Taxol), QP-2 Vincristin, Methotrexat, Angiopeptin, Mitomycin, BCP 678, Antisense c-myc, ABT 578, Actinomycin-D, RestenASE, 1-Chlor-deoxyadenosin, PCNA Ribozym, and Celecoxib.


Examples of anti-restenosis agents include, but are not limited to, immunomodulators such as Sirolimus (Rapamycin), Tacrolimus, Biorest, Mizoribin, Cyclosporin, Interferon-γ Ib, Leflunomid, Tranilast, Corticosteroide, Mycophenolic acid and Biphosphonate.


Examples of anti-migratory agents and extracellular matrix modulators include, but are not limited to Halofuginone, Propyl-hydroxylase-Inhibitors, C-Proteinase-Inhibitors, MMP-Inhibitors, Batimastat, Probucol.


Examples of antiplatelet agents include, but are not limited to, heparin.


Examples of wound healing agents and endothelialization promoters include vascular epithelial growth factor (“VEGF”), 17-Estradiol, Tkase-Inhibitors, BCP 671, Statins, nitric oxide (“NO”)-Donors, and endothelial progenitor cell (“EPC”)-antibodies.


Besides coronary applications, drugs and active agents may be incorporated into the stent or stent coating for other indications. For example, in urological applications, antibiotic agents may be incorporated into the stent or stent coating for the prevention of infection. In gastroenterological and urological applications, active agents may be incorporated into the stent or stent coating for the local treatment of carcinoma. It may also be advantageous to incorporate in or on the stent a contrast agent, radiopaque markers, or other additives to allow the stent to be imaged in vivo for tracking, positioning, and other purposes. Such additives could be added to the absorbable composition used to make the stent or stent coating, or absorbed into, melted onto, or sprayed onto the surface of part or all of the stent. Preferred additives for this purpose include silver, iodine and iodine labeled compounds, barium sulfate, gadolinium oxide, bismuth derivatives, zirconium dioxide, cadmium, tungsten, gold tantalum, bismuth, platinum, iridium, and rhodium. These additives may be, but are not limited to, micro- or nano-sized particles or nano particles. Radio-opacity may be determined by fluoroscopy or by x-ray analysis.


A compound of the invention and one or more additional agents, or pharmaceutical composition thereof, can be incorporated into the stent, either by loading the compound and one or more additional agents, or pharmaceutical composition thereof into the absorbable material prior to processing, and/or coating the surface of the stent with the agent(s). The rate of release of agent may be controlled by a number of methods including varying the following the ratio of the absorbable material to the compound and one or more additional agents, or pharmaceutical composition, the molecular weight of the absorbable material, the composition of the compound and one or more additional agents, or pharmaceutical composition, the composition of the absorbable polymer, the coating thickness, the number of coating layers and their relative thicknesses, and/or the compound and one or more additional agents, or pharmaceutical composition concentration. Top coats of polymers and other materials, including absorbable polymers, may also be applied to active agent coatings to control the rate of release. For example, P4HB can be applied as a top coat on a metallic stent coated with P4HB including an active agent to retard the release of the active agent.


The invention is further exemplified by the following non-limiting examples.


Examples

Abbreviations used herein are defined below. Any abbreviations not defined are intended to convey their generally accepted meaning.


Abbreviations



  • AcOH glacial acetic acid

  • AlMe3 trimethylaluminium

  • aq aqueous

  • Ar aromatic ring

  • BEH ethylene bridged hybrid

  • Bispin bis(pinacolato)diboron; 4,4,4′,4′,5,5,5′,5′-Octamethyl-2,2′-bi-1,3,2-dioxaborolane

  • Bz benzyl (CH2-phenyl)

  • BOC tert-butyloxycarbonyl protecting group

  • Cs2CO3 cesium carbonate

  • CSH charged surface hybrid

  • d doublet

  • DCM dichloromethane

  • DIBAL-H diisobutylaluminium hydride

  • DIPEA N,N-diisopropylethylamine

  • dioxane 1,4-dioxane

  • DMF N,N-dimethylformamide

  • DMSO dimethyl sulfoxide

  • DPPA diphenylphosphoryl azide

  • dppf 1,1′-bis(diphenylphosphino)ferrocene

  • (ES+) electrospray ionisation, positive mode

  • (ES) electrospray ionisation, negative mode

  • ESI electrospray ionisation

  • Et ethyl

  • EtMgBr ethyl magnesium bromide

  • EtOAc ethyl acetate

  • EtOH ethanol

  • Fmoc fluorenylmethyloxycarbonyl

  • g grams

  • HATU 1-[bis(dimethylamino)methylene]-1H-1,2,3-triazolo[4,5-b]pyridinium 3-oxid hexafluorophosphate

  • HCl hydrochloric acid

  • HPLC high performance liquid chromatography

  • hr(s) hour(s)

  • H2SO4 sulfuric acid

  • IC50 50% inhibitory concentration

  • K2CO3 potassium carbonate

  • LCMS liquid chromatography-mass spectrometry

  • LiOH lithium hydroxide

  • (M+H)+ protonated molecular ion

  • (M−H) unprotonated molecular ion

  • M molar concentration

  • mL millilitre

  • mm millimeter

  • mmol millimole

  • MgSO4 magnesium sulfate

  • Me methyl

  • MeCN acetonitrile

  • MeMgBr methyl magnesium bromide

  • MeOH methanol

  • MHz megahertz

  • min(s) minute(s)

  • MSD mass selective detector

  • m/z mass-to-charge ratio

  • N2 nitrogen gas

  • NH3 ammonia

  • NH4Cl ammonium chloride

  • NaH sodium hydride

  • Na2SO4 sodium sulfate

  • NaHCO3 sodium bicarbonate

  • nM nanomolar

  • nm nanometre

  • NMR nuclear magnetic resonance (spectroscopy)

  • PDA photodiode array

  • PdCl2(pddf).CH2Cl2 [1,1′-bis(diphenylphosphino)ferrocene]dichloropalladium(II) dichloromethane

  • prep HPLC preparative high performance liquid chromatography

  • Ph phenyl

  • pos/neg positive/negative

  • q quartet

  • RT room temperature

  • Rt retention time

  • RP reverse phase

  • s singlet

  • SNAr nucleophilic aromatic substitution

  • sat saturated

  • SCX solid supported cation exchange (resin)

  • t triplet

  • T3P 2,4,6-tripropyl-1,3,5,2,4,6-trioxatriphosphorinane-2,4,6-trioxide

  • TBME tert-butyl methyl ether

  • TFA trifluoroacetic acid

  • TMSOK potassium trimethylsilanolate

  • THE tetrahydrofuran

  • UPLC ultra performance liquid chromatography

  • UV ultraviolet

  • v/v volume/volume

  • VWD variable wave detector



General Procedures


All starting materials and solvents were obtained either from commercial sources or prepared according to the literature. Unless otherwise stated all reactions were stirred. Organic solutions were routinely dried over anhydrous magnesium sulfate or sodium sulfate. Hydrogenations were performed on a Thales H-cube flow reactor under the conditions stated.


Column chromatography was performed on pre-packed silica (230-400 mesh, 40-63 um) cartridges using the amount indicated. SCX was purchased from Supelco and treated with 1 M hydrochloric acid prior to use. Unless stated otherwise the reaction mixture to be purified was first diluted with MeOH and made acidic with a few drops of AcOH. This solution was loaded directly onto the SCX and washed with MeOH. The desired material was then eluted by washing with 0.7 M NH3 in MeOH.


Preparative Reverse Phase High Performance Liquid Chromatography (HPLC)


Prep HPLC


Acidic Prep


Waters X-Select CSH column C18, 5 um (19×50 mm), flow rate 28 mL min−1 eluting with a H2O-MeCN gradient containing 0.1% v/v formic acid over 6.5 min using UV detection at 254 nm.


Basic Prep


Waters X-Bridge Prep column C18, 5 um (19×50 mm), flow rate 28 mL min−1 eluting with a 10 mM NH4HCO3-MeCN gradient over 6.5 min using UV detection at 254 nm.


Prep Chiral HPLC


Chiral Method A: Chiralpak® IA (Daicel Ltd.) column (2×25 cm), flow rate 13.5 mL min−1 eluting with a mixture of (30%) EtOH in a 4:1 mixture of heptane+0.2% TFA and CHCl3, UV detection at 254 nm. Samples were loaded onto the column via an at-column dilution pump, pumping (EtOH) (1.5 mL min−1) for the duration of the run, giving a combined flow rate of 15 mL min−1


Chiral Method B: Chiralpak® IA (Daicel Ltd.) column (2×25 cm), flow rate 13.5 mL min−1 eluting with a mixture of (40%) EtOH in a 4:1 mixture of heptane+0.2% TFA and CHCl3, UV detection at 254 nm. Samples were loaded onto the column via an at-column dilution pump, pumping (EtOH) (1.5 mL min−1) for the duration of the run, giving a combined flow rate of 15 mL min−1


Analytical Methods


Reverse Phase HPLC Conditions for the LCMS Analytical Methods


HPLC acidic: Acidic LCMS 4 minute (5-95%)


Analytical LCMS was carried out using a Waters X-Select CSH C18, 2.5 um, 4.6×30 mm column eluting with a gradient of 0.1% formic acid in MeCN in 0.1% formic acid in water. The gradient from 5-95% 0.1% formic acid in MeCN occurred between 0.00-3.00 minutes at 2.5 mL/min with a flush from 3.01-3.5 minutes at 4.5 mL/min. A column re-equilibration to 5% MeCN was from 3.60-4.00 minutes at 2.5 mL/min. UV spectra of the eluted peaks were measured using an Agilent 1260 Infinity VWD at 254 nm. Mass spectra were measured using an Agilent 6120 MSD running with positive/negative switching.


HPLC basic: Basic LCMS 4 minute (5-95%)


Analytical LCMS was carried out using a Waters X-Select BEH C18, 2.5 um, 4.6×30 mm column eluting with a gradient of MeCN in aqueous 10 mM ammonium bicarbonate. The gradient from 5-95% MeCN occurred between 0.00-3.00 minutes at 2.5 mL/min with a flush from 3.01-3.5 minutes at 4.5 mL/min. A column re-equilibration to 5% MeCN was from 3.60-4.00 minutes at 2.5 mL/min. UV spectra of the eluted peaks were measured using an Agilent 1260 Infinity VWD at 254 nm. Mass spectra were measured using an Agilent 6120 MSD running with positive/negative switching.


Reverse Phase HPLC Conditions for the UPLC Analytical Methods


UPLC Acidic: Acidic UPLC 3 Minute


Analytical UPLC/MS was carried out using a Waters Acquity CSH C18, 1.7 um, 2.1×30 mm column eluting with a gradient of 0.1% formic acid in MeCN in 0.1% formic acid in water. The gradient was structured with a starting point of 5% MeCN held from 0.0-0.11 minutes. The gradient from 5-95% occurred between 0.11-2.15 minutes with a flush from 2.15-2.56 minutes. A column re-equilibration to 5% MeCN was from 2.56-2.83 minutes. UV spectra of the eluted peaks were measured using an Acquity PDA and mass spectra were recorded using an Acquity QDa detector with ESI positive/negative switching.


UPLC basic: Basic UPLC 3 minute


Analytical UPLC/MS was carried out using a Waters Acquity BEH C18, 1.7 um, 2.1×30 mm column eluting with a gradient of MeCN in aqueous 10 mM ammonium bicarbonate. The gradient was structured with a starting point of 5% MeCN held from 0.0-0.11 minutes. The gradient from 5-95% occurred between 0.11-2.15 minutes with a flush from 2.15-2.56 minutes. A column re-equilibration to 5% MeCN was from 2.56-2.83 minutes. UV spectra of the eluted peaks were measured using an Acquity PDA and mass spectra were recorded using an Acquity QDa detector with ESI positive/negative switching.


Column temperature was 40° C. in all runs. Injection volume was 3 uL and the flow rate was 0.77 mL/min. PDA scan from 210-400 nm was conducted on all runs.


Normal Phase HPLC Conditions for the Chiral Analytical Methods


Chiral IA method 1: Chiral HPLC (Daicel Chiralpak IA, 5 um, 4.6×250 mm, 1.0 mL/min, 5-95% (gradient over 45 min) EtOH (0.2% TFA) in [4:1 heptane (0.2% TFA):CHCl3].


Chiral IA method 2: Chiral HPLC (Daicel Chiralpak IA, 5 um, 4.6×250 mm, 1.0 mL/min, Isocratic 40% EtOH (0.2% TFA) in [4:1 heptane (0.2% TFA):CHCl3].


Chiral IC method 1: Chiral HPLC (Daicel Chiralpak IA, 5 um, 4.6×250 mm, 0.5 mL/min, Isocratic 70% EtOH (0.2% TFA) in [4:1 iso-hexane (0.2% TFA):CHCl3].



1H NMR Spectroscopy



1H NMR spectra were acquired on a Bruker Avance III spectrometer at 400 MHz or Bruker Avance III HD spectrometer at 500 MHz using residual undeuterated solvent as reference and unless specified otherwise were run in DMSO-ds.


Preparation of Intermediates


Known synthetic intermediates were procured from commercial sources or were obtained using published literature procedures. Additional intermediates were prepared by the representative synthetic processes described herein.


Ethyl 2-(cyclopropanesulfonamido)thiazole-4-carboxylate INTE1



embedded image


A solution of ethyl 2-aminothiazole-4-carboxylate (6.49 g, 37.7 mmol) and cyclopropanesulfonyl chloride (4 mL, 39.5 mmol) in pyridine (15 mL) was warmed to 40° C. and stirred for 48 hrs. The reaction mixture was taken up in DMSO (20 mL) and the crude product was purified by reverse phase chromatography on C18 silica (330 g column, 10-20% MeCN/10 mM ammonium bicarbonate) to afford the product which was then taken up in EtOAc (300 mL) and washed with 1 M HCl (aq, 300 mL) and brine (150 mL). The organic layer was dried (Na2SO4), filtered and concentrated to afford ethyl 2-(cyclopropanesulfonamido)thiazole-4-carboxylate (4.7 g, 15.31 mmol, 41% yield) as an orange oil; Rt 1.36 min (HPLC acidic); m/z 277 (M+H)+ (ES+); 1H NMR (400 MHz, DMSO-d6) δ 13.14 (s, 1H), 7.72 (s, 1H), 4.28 (q, J=7.1 Hz, 2H), 2.72-2.58 (m, 1H), 1.29 (t, J=7.1 Hz, 3H), 1.01-0.81 (m, 4H).


N-(4-Formylthiazol-2-yl)cyclopropanesulfonamide INTE2



embedded image


A solution of ethyl 2-(cyclopropanesulfonamido)thiazole-4-carboxylate INTE1 (1.0 g, 3.62 mmol) in DCM (10 mL) was cooled to −78° C. whereupon DIBAL-H (1 M in DCM) (14.5 mL, 14.5 mmol) was added dropwise over 30 mins. The reaction was then stirred at this temperature for 2 hrs. MeOH (1.5 mL) was added cautiously before the reaction mixture was allowed to warm to RT. DCM (50 mL) was then added, followed by 1 M HCl (aq, 90 mL) with vigorous stirring. The mixture was stirred for 10 mins before being passed through a phase separator and further extracting with DCM (50 mL). The organic layers were combined and concentrated onto silica (2 g) and the crude product was purified by chromatography on silica (40 g column, 20-80% EtOAc/iso-hexanes) to afford N-(4-formylthiazol-2-yl)cyclopropanesulfonamide (122 mg, 0.5 mmol, 14% yield) as a colourless gum; Rt 0.53 min (UPLC acidic); m/z 233 (M+H)+ (ES+); 1H NMR (400 MHz, DMSO-d6) δ 13.17 (s, 1H), 9.52 (s, 1H), 8.06 (s, 1H), 2.73-2.57 (m, 1H), 1.04-0.67 (m, 4H).


2-(Cyclopropanesulfonamido)thiazole-4-carboxylic Acid INTE3



embedded image


A solution of ethyl 2-(cyclopropanesulfonamido)thiazole-4-carboxylate INTE1 (1.3 g, 4.70 mmol) in 2 M LiOH (aq, 4.70 mL, 9.41 mmol), MeOH (1 mL) and THE (6 mL) was stirred at RT. The reaction mixture was part concentrated (to approx. 6 mL) then acidified with 1 M HCl (aq. 12 mL). The aqueous layer was then extracted with EtOAc (3×20 mL), then the organic phases were combined, dried (Na2SO4), filtered and concentrated to afford 2-(cyclopropanesulfonamido)thiazole-4-carboxylic acid (910 mg, 3.59 mmol, 76% yield) as a colourless solid; Rt 0.65 min (UPLC acidic); m/z 249 (M+H)+ (ES+); 1H NMR (400 MHz, DMSO-d6) δ 13.83-12.58 (br. s, 2H), 7.61 (s, 1H), 2.67-2.58 (m, 1H), 1.07-0.73 (m, 4H).


2-(Cyclopropanesulfonamido)-N-methoxy-N-methylthiazole-4-carboxamide INTE4



embedded image


A solution of 2-(cyclopropanesulfonamido)thiazole-4-carboxylic acid INTE3 (910 mg, 3.67 mmol) and N,O-dimethylhydroxylamine hydrochloride (358 mg, 3.67 mmol) in DMF (6 mL) was treated with DIPEA (2.2 mL, 12.8 mmol) and stirred for 5 mins before HATU (1.3 g, 3.67 mmol) was added, the reaction mixture was stirred at RT for 20 hrs. The reaction mixture was taken up in 1 M HCl (aq, 50 mL) which was extracted with EtOAc (3×50 mL). The organic phases were combined, dried (Na2SO4), filtered and concentrated onto silica (5 g). The crude product was purified by chromatography on silica (24 g column, 0-100% EtOAc/iso-hexanes) to afford 2-(cyclopropanesulfonamido)-N-methoxy-N-methylthiazole-4-carboxamide (786 mg, 2.64 mmol, 72% yield) as a colourless solid; Rt 0.73 min (UPLC acidic); m/z 292 (M+H)+(ES+); 1H NMR (400 MHz, DMSO-d6) δ 12.75 (s, 1H), 7.58 (s, 1H), 3.73 (s, 3H), 3.26 (s, 3H), 2.68-2.58 (m, 1H), 1.00-0.84 (m, 4H).


N-(4-Propionylthiazol-2-yl)cyclopropanesulfonamide INTE5



embedded image


A suspension of 2-(cyclopropanesulfonamido)-N-methoxy-N-methylthiazole-4-carboxamide INTE4 (2.5 g, 8.58 mmol) in THE (100 mL) at 40° C. was treated dropwise with 2 M EtMgCl (THF, 8.6 mL, 17.2 mmol). The reaction mixture was maintained at 40° C. for 18 hrs. The reaction mixture was quenched by addition of NH4Cl (sat. aq, 30 mL) followed by EtOAc (50 mL) and water (20 mL). The phases were partitioned and the aqueous layer was extracted with EtOAc (50 mL), the organic phases were combined, dried (Na2SO4), filtered and concentrated onto silica (10 g). The crude product was purified by chromatography on silica (24 g column, 0-50% EtOAc/iso-hexanes) to afford N-(4-propionylthiazol-2-yl)cyclopropanesulfonamide (1.9 g, 5.84 mmol, 68% yield) as an off white gum; Rt 1.24 min (HPLC acidic); m/z 261 (M+H)+ (ES+); 1H NMR (400 MHz, DMSO-d6) δ 12.92 (s, 1H), 7.95 (s, 1H), 2.86 (q, J=7.2 Hz, 2H), 2.68-2.58 (m, 1H), 1.05 (t, J=7.2 Hz, 3H), 0.97-0.80 (m, 4H).


N-(4-acetylthiazol-2-yl)cyclopropanesulfonamide INTE21



embedded image


Prepared as for INTE1 using commercial 1-(2-aminothiazol-4-yl)ethanone to afford N-(4-acetylthiazol-2-yl)cyclopropanesulfonamide (30% yield) as a yellow gum. Rt 1.00 (HPLC acidic); m/z 247 (M+H)+(ES+); 1H NMR (500 MHz, DMSO-d6) δ 12.92 (s, 1H), 7.98 (s, 1H), 2.70-2.58 (m, 1H), 2.43 (s, 3H), 1.00-0.80 (m, 4H).


Method A: Reductive Amination




embedded image


A solution of aldehyde/ketone (1 eq.) in THE was treated with AcOH (1 eq.), amine (1 eq.) and a reducing agent such as STAB (1.2 eq.) and stirred at RT for 1 hr. The reaction mixture was quenched by addition of MeOH then loaded directly on to SCX (1 g/mmol of substrate), washed with MeOH and the product was eluted with 1 M NH3 in MeOH. The crude product was then concentrated onto silica and purified by normal phase chromatography.









TABLE 1







The following intermediates were made according to Method A.












Synthesis





Method,





[LCMS





Method],




Name/Structure
m/z




(All examples containing chiral centres
(M + H)+,

1H NMR Chemical Shift Data



INT
are racemates unless stated)
(Rt/min)
(DMSO-d6 unless stated)





INTE6
N-(4-(((2,4-
Using
7.23 (d, J = 8.3 Hz, 1H), 6.56 (d, J =



dimethoxybenzyl)amino)methyl)thiazol-2-
INTE2
2.4 Hz, 1H), 6.52 (d, J = 2.4 Hz,



yl)cyclopropanesulfonamide   embedded image
[HPLC acidic], 384 (0.99).
1H), 6.50 (d, J = 2.3 Hz, 1H), 3.79 (s, 3H), 3.76 (s, 3H), 3.74 (s, 2H), 3.63-3.61 (m, 2H), 2.49-2.45 (m, 1H), 0.89-0.72 (m, 4H), zwitterion, 2 × N—H not observed.





INTE7
N-(4-(1-((2,4-
Using
7.18 (d, J = 8.3 Hz, 1H), 6.59-6.37



dimethoxybenzyl)amino)propyl)thiazol-2-
INTE5
(m, 3H), 3.76 (s, 3H), 3.75 (s, 3H),



yl)cyclopropanesulfonamide   embedded image
[UPLC acidic], 412 (0.62).
3.64-3.43 (m, 3H), 2.58-2.52 (m, 1H), 1.76-1.57 (m, 2H), 0.91- 0.81 (m, 4H), 0.78 (t, J = 7.4 Hz, 3H), 2 × N—H not observed.





INTE8
N-(4-(1-((4-
Using
12.11 (v. br. s, 1H), 7.26-7.18 (m,



methoxybenzyl)(methyl)amino)propyl)thiazol-
INTE5,
2H), 6.91-6.83 (m, 2H), 6.58 (s,



2-yl)cyclopropanesulfonamide   embedded image
[HPLC basic], 396 (1.63).
1H), 3.73 (s, 3H), 3.55-3.42 (m, 2H), 3.39-3.26 (m, 1H), 2.65- 2.57 (m, 1H), 1.99 (s, 3H), 1.91- 1.57 (m, 2H), 0.97-0.84 (m, 5H), 0.75-0.65 (m, 2H).





INTE22
N-(4-(1-((2,4-
Using
None recorded



dimethoxybenzyl)amino)ethyl)thiazol-2-
INTE21




yl)cyclopropanesulfonamide   embedded image
[HPLC basic], 398 (1.43).









Method B: Benzylamine Deprotection (TFA)




embedded image


Benzylamine derivative (1 eq.) was dissolved in TEA (50 eq.) and heated to 70° C. for 1-24 hrs. The reaction was allowed to cool to RT, then was loaded on to SCX (1 g/mmol of substrate) and washed with MeOH. The required compound was eluted with 1% NH3 in MeOH.









TABLE 2







The following intermediates were made according to Method B.












Synthesis





Method,




Name/Structure
[LCMS




(All examples containing chiral
Method],




centres are racemates unless
m/z (M + H)+,

1H NMR Chemical Shift Data



INT
stated)
(Rt/min)
(DMSO-d6 unless stated)





INTE9
N-(4-(aminomethyl)thiazol-2-
Using
6.44 (s, 1H), 3.79-3.70 (m, 2H), 2.46-



yl)cyclopropanesulfonamide   embedded image
INTE6, [UPLC basic], 234 (0.23).
2.33 (m, 1H), 0.85-0.75 (m, 2H), 0.74- 0.61 (m, 2H), 3 × NH not observed.





INTE10
N-(4-(1-aminopropyl)thiazol-2-
Using
8.00 (v. br. s, 3H), 6.43 (s, 1H), 3.98-



yl)cyclopropanesulfonamide   embedded image
INTE7, [HPLC basic], 262 (M + H)+ (ES+); (0.51).
3.73 (m, 1H, obscured by impurity), 2.42- 2.28 (m, 1H), 1.92-1.62 (m, 2H), 0.95- 0.40 (m, 7H).





INTE11
N-(4-(1-
Using
6.49 (s, 1H), 3.70-3.57 (m, 1H), 2.44-



(methylamino)propyl)thiazol-2-
INTE8,
2.34 (m, 1H), 2.32 (s, 3H), 1.82-1.69 (m,



yl)cyclopropanesulfonamide   embedded image
[HPLC acidic], 276 (0.34).
2H), 0.84-0.74 (m, 5H), 0.74-0.66 (m, 2H), 2 × NH not observed





INTE23
N-(4-(1-aminoethyl)thiazol-2-
Using
6.39 (d, J = 0.8 Hz, 1H), 4.16-4.02 (m,



yl)cyclopropanesulfonamide   embedded image
INTE21, No Data recorded
1H), 2.46-2.26 (m, 1H), 1.41 (d, J = 6.7 Hz, 3H), 0.84-0.73 (m, 2H), 0.72-0.56 (m, 2H), 3 × exchangeable N—H not observed.









N-(4-(2-Hydroxypropan-2-yl)thiazol-2-yl)cyclopropanesulfonamide INTE12



embedded image


A solution of ethyl 2-(cyclopropanesulfonamido)thiazole-4-carboxylate INTE1 (2.7 g, 9.77 mmol) in THE (30 mL) was cooled to 0° C. then MeMgBr (3.4 M in THF, 14.4 mL, 48.9 mmol) was added dropwise, over approx. 20 mins, maintaining the temperature below 10° C. Once addition was complete the reaction mixture was allowed to warm to RT and was stirred for 24 hrs. The reaction mixture was cooled with an ice bath and NH4Cl (sat. aq, 10 mL) was added cautiously, resulting in precipitate formation. 1 M HCl (aq, 50 mL) was added and the reaction mixture was extracted with EtOAc (3×50 mL). The organic phases were combined, dried (MgSO4), filtered and concentrated onto silica (10 g). The product was then purified by chromatography on silica (24 g column, 0-100% EtOAc/iso-hexanes) to afford N-(4-(2-hydroxypropan-2-yl)thiazol-2-yl)cyclopropanesulfonamide (1.03 g, 3.53 mmol, 36% yield) as a pale yellow solid: Rt 1.05 min (HPLC acidic); m/z 263 (M+H)+ (ES+); 1H NMR (400 MHz, DMSO-d6) δ 12.44 (s, 1H), 6.42 (s, 1H), 5.35 (s, 1H), 2.64-2.54 (m, 1H), 1.40 (s, 6H), 0.96-0.74 (m, 4H).


2-Chloro-N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)acetamide INTE13



embedded image


A mixture of N-(4-(2-hydroxypropan-2-yl)thiazol-2-yl)cyclopropanesulfonamide INTE12 (500 mg, 1.91 mmol) and 2-chloroacetonitrile (0.72 mL, 11.4 mmol) in AcOH (0.87 mL, 15 mmol) was cooled in an ice bath before H2SO4 (0.92 mL, 17.2 mmol) was added. The reaction was allowed to warm to RT and was stirred for 18 hrs. The solution was poured onto ice water (10 mL) and extracted with DCM (3×10 mL), partitioning with a phase separator. The crude product was purified by chromatography on silica (12 g column, 0-100% EtOAc/iso-hexanes) to afford 2-chloro-N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)acetamide (574 mg, 1.61 mmol, 85% yield) as an orange gum; Rt 0.78 min (UPLC acidic); m/z 337 (35Cl M+H)+ (ES+); 1H NMR (400 MHz, DMSO-d6) δ 12.46 (s, 1H), 8.29 (s, 1H), 6.44 (s, 1H), 4.11-3.87 (m, 2H), 2.63-2.53 (m, 1H), 1.51 (s, 6H), 0.97-0.83 (m, 4H).


N-(4-(2-Aminopropan-2-yl)thiazol-2-yl)cyclopropanesulfonamide INTE14



embedded image


A suspension of thiourea (154 mg, 2.03 mmol) and 2-chloro-N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)acetamide INTE13 (570 mg, 1.69 mmol) in EtOH (8 mL) was treated with AcOH (1.6 mL, 28.7 mmol) and heated to reflux for 20 hrs. The reaction mixture was allowed to cool to RT. The resulting precipitate was filtered and the filtrate was loaded onto SCX (5 g), washed with MeOH and the required product was isolated by eluting with 1% NH3 in MeOH to afford N-(4-(2-aminopropan-2-yl)thiazol-2-yl)cyclopropanesulfonamide (479 mg, 1.80 mmol, quant. yield) as a slightly pink solid; Rt 0.50 min (UPLC basic); m/z 262 (M+H)+ (ES+); 1H NMR (400 MHz, DMSO-d6) δ 6.38 (s, 1H), 2.44-2.21 (m, 1H), 1.49 (s, 6H), 0.89-0.35 (m, 4H), 3×H exchangeable protons were very broad and are not reported.


N-(4-(3-hydroxypentan-3-yl)thiazol-2-yl)cyclopropanesulfonamide INTE15



embedded image


A solution of ethyl 2-(cyclopropanesulfonamido)thiazole-4-carboxylate INTE1 (3 g, 10.86 mmol) in THE (50 mL) was cooled to 0° C., then EtMgBr (2 M in THF) (27.1 mL, 54.3 mmol) was added dropwise over approx. 20 mins, maintaining the temperature below 20° C. Once addition was complete the reaction mixture was warmed to RT and was stirred for 1 hr after which the reaction mixture was cooled with an ice bath and 1 M HCl (aq, 65 mL) was added cautiously. The aqueous layer was extracted with EtOAc (3×50 mL). The organic phases were combined, dried (Na2SO4), filtered and concentrated onto silica (10 g). The product was purified by chromatography on silica (24 g column, 0-100% EtOAc/iso-hexanes) to afford N-(4-(3-hydroxypentan-3-yl)thiazol-2-yl)cyclopropane sulfonamide (2.13 g, 6.97 mmol, 64% yield) as a colourless solid. Rt 0.86 min (UPLC, acidic); m/z 313.2 (M+Na)+ (ES+); 1H NMR (400 MHz, DMSO-d6) δ 12.29 (s, 1H), 6.37 (s, 1H), 4.91 (s, 1H), 2.63-2.53 (m, 1H), 1.82-1.47 (m, 4H), 0.95-0.82 (m, 4H), 0.70 (t, J=7.3 Hz, 6H).


2-Chloro-N-(3-(2-(cyclopropanesulfonamido)thiazol-4-yl)pentan-3-yl)acetamide INTE16



embedded image


A mixture of N-(4-(3-hydroxypentan-3-yl)thiazol-2-yl)cyclopropanesulfonamide INTE15 (2.13 g, 7.33 mmol) and 2-chloroacetonitrile (2.8 mL, 44.5 mmol) in AcOH (3.4 mL, 59.4 mmol) was cooled in an ice bath before sulfuric acid (3.5 mL, 65.7 mmol) was added to afford a solution. The reaction was warmed to RT and was stirred for 18 hrs. The solution was poured onto ice water (100 mL) and extracted with DCM (3×100 mL) partitioning with a phase separator. The material was concentrated onto silica (20 g) and the crude product was purified by chromatography on silica (80 g column, 0-100% EtOAc/iso-hexanes) to afford 2-chloro-N-(3-(2-(cyclopropanesulfonamido)thiazol-4-yl)pentan-3-yl)acetamide (1.62 g, 4.21 mmol, 57% yield) as a colourless solid. Rt 0.76 min (UPLC, acidic); m/z 366.2 (35Cl M+H)+ (ES+); 1H NMR (400 MHz, DMSO-d6) δ 12.36 (s, 1H), 7.99 (s, 1H), 6.44 (s, 1H), 4.09 (s, 2H), 2.62-2.53 (m, 1H), 2.05-1.86 (m, 2H), 1.80-1.66 (m, 2H), 0.95-0.83 (m, 4H), 0.69 (t, J=7.3 Hz, 6H).


N-(4-(3-aminopentan-3-yl)thiazol-2-yl)cyclopropanesulfonamide INTE17



embedded image


A solution of thiourea (0.40 g, 5.25 mmol) and 2-chloro-N-(3-(2-(cyclopropanesulfonamido)thiazol-4-yl)pentan-3-yl)acetamide INTE16 (1.6 g, 4.37 mmol) in EtOH (20 mL) was treated with acetic acid (4.3 mL, 75 mmol) and heated to reflux for 18 hrs. The reaction mixture was cooled to RT, the resulting precipitate was filtered and the filtrate was loaded onto SCX (50 g), washed with MeOH and the product was isolated by eluting with 1% NH3 in MeOH to afford N-(4-(3-aminopentan-3-yl)thiazol-2-yl)cyclopropanesulfonamide (1.05 g, 3.27 mmol, 75% yield) as a colourless solid. Rt 0.56 min (HPLC, basic); m/z 273.0 (M-NH2+H)+ (ES+); 1H NMR (400 MHz, DMSO-d6) δ 7.70 (v. br s, 3H), 6.34 (s, 1H), 2.41-2.29 (m, 1H), 1.80 (app. q, J=7.4 Hz, 4H), 0.83-0.76 (m, 6H), 0.73-0.60 (m, 4H).


Methyl 2-(2-bromothiazol-4-yl)-4-methoxybutanoate INTE24



embedded image


To an ice cold solution of commercial methyl 2-(2-bromothiazol-4-yl)acetate (5.0 g, 21.9 mmol) in DMF (30 mL) was added NaH (60 wt % in mineral oil 0.93 g, 23.3 mmol) portion-wise over 5 min. The resulting mixture was allowed to warm to RT under vigorous stirring for 10 min, then cooled to 0° C. before a solution of 1-bromo-2-methoxyethane (2.09 mL, 22.24 mmol) in DMF (15 mL) was added dropwise over 1 min. The resulting mixture was allowed to warm to RT and stirred for 2 hrs. The mixture was carefully poured into sat. NH4Cl (aq, 100 mL) and the aqueous phase was extracted with EtOAc (3×20 mL). The combined organic extracts were dried over Na2SO4, filtered and the solvent was removed in vacuo. The crude product was purified by chromatography on silica gel (120 g column, 0-20% EtOAc/iso-hexane) to afford methyl 2-(2-bromothiazol-4-yl)-4-methoxybutanoate (3.35 g, 11.27 mmol, 53% yield) as an orange oil. Rt 1.14 (UPLC acidic); m/z 296 (81Br M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 7.59 (s, 1H), 3.96 (t, J=7.5 Hz, 1H), 3.61 (s, 3H), 3.31-3.19 (m, 2H), 3.18 (s, 3H), 2.26-2.14 (m, 1H), 2.09-1.95 (m, 1H).


2-(2-Bromothiazol-4-yl)-4-methoxybutanoic Acid INTE25



embedded image


Prepared as for INTE3 using methyl 2-(2-bromothiazol-4-yl)-4-methoxybutanoate INTE24 to afford 2-(2-bromothiazol-4-yl)-4-methoxybutanoic acid (99% yield) as a white solid. Rt 0.92 (UPLC acidic); m/z 280 (79Br M+H)+(ES+); 1H NMR (500 MHz, DMSO-d6) δ 12.55 (s, 1H), 7.54 (s, 1H), 3.84 (t, J=7.4 Hz, 1H), 3.30-3.26 (m, 1H), 3.26-3.20 (m, 1H), 3.20 (s, 3H), 2.21-2.12 (m, 1H), 2.02-1.93 (m, 1H).


Ethyl 2-(cyclopropanesulfonamido)-5-methylthiazole-4-carboxylate INTE26



embedded image


Prepared as for INTE1 using commercial ethyl 2-amino-5-methylthiazole-4-carboxylate to afford ethyl 2-(cyclopropanesulfonamido)-5-methylthiazole-4-carboxylate (43% yield) as an off-white solid. Rt 1.60 (HPLC acidic); m/z 291 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 12.78 (s, 1H), 4.27 (q, J=7.1 Hz, 2H), 2.68-2.58 (m, 1H), 2.49 (s, 3H), 1.30 (t, J=7.1 Hz, 3H), 0.98-0.66 (m, 4H).


Methyl 5-chloro-2-(cyclopropanesulfonamido)thiazole-4-carboxylate INTE27



embedded image


Prepared as for INTE1 using commercial methyl 2-amino-5-chlorothiazole-4-carboxylate to afford methyl 5-chloro-2-(cyclopropanesulfonamido)thiazole-4-carboxylate (29% yield) as an off-white solid. Rt 1.63 (HPLC acidic); m/z 297 (38Cl M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 13.07 (v. br. s, 1H), 3.84 (s, 3H), 2.81-2.68 (m, 1H), 1.03-0.90 (m, 4H).


N-(4-(2-Hydroxypropan-2-yl)-5-methylthiazol-2-yl)cyclopropanesulfonamide INTE28



embedded image


Prepared as for INTE12 using ethyl 2-(cyclopropanesulfonamido)-5-methylthiazole-4-carboxylate INTE26 to afford N-(4-(2-hydroxypropan-2-yl)-5-methylthiazol-2-yl)cyclopropanesulfonamide (37% yield) as an off-white solid. Rt 1.29 (HPLC acidic); m/z 277 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 11.84 (s, 1H), 5.36 (s, 1H), 2.61-2.51 (m, 1H), 2.27 (s, 3H), 1.43 (s, 6H), 0.90-0.73 (m, 4H).


N-(5-Chloro-4-(2-hydroxypropan-2-yl)thiazol-2-yl)cyclopropanesulfonamide INTE29



embedded image


Prepared as for INTE12 using methyl 5-chloro-2-(cyclopropanesulfonamido)thiazole-4-carboxylate INTE27 to afford N-(5-chloro-4-(2-hydroxypropan-2-yl)thiazol-2-yl)cyclopropanesulfonamide (44% yield) as an off-white solid. Rt 1.57 (HPLC acidic); m/z 297 (35Cl M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 12.27 (s, 1H), 5.63 (s, 1H), 2.69-2.59 (m, 1H), 1.49 (s, 6H), 1.01-0.84 (m, 4H).


2-Chloro-N-(2-(2-(cyclopropanesulfonamido)-5-methylthiazol-4-yl)propan-2-yl)acetamide INTE30



embedded image


Prepared as for INTE13 using N-(4-(2-hydroxypropan-2-yl)-5-methylthiazol-2-yl)cyclopropanesulfonamide INTE28 to afford 2-chloro-N-(2-(2-(cyclopropanesulfonamido)-5-methylthiazol-4-yl)propan-2-yl)acetamide (95% yield) as a yellow gum. Rt 1.36 (HPLC acidic); m/z 352 (35Cl M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 11.85 (s, 1H), 8.46 (s, 1H), 4.06 (s, 2H), 2.59-2.52 (m, 1H), 2.15 (s, 3H), 1.55 (s, 6H), 0.99-0.83 (m, 4H).


2-Chloro-N-(2-(5-chloro-2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)acetamide INTE31



embedded image


Prepared as for INTE13 using N-(5-chloro-4-(2-hydroxypropan-2-yl)thiazol-2-yl)cyclopropanesulfonamide INTE29 to afford 2-chloro-N-(2-(5-chloro-2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)acetamide (97% yield) as a yellow gum. Rt 1.61 (HPLC acidic); m/z 372 (35Cl M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 12.33 (s, 1H), 8.59 (s, 1H), 4.07 (s, 2H), 2.74-2.63 (m, 1H), 1.58 (s, 6H), 1.00-0.89 (m, 4H).


N-(4-(2-Aminopropan-2-yl)-5-methylthiazol-2-yl)cyclopropanesulfonamide INTE32



embedded image


Prepared as for INTE14 using 2-chloro-N-(2-(2-(cyclopropanesulfonamido)-5-methylthiazol-4-yl)propan-2-yl)acetamide INTE30 to afford N-(4-(2-aminopropan-2-yl)-5-methylthiazol-2-yl)cyclopropanesulfonamide (50% yield) as a white solid. Rt 1.23 (HPLC basic); m/z 276 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 7.87 (s, 3H), 2.39-2.27 (m, 1H), 2.20 (s, 3H), 1.51 (s, 6H), 0.84-0.69 (m, 2H), 0.69-0.56 (m, 2H).


N-(4-(2-Aminopropan-2-yl)-5-chlorothiazol-2-yl)cyclopropanesulfonamide INTE33



embedded image


Prepared as for INTE14 using 2-chloro-N-(2-(5-chloro-2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)acetamide INT31 to afford N-(4-(2-aminopropan-2-yl)-5-chlorothiazol-2-yl)cyclopropanesulfonamide (37% yield) as a white solid. Rt 1.23 (HPLC basic); m/z 296 (35Cl M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 8.21 (s, 3H), 2.36-2.23 (m, 1H), 1.58 (s, 6H), 0.80-0.73 (m, 2H), 0.73-0.61 (m, 2H).


Tert-Butyl (1-(2-bromothiazol-4-yl)cyclopropyl)carbamate INTE34



embedded image


A suspension of commercial 1-(2-bromothiazol-4-yl)cyclopropanecarboxylic acid (2.95 g, 11.9 mmol) in toluene (30 mL) was treated with t-BuOH (30 mL) and triethylamine (1.8 mL, 12.91 mmol) and then heated to 40° C. whereupon a solution was observed, DPPA (2.7 mL, 11.90 mmol) was then added. The reaction mixture was then heated to 100° C. for 3 hrs then allowed to cool to RT. The reaction mixture was then treated with sat. NaHCO3 (aq, 100 mL) and EtOAc (100 mL). The phases were separated and the organic phase washed with brine (20 mL), dried over Na2SO4, filtered and concentrated. The crude product was purified by chromatography on silica gel (40 g column, 0-100% EtOAc/iso-hexane) to afford tert-butyl (1-(2-bromothiazol-4-yl)cyclopropyl)carbamate (1.26 g, 3.55 mmol, 30% yield) as a colourless solid. Rt 1.23 (UPLC acidic); m/z 264 (79Br M+H-tBu)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 7.76 (s, 1H), 7.14 (s, 1H), 1.40 (s, 9H), 1.26-1.21 (m, 2H), 1.12-1.05 (m, 2H).


Tert-Butyl (1-(2-bromothiazol-4-yl)-3-methoxypropyl)carbamate INTE35



embedded image


Prepared as for INTE34 using 2-(2-bromothiazol-4-yl)-4-methoxybutanoic acid INTE25 to afford tert-butyl (1-(2-bromothiazol-4-yl)-3-methoxypropyl)carbamate (28% yield) as a colourless solid. Rt 1.38 (UPLC basic); m/z 251 (M+H-tBu)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 7.37 (s, 1H), 7.32 (d, J=8.7 Hz, 1H), 4.75-4.66 (m, 1H), 3.37-3.24 (m, 2H), 3.20 (s, 3H), 2.05-1.93 (m, 1H), 1.88-1.76 (m, 1H), 1.38 (s, 9H).


Tert-Butyl (1-(2-(cyclopropanesulfonamido)thiazol-4-yl)cyclopropyl)carbamate INTE36



embedded image


A suspension of cyclopropanesulfonamide (500 mg, 4.13 mmol), tert-butyl (1-(2-bromothiazol-4-yl)cyclopropyl)carbamate (1.26 g, 3.95 mmol) INTE34 and Cs2CO3 (4.0 g, 12.9 mmol) in dioxane (10 mL) was degassed (N2). To this suspension was added a degassed (N2) solution of t-BuXPhos (170 mg, 0.40 mmol) and [Pd(allyl)Cl]2 (75 mg, 0.204 mmol) in dioxane (5 mL). The reaction mixture was stirred at 90° C. for 18 hrs. An additional degassed (N2) solution of t-BuXPhos (170 mg, 0.400 mmol) and [Pd(allyl)Cl]2 (75 mg, 0.204 mmol) in dioxane (5 mL) was then added to the reaction mixture and the temperature was maintained at 90° C. for 18 hrs. The reaction mixture was cooled to RT then diluted with EtOAc (100 mL) and acidified with 1M HCl (50 mL). The phases were separated and the organic phase washed with brine (50 mL). The organic phase was dried over Na2SO4, filtered and concentrated onto silica (5 g). The crude product was purified by chromatography on silica gel (40 g column, 0-100% EtOAc/iso-hexane) to afford tert-butyl (1-(2-(cyclopropanesulfonamido)thiazol-4-yl)cyclopropyl)carbamate (427 mg, 1.13 mmol, 29% yield) as a colourless solid. Rt 1.72 (HPLC acidic); m/z 360 (79Br M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 12.12 (s, 1H), 7.57 (s, 1H), 6.27 (s, 1H), 2.61-2.54 (m, 1H), 1.37 (s, 9H), 1.25-1.19 (m, 2H), 1.09-1.00 (m, 2H), 0.99-0.85 (m, 4H).


Tert-Butyl (1-(2-(cyclopropanesulfonamido)thiazol-4-yl)-3-methoxypropyl)carbamate INTE37



embedded image


Prepared as for INTE36 using tert-butyl (1-(2-bromothiazol-4-yl)-3-methoxypropyl)carbamate INTE35 to afford tert-butyl (1-(2-(cyclopropanesulfonamido)thiazol-4-yl)-3-methoxypropyl)carbamate (47% yield) as a colourless solid. Rt 1.71 (HPLC acidic); m/z 392 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 12.48 (s, 1H), 7.17 (d, J=8.7 Hz, 1H), 6.43 (s, 1H), 4.57-4.44 (m, 1H), 3.39-3.25 (m, 2H), 3.21 (s, 3H), 2.63-2.55 (m, 1H), 2.00-1.86 (m, 1H), 1.84-1.67 (m, 1H), 1.39 (s, 9H), 0.99-0.81 (m, 4H).


N-(4-(1-Aminocyclopropyl)thiazol-2-yl)cyclopropanesulfonamide, HCl INTE38



embedded image


tert-Butyl (1-(2-(cyclopropanesulfonamido)thiazol-4-yl)cyclopropyl)carbamate (427 mg, 1.13 mmol) INTE36 was dissolved in 4M HCl in dioxane (5 mL) then stirred at RT for 1 hr. The reaction mixture was then concentrated in vacuo and the residue azeotroped with toluene (5 mL) then MeCN (2×5 mL) to afford N-(4-(1-aminocyclopropyl)thiazol-2-yl)cyclopropanesulfonamide, HCl (340 mg, 0.92 mmol, 82% yield) as a brown solid. Rt 0.25 (HPLC acidic); m/z 260 (M+H)+ (ES+); 1H NMR data not collected.


N-(4-(1-Amino-3-methoxypropyl)thiazol-2-yl)cyclopropanesulfonamide, HCl INTE39



embedded image


Prepared as for INTE37 using tert-butyl (1-(2-(cyclopropanesulfonamido)thiazol-4-yl)-3-methoxypropyl)carbamate to afford N-(4-(1-amino-3-methoxypropyl)thiazol-2-yl)cyclopropanesulfonamide, HCl (quantitative yield) as a colourless solid. Rt 0.84 (HPLC basic); m/z 292 (M+H)+ (ES+); 1H NMR data not collected.









TABLE 3







The following intermediates were made according to Method 1a or 1b (see preparation


of examples section for details).












Synthesis





Method,





[LCMS




Name/Structure
Method],




(All examples containing chiral
m/z




centres are racemates unless
(M + H)+,

1H NMR Chemical Shift Data



INT
stated)
(Rt/min)
(DMSO-d6 unless stated)





INTE18
4-Bromo-N-(2-(2-
Method 1b,
12.52 (s, 1H), 8.24 (s, 1H), 7.68 (d, J =



(cyclopropanesulfonamido)thiazol-4-
Using
8.3 Hz, 1H), 7.40 (d, J = 1.8 Hz, 1H), 7.26



yl)propan-2-yl)-2-methoxybenzamide   embedded image
INTE14, [UPLC acidic], 474 (1.27).
(dd, J = 8.3, 1.8 Hz, 1H), 6.49 (s, 1H), 3.96 (s, 3H), 2.61-2.54 (m, 1H), 1.61 (s, 6H), 0.94-0.84 (m, 4H).





INTE19
N-(2-(2-
Method 1a,
12.55 (s, 1H), 8.27 (s, 1H), 7.90-7.85



(Cyclopropanesulfonamido)thiazol-4-
Using
(m, 2H), 7.76-7.71 (m, 2H), 6.46 (s,



yl)propan-2-yl)-4-(4,4,5,5-tetramethyl-
INTE14,
1H), 2.60-2.52 (m, 1H), 1.61 (s, 6H),



1,3,2-dioxaborolan-2-yl)benzamide   embedded image
[UPLC acidic], 492 (1.38).
1.31 (s, 12H), 0.92-0.79 (m, 4H).





INTE20
N-(2-(2-
Method 1a,
12.57 (s, 1H), 8.35-8.27 (m, 1H), 7.78-



(Cyclopropanesulfonamido)thiazol-4-
Using
7.70 (m, 1H), 7.56-7.50 (m, 1H), 7.43-



yl)propan-2-yl)-2-fluoro-4-(4,4,5,5-
INTE14,
7.35 (m, 1H), 6.47 (s, 1H), 2.63-2.54



tetramethyl-1,3,2-dioxaborolan-2-
[UPLC
(m, 1H), 1.60 (s, 6H), 1.31 (s, 12H), 0.93-



yl)benzamide   embedded image
acidic], 510 (1.44).
0.82 (m, 4H).









Synthesis of Biaryl Acids and their Intermediates
2-Ethoxy-6-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrazine INTF1



embedded image


To a solution of 2-chloro-6-ethoxypyrazine (10.0 g, 59.9 mmol) in dioxane (200 mL) was successively added bispin (16.7 g, 65.9 mmol), KOAc (23.5 g, 240 mmol) and PdCl2(dppf)-CH2Cl2 (2.45 g, 3.00 mmol) at RT. The resulting mixture was degassed (N2) before heating at 110° C. for 2.5 hrs. The mixture was cooled to RT, filtered through celite and the solvent was removed in vacuo. The crude product was purified by chromatography on silica (220 g cartridge, 20-100% EtOAc/iso-hexanes). The crude product was then dissolved in EtOAc (20 mL) and washed with water (3×10 mL). The organic layer was dried (Na2SO4), filtered and the solvent was removed in vacuo. The product was re-purified by chromatography on silica (330 g cartridge, 0-100% EtOAc/iso-hexanes) and the product was dissolved in EtOAc (50 mL) and washed with water (4×30 mL). The organic layer was dried (Na2SO4), filtered and concentrated in vacuo to afford 2-ethoxy-6-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrazine (2.0 g, 7.60 mmol, 13% yield) as a thick pale yellow oil. 1H NMR (500 MHz, DMSO-d6) δ 8.38 (s, 1H), 8.30 (s, 1H), 4.36 (q, J=7.1 Hz, 2H), 1.34 (t, J=7.1 Hz, 3H), 1.32 (s, 12H).


Methyl 4-(6-ethoxypyrazin-2-yl)-2-methylbenzoate INTF2



embedded image


A solution of 2-ethoxy-6-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrazine INTF1 (200 mg, 0.80 mmol), methyl 4-bromo-2-methylbenzoate (183 mg, 0.80 mmol) and Cs2CO3 (700 mg, 2.15 mmol) in a mixture of dioxane (5 mL) and water (1 mL) at 35° C. was degassed (N2) then PdCl2(dppf)-CH2Cl2 (35 mg, 0.043 mmol) was added. The mixture was degassed (N2) then heated to 90° C. for 18 hrs. The reaction mixture was concentrated (to approx. 2 mL) then taken up with water (5 mL) and EtOAc (10 mL) and filtered through celite, eluting with EtOAc (20 mL). The phases were then diluted with water (10 mL) and partitioned. The organic phase was washed with brine (10 mL), dried (Na2SO4), filtered and concentrated onto silica (1 g). The crude product was purified by chromatography on silica (40 g cartridge, 0-30% EtOAc/iso-hexanes to afford methyl 4-(6-ethoxypyrazin-2-yl)-2-methylbenzoate (124 mg, 0.45 mmol, 56% yield) as a colourless solid. Rt 2.54 min (HPLC, acidic); m/z 273 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 8.88 (s, 1H), 8.29 (s, 1H), 8.11-8.08 (m, 1H), 8.05 (dd, J=8.2, 1.8 Hz, 1H), 7.95 (d, J=8.2 Hz, 1H), 4.49 (q, J=7.0 Hz, 2H), 3.86 (s, 3H), 2.61 (s, 3H), 1.41 (t, J=7.0 Hz, 3H).


Methyl 2-fluoro-4-(6-vinylpyrazin-2-yl)benzoate INTF3



embedded image


A stirred solution of potassium trifluoro(vinyl)borate (900 mg, 6.72 mmol), 2,6-dichloropyrazine (1 g, 6.71 mmol) and 2 M K2CO3 (10 mL, 20.0 mmol) in dioxane (80 mL) at 40° C. was degassed (N2) then treated with PdCl2(dppf)-CH2Cl2 (274 mg, 0.336 mmol), degassed (N2), then heated to 80° C. for 4 hrs. The reaction mixture was cooled to RT then (3-fluoro-4-(methoxycarbonyl)phenyl)boronic acid (1.33 g, 6.71 mmol) was added and the reaction mixture was heated to 100° C. for 18 hrs. The reaction mixture was cooled and concentrated (to approx. 10 mL). 1 M HCl (100 mL) and EtOAc (100 mL) were added and the reaction mixture was filtered through celite, further eluting with EtOAc (50 mL). The phases were partitioned and the organic phase was washed with brine (50 mL). The organic phase was dried (MgSO4), filtered and concentrated onto silica (5 g). The crude product was purified by chromatography on silica (40 g cartridge, 0-50% EtOAc/iso-hexanes) to afford methyl 2-fluoro-4-(6-vinylpyrazin-2-yl)benzoate (490 mg, 1.803 mmol, 27% yield) as a brown gum. Rt 2.24 min (HPLC, acidic); m/z 259 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 9.27 (s, 1H), 8.83 (s, 1H), 8.19 (d, J=1.0 Hz, 1H), 8.18-8.15 (m, 1H), 8.08-7.99 (m, 1H), 6.98 (dd, J=17.5, 10.9 Hz, 1H), 6.56 (dd, J=17.5, 1.3 Hz, 1H), 5.74 (dd, J=10.9, 1.4 Hz, 1H), 3.90 (s, 3H).


Methyl 4-(6-ethylpyrazin-2-yl)-2-fluorobenzoate INTF4



embedded image


A solution of methyl 2-fluoro-4-(6-vinylpyrazin-2-yl)benzoate INTF3 (490 mg, 1.88 mmol) in MeOH (10 mL) was prepared. The reaction mixture was hydrogenated in the H-Cube (10% Pd/C, 30×4 mm, full hydrogen, 35° C., 1 mL/min). The reaction mixture was concentrated to afford methyl 4-(6-ethylpyrazin-2-yl)-2-fluorobenzoate (470 mg; 1.77 mmol; 93% yield); Rt 2.27 min (HPLC, acidic); m/z 261 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 9.20 (s, 1H), 8.63 (s, 1H), 8.15-8.09 (m, 2H), 8.07-8.00 (m, 1H), 3.89 (s, 3H), 2.89 (q, J=7.6 Hz, 2H), 1.32 (t, J=7.6 Hz, 3H).


Method C: Suzuki Coupling




embedded image


A solution of boronic acid (1 eq), aryl halide (1.05 eq.) and Cs2CO3 (3 eq.) in a mixture of dioxane (40 volumes) and water (6 volumes) was degassed (N2, 5 mins). PdCl2(dppf).CH2Cl2 (5 mol %) was added and the reaction was further degassed (N2) before being heated to 90° C. for 18 hrs. The reaction mixture was filtered through celite before an aqueous workup was undertaken, followed by purification by normal phase chromatography.









TABLE 4







The following intermediates were made according to Method C.












Synthesis





Method, [LCMS





Method], m/z

1H NMR Chemical Shift Data



INT
Name/Structure
(M + H)+, (Rt/min)
(DMSO-d6 unless stated)













INTF5
tert-butyl 4-(5-methylpyridin-3-
Using Ar2Br,
8.75 (d, J = 2.2 Hz, 1H), 8.51-



yl)benzoate   embedded image
[HPLC acidic], 270 (1.93).
8.39 (m, 1H), 8.03-7.98 (m, 3H), 7.88-7.82 (m, 2H), 2.4 (s, 3H), 1.57 (s, 9H).





INTF6
tert-butyl 4-(5-(trifluoromethyl)pyridin-3-
Using Ar2Br,
9.27 (d, J = 2.2 Hz, 1H), 9.03



yl)benzoate   embedded image
[HPLC acidic], 324 (2.78).
(dd, J = 2.2, 1.0 Hz, 1H), 8.61- 8.41 (m, 1H), 8.22-7.83 (m, 4H), 1.58 (s, 9H).





INTF7
tert-butyl 4-(5-fluoropyridin-3-
Using Ar2Br,
8.87 (d, J = 1.9 Hz, 1H), 8.64



yl)benzoate   embedded image
[HPLC acidic], 274 (2.56).
(d, J = 2.7 Hz, 1H), 8.22-8.09 (m, 1H), 8.06-7.98 (m, 2H), 7.98-7.89 (m, 2H), 1.57 (s, 9H).





INTF8
tert-butyl 4-(6-chloropyrazin-2-
Using Ar2Cl,
No 1H NMR recorded.



yl)benzoate   embedded image
[UPLC acidic], 290 35Cl isotope, (1.53).






INTF9
tert-butyl 4-(6-(trifluoromethyl)pyrazin-2-
Using Ar2Cl,
9.70 (s, 1H), 9.23 (s, 1H), 8.40-



yl)benzoate   embedded image
[HPLC acidic], no ionisation (2.83).
8.30 (m, 2H), 8.12-8.03 (m, 2H), 1.59 (s, 9H).





INTF10
tert-butyl 4-(6-methylpyrazin-2-
Using Ar2Cl,
9.24-9.02 (m, 1H), 8.57 (s,



yl)benzoate   embedded image
[HPLC acidic], 271 (2.54).
1H), 8.44-8.14 (m, 2H), 8.14- 7.68 (m, 2H), 2.63-2.52 (m, 3H), 1.57 (s, 9H).





INTF11
tert-butyl 4-(6-isopropoxypyrazin-2-
Using Ar2Cl,
8.86 (s, 1H), 8.30-8.21 (m,



yl)benzoate   embedded image
[UPLC acidic], 315 (1.97).
3H), 8.06-8.02 (m, 2H), 5.41 (hept, J = 6.2 Hz, 1H), 1.58 (s, 9H), 1.40 (d, J = 6.2 Hz, 6H).





INTF12
methyl 4-(5-chloropyridin-3-yl)benzoate   embedded image
Using Ar2Cl, [HPLC acidic], 247 35Cl isotope, (2.20).
8.94 (d, J = 2.0 Hz, 1H), 8.69 (d, J = 2.2 Hz, 1H), 8.35 (t, J = 2.2 Hz, 1H), 8.10-8.01 (m, 2H), 8.00-7.89 (m, 2H), 3.89 (s, 3H).





INTF13
methyl 2-fluoro-4-(5-
Using Ar2Cl
No 1H NMR recorded.



(trifluoromethyl)pyridin-3-yl)benzoate   embedded image
[HPLC acidic], 300 (2.30).






INTF14
methyl 4-(5-chloropyridin-3-yl)-2-
Using Ar2Br
No 1H NMR recorded.



fluorobenzoate   embedded image
[HPLC acidic], 266 35Cl isotope (2.20).






INTF15
methyl 2-fluoro-4-(6-
Using Ar2Cl,
9.73 (s, 1H), 9.25 (s, 1H), 8.23-



(trifluoromethyl)pyrazin-2-yl)benzoate   embedded image
[UPLC acidic], 301 (1.53).
8.13 (m, 2H), 8.09 (dd, J = 8.5, 7.5 Hz, 1H), 3.90 (s, 3H).





INTF16
methyl 4-(6-ethoxypyrazin-2-yl)-2-
Using Ar2Cl,
8.94 (s, 1H), 8.34 (s, 1H), 8.12-



fluorobenzoate   embedded image
[UPLC acidic], 277 (1.53).
8.08 (m, 2H), 8.04-8.00 (m, 1H), 4.50 (q, J = 7.0 Hz, 2H), 3.89 (s, 3H), 1.41 (t, J = 7.0 Hz, 3H).





INTF17
methyl 2-fluoro-4-(6-isopropoxypyrazin-
Using Ar2Cl,
8.91 (s, 1H), 8.28 (s, 1H), 8.13-



2-yl)benzoate   embedded image
[UPLC acidic], 291 (1.63).
7.94 (m, 3H), 5.43 (hept, J = 6.1 Hz, 1H), 3.89 (s, 3H), 1.39 (d, J = 6.2 Hz, 6H).





INTF18
tert-butyl 4-(6-ethoxypyrazin-2-
Using Ar2Cl,
8.87 (s, 1H), 8.30 (s, 1H), 8.26-



yl)benzoate   embedded image
[HPLC acidic], 301 (2.89).
8.22 (m, 2H), 8.06-7.98 (m, 2H), 4.48 (q, J = 7.1 Hz, 2H), 1.57 (s, 9H), 1.40 (t, J = 7.0 Hz, 3H).





INTF19
methyl 2-fluoro-4-(6-(2,2,2-
Using Ar2Cl,
9.11 (s, 1H), 8.56 (s, 1H), 8.23



trifluoroethoxy)pyrazin-2-yl)benzoate   embedded image
[HPLC acidic], 331 (2.44).
(dd, J = 12.3, 1.7 Hz, 1H), 8.18 (dd, J = 8.2, 1.7 Hz, 1H), 8.06- 8.01 (m, 1H), 5.24 (q, J = 9.0 Hz, 2H), 3.90 (s, 3H).





INTF20
tert-butyl 4-(6-(2,2,2-
Using Ar2Cl,
9.06 (s, 1H), 8.52 (s, 1H), 8.44-



trifluoroethoxy)pyrazin-2-yl)benzoate   embedded image
[UPLC acidic], 355 (2.88)
8.24 (m, 2H), 8.06-8.01 (m, 2H), 5.22 (q, J = 9.0 Hz, 2H), 1.58 (s, 9H).





INTF21
methyl 4-(6-ethoxypyrazin-2-yl)-2-
Using Ar2Cl,
9.01 (d, J = 1.6 Hz, 1H), 8.56-



(trifluoromethyl)benzoate   embedded image
[UPLC acidic], 327 (2.59)
8.52 (m, 2H), 8.37 (d, J = 1.6 Hz, 1H), 8.01 (d, J = 8.4 Hz, 1H), 4.58-4.41 (m, 2H), 3.91 (s, 3H), 1.42 (t, J = 7.0 Hz, 3H).





INTF22
methyl 2-methyl-4-(6-
Using Ar2Cl,
9.69 (s, 1H), 9.21 (s, 1H), 8.19



(trifluoromethyl)pyrazin-2-yl)benzoate   embedded image
[UPLC acidic], 297 (1.62)
(d, J = 1.8 Hz, 1H), 8.14 (dd, J = 8.2, 1.8 Hz, 1H), 8.01 (d, J = 8.2 Hz, 1H), 3.88 (s, 3H), 2.64 (s, 3H).





INTF23
5-(6-ethoxypyrazin-2-yl)-3-
Using Ar2Cl,
9.38 (t, J = 1.6 Hz, 1H), 9.05



fluoropicolinonitrile   embedded image
[HPLC acidic], 245 (2.17)
(s, 1H), 8.76 (dd, J = 10.2, 1.6 Hz, 1H), 8.43 (s, 1H), 4.53 (q, J = 7.0 Hz, 2H), 1.41 (t, J = 7.0 Hz, 3H).









Method D: Ester Deprotection with TFA




embedded image


A solution of the ester (1 eq) in DCM (20 volumes) was treated with TFA (10 eq.) and stirred at RT for 3 hrs. The reaction mixture was then concentrated and azeotroped with MeOH and MeCN. No further purification was undertaken.


Method E: Ester Deprotection with Base




embedded image


A solution of the ester (1 eq) in a mixture of THF/MeOH (4/1 volumes) was treated with LiOH (2.2-6 eq.) and stirred between RT and 50° C. for between 3 hrs and 18 hrs. The organic solvents were removed in vacuo then acidified with 1 M HCl and extracted with EtOAc. The organic phases were combined, dried (Na2SO4), filtered and concentrated. The products were used directly in the next step with no further purification undertaken.


Method F: Potassium Salt Formation




embedded image


A solution of the ester (1 eq.) in THE (4 volumes) was treated with TMSOK (1 eq.) and stirred at RT for 2 hrs before the reaction mixtures were filtered and washed with iso-hexanes. The products were used directly in the next step with no further purification undertaken.









TABLE 5







The following intermediates were made according to Method D, E or F.












Synthesis Method,





[LCMS Method],

1H NMR Chemical Shift





m/z (M + H)+,
Data


INT
Name/Structure
(Rt/min)
(DMSO-d6 unless stated)





INTF24
4-(5-methylpyridin-3-yl)benzoic acid   embedded image
Method D, Using INTF5, [HPLC acidic], 214 (0.95).
9.02-8.94 (m, 1H), 8.70- 8.63 (m, 1H), 8.47 (s, 1H), 8.14-8.06 (m, 2H), 8.00- 7.90 (m, 2H), 2.49 (s, 3H), O—H not observed.





INTF25
4-(5-(trifluoromethyl)pyridin-3-yl)benzoic
Method D, Using
13.12 (s, 1H), 9.28 (d, J =



acid   embedded image
INTF6, [HPLC acidic], 268 (2.01).
2.2 Hz, 1H), 9.03 (dd, J = 2.2, 1.0 Hz, 1H), 8.56 (d, J = 2.2 Hz, 1H), 8.13- 8.04 (m, 2H), 8.04-7.86 (m, 2H).





INTF26
4-(5-fluoropyridin-3-yl)benzoic acid   embedded image
Method D, Using INTF7, [HPLC acidic], 218 (1.67).
8.87 (t, J = 1.8 Hz, 1H), 8.64 (d, J = 2.7 Hz, 1H), 8.17 (ddd, J = 10.3, 2.7, 1.8 Hz, 1H), 8.07-8.03 (m, 2H), 7.97-7.90 (m, 2H), OH not observed.





INTF27
4-(6-chloropyrazin-2-yl)benzoic acid   embedded image
Method D, Using INTF8, [HPLC acidic], 234 35Cl isotope, (1.91).
No NMR recorded.





INTF28
4-(6-(trifluoromethyl)pyrazin-2-yl)benzoic
Method D, Using
13.25 (s, 1H), 9.70 (s,



acid   embedded image
INTF9, [UPLC acidic], 269 (1.33).
1H), 9.23 (s, 1H), 8.42- 8.20 (m, 2H), 8.20-8.00 (m, 2H).





INTF29
4-(6-methylpyrazin-2-yl)benzoic acid   embedded image
Method D, Using INTF10, [HPLC acidic], 215 (1.60).
9.13 (s, 1H), 8.57 (s, 1H), 8.31-8.23 (m, 2H), 8.09- 8.04 (m, 2H), 2.59 (s, 3H), OH not observed.





INTF30
4-(6-isopropoxypyrazin-2-yl)benzoic acid   embedded image
Method D, Using INTF11, [UPLC acidic], 259 (1.40).
13.13 (s, 1H) 8.87 (s, 1H), 8.27-8.20 (m, 3H), 8.09- 8.05 (m, 2H), 5.43 (p, J = 6.2 Hz, 1H), 1.40 (d, J = 6.2 Hz, 6H).





INTF31
potassium 4-(5-chloropyridin-3-yl)benzoate   embedded image
Method F, Using INTF12, [UPLC acidic], 234 35Cl isotope, ionises as free acid, (1.18).
8.87 (d, J = 2.0 Hz, 1H), 8.59 (d, J = 2.2 Hz, 1H), 8.23 (t, J = 2.2 Hz, 1H), 7.95-7.86 (m, 2H), 7.72- 7.55 (m, 2H).





INTF32
potassium 2-fluoro-4-(5-
Method F,
9.22 (d, J = 2.2 Hz, 1H),



(trifluoromethyl)pyridin-3-yl)benzoate   embedded image
Using INTF13, [HPLC acidic], 286 ionises as free acid, (2.01).
8.95 (d, J = 2.1 Hz, 1H), 8.48 (d, J = 2.3 Hz, 1H), 7.64-7.45 (m, 3H).





INTF33
potassium 4-(5-chloropyridin-3-yl)-2-
Method F,
8.91-8.85 (m, 1H), 8.63-



fluorobenzoate   embedded image
Using INTF14, [HPLC acidic], 251 35Cl isotope, ionises as free acid, (1.88).
8.54 (m, 1H), 8.30-8.20 (m, 1H), 7.59-7.49 (m, 1H), 7.49-7.34 (m, 2H).





INTF34
2-fluoro-4-(6-(trifluoromethyl)pyrazin-2-
Method E, Using
13.53 (s, 1H), 9.72 (s,



yl)benzoic acid   embedded image
INTF15, [HPLC acidic], 287 (2.08).
1H), 9.25 (s, 1H), 8.19- 8.12 (m, 2H), 8.11-7.99 (m, 1H).





INTF35
4-(6-ethoxypyrazin-2-yl)-2-fluorobenzoic
Method E, Using
13.40 (s, 1H), 8.94 (s,



acid   embedded image
INTF16, [HPLC acidic], 263 (2.07).
1H), 8.34 (s, 1H), 8.12- 8.03 (m, 2H), 8.03-7.92 (m, 1H), 4.50 (q, J = 7.0 Hz, 2H), 1.41 (t, J = 7.0 Hz, 3H).





INTF36
2-fluoro-4-(6-isopropoxypyrazin-2-
Method E, Using
13.53 (s, 1H), 8.90 (s,



yl)benzoic acid   embedded image
INTF17, [HPLC acidic], 277 (2.24).
1H), 8.27 (s, 1H), 8.08- 7.87 (m, 3H), 5.43 (hept, J = 6.2 Hz, 1H), 1.39 (d, J = 6.2 Hz, 6H).





INTF37
4-(6-ethoxypyrazin-2-yl)benzoic acid   embedded image
Method D, Using INTF18, [UPLC acidic], 245 (1.29)
13.15 (v. br. s, 1H), 8.89 (s, 1H), 8.31 (s, 1H), 8.29- 8.22 (m, 2H), 8.11-8.01 (m, 2H), 4.51 (q, J = 7.0 Hz, 2H), 1.42 (t, J = 7.0 Hz, 3H).





INTF38
4-(6-ethoxypyrazin-2-yl)-2-methylbenzoic
Method E, Using
12.97 (s, 1H), 8.87 (s,



acid   embedded image
INTF2, [HPLC acidic], 259 (2.17)
1H), 8.29 (s, 1H), 8.07- 8.05 (m, 1H), 8.03 (dd, J = 8.2, 1.9 Hz, 1H), 7.94 (d, J = 8.2 Hz, 1H), 4.49 (q, J = 7.0 Hz, 2H), 2.62 (s, 3H), 1.41 (t, J = 7.0 Hz, 3H).





INTF39
4-(6-ethylpyrazin-2-yl)-2-fluorobenzoic acid   embedded image
Method E, Using INTF4, [HPLC acidic], 247 (1.91)
13.40 (s, 1H), 9.19 (s, 1H), 8.63 (s, 1H), 8.13- 8.05 (m, 2H), 8.01 (t, J = 7.9 Hz, 1H), 2.89 (q, J = 7.6 Hz, 2H), 1.32 (t, J = 7.6 Hz, 3H).





INTF40
2-fluoro-4-(6-(2,2,2-trifluoro ethoxy)pyrazin-
Method E, Using
13.44 (s, 1H), 9.10 (s,



2-yl)benzoic acid   embedded image
INTF19, [UPLC acidic], 317 (1.38)
1H), 8.55 (s, 1H), 8.23- 8.12 (m, 2H), 8.03-7.95 (m, 1H), 5.24 (q, J = 9.0 Hz, 2H).





INTF41
4-(6-(2,2,2-trifluoroethoxy)pyrazin-2-
Method D, Using
13.16 (s, 1H), 9.06 (s,



yl)benzoic acid   embedded image
INTF20 [UPLC acidic], 299 (1.37)
1H), 8.52 (s, 1H), 8.41- 8.27 (m, 2H), 8.13-8.03 (m, 2H), 5.22 (q, J = 9.0 Hz, 2H).





INTF42
4-(6-ethoxypyrazin-2-yl)-2-
Method E, Using
13.75 (s, 1H), 8.98 (s,



(trifluoromethyl)benzoic acid   embedded image
INTF21, [UPLC acidic], 313 (2.30)
1H), 8.52-8.46 (m, 2H), 8.35 (s, 1H), 7.97 (d, J = 7.9 Hz, 1H), 4.49 (q, J = 7.0 Hz, 2H), 1.42 (t, J = 7.0 Hz, 3H).





INTF43
2-methyl-4-(6-(trifluoromethyl) pyrazin-2-
Method E, Using
13.06 (s, 1H), 9.66 (s,



yl)benzoic acid   embedded image
INTF22, [HPLC acidic], 283 (2.20)
1H), 9.18 (s, 1H), 8.14- 8.11 (m, 1H), 8.09 (dd, J = 8.1, 1.9 Hz, 1H), 7.99 (d, J = 8.1 Hz, 1H), 2.63 (s, 3H).









5-(6-Ethoxypyrazin-2-yl)-3-fluoropicolinic Acid INTF44



embedded image


A suspension of 5-(6-ethoxypyrazin-2-yl)-3-fluoropicolinonitrile INTF23 (630 mg, 2.58 mmol) in conc. HCl (10 mL) was heated to reflux for 1 hr. The reaction mixture was allowed to cool to RT. This was then concentrated in vacuo, then suspended in TBME (20 mL) and filtered, washing with iso-hexanes (10 mL) to afford 5-(6-ethoxypyrazin-2-yl)-3-fluoropicolinic acid (750 mg, 2.28 mmol, 88% yield) as an orange solid. Rt 1.74 min (HPLC, acidic); m/z 264 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 9.26 (t, J=1.6 Hz, 1H), 9.02 (s, 1H), 8.54 (dd, J=11.5, 1.6 Hz, 1H), 8.39 (s, 1H), 4.52 (q, J=7.0 Hz, 2H), 1.41 (t, J=7.0 Hz, 3H), 0-H not observed.


(5-(6-(Trifluoromethyl)pyrazin-2-yl)pyridin-2-yl)methanol INTF45



embedded image


A suspension of (5-bromopyridin-2-yl)methanol (1 g, 5.32 mmol), Bispin (1.5 g, 5.91 mmol) and KOAc (1.6 g, 16.0 mmol) in dioxane (20 mL) was heated to 30° C. then degassed (N2). PdCl2(dppf)-CH2Cl2 (0.217 g, 0.266 mmol) was added and the reaction mixture heated to 90° C. for 2 hrs. The reaction mixture was cooled to 40° C. whereupon 2-chloro-6-(trifluoromethyl)pyrazine (0.97 g, 5.32 mmol), Cs2CO3 (3.47 g, 10.6 mmol) and water (5 mL) were added. The mixture was degassed (N2), then PdCl2(dppf)-CH2Cl2 (0.217 g, 0.266 mmol) was added and the mixture was again degassed (N2). The reaction mixture was then heated to 90° C. for 18 hrs. The reaction mixture was part concentrated (to approx. 5 mL) then taken up with water (20 mL) and EtOAc (50 mL) and passed through celite, eluting with EtOAc (20 mL). The phases were then diluted with water (20 mL) and partitioned. The organic phase was washed with brine (30 mL), dried (Na2SO4), filtered and concentrated onto silica (5 g). The crude product was purified by chromatography on silica (40 g cartridge, 0-100% EtOAc/iso-hexanes) to afford (5-(6-(trifluoromethyl)pyrazin-2-yl)pyridin-2-yl)methanol (980 mg, 3.76 mmol, 71% yield) as an off-white solid. Rt 1.38 min (HPLC, acidic); m/z 256 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 9.69 (s, 1H), 9.28 (d, J=2.3 Hz, 1H), 9.20 (s, 1H), 8.56 (dd, J=8.2, 2.3 Hz, 1H), 7.70 (d, J=8.2 Hz, 1H), 5.59 (t, J=5.8 Hz, 1H), 4.67 (d, J=5.8 Hz, 2H).


(5-(6-Chloropyrazin-2-yl)pyridin-2-yl)methanol INTF46



embedded image


Prepared as for INTF45 using (5-bromopyridin-2-yl)methanol and 2,6-dichloropyrazine to afford (5-(6-chloropyrazin-2-yl)pyridin-2-yl)methanol (27% yield) as a brown solid. Rt 1.10 min (HPLC, acidic); m/z 222 (35Cl M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 9.36 (s, 1H), 9.22 (s, 1H), 8.81 (s, 1H), 8.50 (d, J=8.2 Hz, 1H), 7.66 (d, J=8.2 Hz, 1H), 5.57 (t, J=6.0 Hz, 1H), 4.66 (d, J=6.0 Hz, 2H).


(5-(6-Ethoxypyrazin-2-yl)pyridin-2-yl)methanol INTF47



embedded image


Prepared as for INTF45 using (5-bromopyridin-2-yl)methanol and 2-chloro-6-ethoxypyrazine to afford (5-(6-ethoxypyrazin-2-yl)pyridin-2-yl)methanol (54% yield) as a brown solid. Rt 1.34 min (HPLC, acidic); m/z 232 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 9.27-9.09 (m, 1H), 8.87 (s, 1H), 8.49 (dd, J=8.2, 2.3 Hz, 1H), 8.29 (s, 1H), 7.62 (d, J=8.2 Hz, 1H), 5.53 (t, J=5.9 Hz, 1H), 4.64 (d, J=5.9 Hz, 2H), 4.50 (q, J=7.1 Hz, 2H), 1.41 (t, J=7.1 Hz, 3H).


5-(6-(Trifluoromethyl)pyrazin-2-yl)picolinaldehyde INTF48



embedded image


A solution of (5-(6-(trifluoromethyl)pyrazin-2-yl)pyridin-2-yl)methanol INTF45 (980 mg, 3.84 mmol) in CH2Cl2 (15 mL) was treated with manganese dioxide (3 g, 34.5 mmol). The reaction was stirred for 4 hrs at RT then filtered through celite and concentrated onto silica (4 g). The crude product was purified by chromatography on silica (24 g cartridge, 0-100% EtOAc/iso-hexanes) to afford 5-(6-(trifluoromethyl)pyrazin-2-yl)picolinaldehyde (541 mg, 2.04 mmol, 55% yield) as a colourless solid. Rt 1.82 min (HPLC, acidic); m/z 254 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 10.09 (s, 1H), 9.82 (s, 1H), 9.60 (dd, J=2.2, 0.8 Hz, 1H), 9.30 (s, 1H), 8.79 (dd, J=8.1, 2.2 Hz, 1H), 8.14 (dd, J=8.1, 0.8 Hz, 1H).


5-(6-Chloropyrazin-2-yl)picolinaldehyde INTF49



embedded image


Prepared as for INTF48 using (5-(6-chloropyrazin-2-yl)pyridin-2-yl)methanol INTF46 to afford 5-(6-chloropyrazin-2-yl)picolinaldehyde (39% yield) as a colourless solid. Rt 1.63 min (HPLC, acidic); m/z 220 (38Cl M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 10.08 (d, J=0.8 Hz, 1H), 9.55 (dd, J=2.2, 0.9 Hz, 1H), 9.50 (s, 1H), 8.92 (s, 1H), 8.74 (ddd, J=8.1, 2.2, 0.9 Hz, 1H), 8.11 (dd, J=8.1, 0.9 Hz, 1H).


5-(6-Ethoxypyrazin-2-yl)picolinaldehyde INTF50



embedded image


Prepared as for INTF48 using (5-(6-ethoxypyrazin-2-yl)pyridin-2-yl)methanol INTF47 to afford 5-(6-ethoxypyrazin-2-yl)picolinaldehyde (42% yield) as a colourless solid. Rt 1.85 min (HPLC, acidic); m/z 230 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 10.07 (d, J=0.8 Hz, 1H), 9.55 (dd, J=2.2, 0.9 Hz, 1H), 9.03 (s, 1H), 8.73 (ddd, J=8.1, 2.2, 0.8 Hz, 1H), 8.39 (s, 1H), 8.08 (dd, J=8.1, 0.9 Hz, 1H), 4.53 (q, J=7.0 Hz, 2H), 1.42 (t, J=7.0 Hz, 3H).


5-(6-(Trifluoromethyl)pyrazin-2-yl)picolinic acid INTF51



embedded image


A solution of 5-(6-(trifluoromethyl)pyrazin-2-yl)picolinaldehyde INTF48 (200 mg, 0.79 mmol) in DMF (2 mL) was treated with oxone (650 mg, 1.06 mmol). The reaction mixture was stirred at RT for 4 days. The reaction mixture was diluted with water (10 mL) and filtered. The filtrate was then taken up in EtOAc (10 mL) and heated to 40° C. to afford a free flowing suspension. This was then treated dropwise with iso-hexanes (10 mL), cooled to RT and filtered to afford 5-(6-(trifluoromethyl)pyrazin-2-yl)picolinic acid (180 mg, 0.56 mmol, 68% yield) as a colourless solid. 1H NMR (500 MHz, DMSO-d6) δ 9.78 (s, 1H), 9.48 (dd, J=2.4, 0.8 Hz, 1H), 9.28 (s, 1H), 8.72 (dd, J=8.2, 2.3 Hz, 1H), 8.24 (dd, J=8.2, 0.8 Hz, 1H), v. br OH observed, not reported.


5-(6-Chloropyrazin-2-yl)picolinic Acid INTF52



embedded image


Prepared as for INTF51 using 5-(6-chloropyrazin-2-yl)picolinaldehyde INTF49 to afford 5-(6-chloropyrazin-2-yl)picolinic acid (82% yield) as a colourless solid. Rt 1.32 min (HPLC, acidic); m/z 236 (35Cl M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 13.30 (s, 1H), 9.46 (s, 1H), 9.42 (d, J=2.1 Hz, 1H), 8.90 (s, 1H), 8.66 (dd, J=8.2, 2.1 Hz, 1H), 8.21 (d, J=8.2 Hz, 1H).


5-(6-Ethoxypyrazin-2-yl)picolinic Acid INTF53



embedded image


Prepared as for INTF51 using 5-(6-ethoxypyrazin-2-yl)picolinaldehyde INTF50 to afford 5-(6-ethoxypyrazin-2-yl)picolinic acid (71% yield) as a colourless solid. Rt 1.45 min (HPLC, acidic); m/z 246 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 13.31 (s, 1H), 9.46-9.38 (m, 1H), 8.98 (s, 1H), 8.64 (dd, J=8.1, 2.3 Hz, 1H), 8.36 (s, 1H), 8.17 (dd, J=8.1, 0.8 Hz, 1H), 4.51 (q, J=7.0 Hz, 2H), 1.42 (t, J=7.0 Hz, 3H).


Preparation of Examples

Method 1: Amide Coupling




embedded image


Method 1a: HATU (1.2 eq.) was added to a solution of appropriate acid (1 eq.), amine (1 eq.) and DIPEA (3 eq.) in DMF (10 volumes) at RT. The reaction was stirred at RT for 18 hrs. The solvent was removed and the crude product was purified by normal phase chromatography, reverse phase chromatography or trituration from an appropriate solvent.


Method 1b: 1-chloro-N,N,2-trimethylprop-1-en-1-amine (2 eq.) was added to a solution of appropriate acid (1 eq.) in DCM (20 volumes). The reaction mixture was stirred at RT for 2 hrs. The reaction mixture was concentrated in vacuo and the residue dissolved in DCM (20 volumes) before addition of DIPEA (3 eq.) and the appropriate amine (1 eq). The reaction mixture was stirred at RT for 2 hrs. An aqueous work up was performed and the crude product was purified by normal phase chromatography, reverse phase chromatography or trituration from an appropriate solvent.


Method 1c: T3P (50 wt % in EtOAc, 2.5 eq.) was added to a solution of appropriate acid (1 eq.), amine (1 eq.) and pyridine (3 eq.) in a mixture of EtOAc (20 volumes) and DMF (10 volumes). The reaction was stirred for 1 hr at RT. An aqueous work up was performed and the crude product was purified by normal phase chromatography, reverse phase chromatography or trituration from an appropriate solvent.


Method 2a: Suzuki [ArB(OR)2 Core]




embedded image


PdCl2(dppf)-CH2Cl2 (10 mol %) or other appropriate catalyst was added to a degassed (N2, 5 mins) solution of Ar1-B(OR)2 (1 eq.), Ar2-halide (1 eq.) and K2CO3 (3 eq.) in dioxane (10 volumes) and water (1 volumes). The solution was then degassed further (N2, 5 mins) and heated to 90° C. for 1-2 hrs. The reaction mixture was allowed to cool to RT. An aqueous workup was performed and the crude product was purified by normal phase chromatography, reverse phase chromatography or trituration from an appropriate solvent.


Method 2b: Telescoped Miyaura Borylation/Suzuki Protocol




embedded image


A suspension of Ar1-Br (1 eq.), Bispin (1.1 eq.) and KOAc (2 eq.) in dioxane (50 volumes) was degassed (N2) then charged with PdCl2(dppf).CH2Cl2 (5 mol %) and again degassed (N2). The reaction mixture was heated to 90° C. for 1-24 hrs, recharging the Pd-catalyst if required. On formation of the boronate ester the reaction was allowed to cool to RT. Ar2-Z (1 eq.) and 2 M K2CO3 (aq, 2 eq.) were added, degassed (N2) and the reaction was then heated to 90° C. for 18 hrs. The reaction was allowed to cool to RT, an aqueous work up was performed and the crude compound was purified by normal phase chromatography.


Representative for Method 1a
N-((2-(cyclopropanesulfonamido)thiazol-4-yl)methyl)-4-(pyridin-3-yl)benzamide R1



embedded image


A solution of N-(4-(aminomethyl)thiazol-2-yl)cyclopropanesulfonamide INTE9 (64 mg, 0.274 mmol), 4-(pyridin-3-yl)benzoic acid (54.6 mg, 0.274 mmol) and DIPEA (0.14 mL, 0.82 mmol) in DMF (0.5 mL) was treated with HATU (110 mg, 0.288 mmol) and stirred at RT for 18 hrs. EtOAc (20 mL) was added and the organic phase was washed with water (10 mL) and brine (10 mL), dried (Na2SO4), filtered and concentrated onto silica (300 mg). The crude product was purified by chromatography on silica (12 g column, 0-7% (0.7 M ammonia/MeOH)/DCM). The crude product was further purified by reverse phase chromatography on C18 silica (12 g column, 10-40% MeCN/water 0.1% formic acid) to afford N-((2-(cyclopropanesulfonamido)thiazol-4-yl)methyl)-4-(pyridin-3-yl)benzamide (18 mg, 0.041 mmol, 15% yield) as a colourless solid. Rt 1.08 min (HPLC, HPLC Acidic); m/z 415 (M+H)+(ES+); 1H NMR (400 MHz, DMSO-d6) δ 12.57 (s, 1H), 9.04-8.94 (m, 2H), 8.62 (dd, J=4.8, 1.6 Hz, 1H), 8.17-8.14 (m, 1H), 8.06-7.98 (m, 2H), 7.92-7.84 (m, 2H), 7.50-7.48 (m, 1H), 6.53 (s, 1H), 4.35-4.33 (m, 2H), 2.64-2.52 (m, 1H), 0.09-0.87 (m, 4H).


Representative for Method 1b
N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(5-(trifluoromethyl)pyridin-3-yl)benzamide R2



embedded image


A suspension of 4-(5-(trifluoromethyl)pyridin-3-yl)benzoic acid INTF25 (46.2 mg, 0.173 mmol) in DCM (2 mL) was treated with 1-chloro-N,N,2-trimethylprop-1-en-1-amine (0.046 mL, 0.346 mmol) and stirred at RT for 1 hr before being concentrated. The residue was taken up in DCM (3 mL), treated with DIPEA (0.091 mL, 0.518 mmol) and stirred for 5 mins before N-(4-(1-aminopropyl)thiazol-2-yl)cyclopropanesulfonamide INTE10 (45 mg, 0.17 mmol) was added and the reaction mixture was stirred at RT for 16 hrs. The reaction mixture was treated with NH4Cl (sat. aq., 5 mL) and passed through a phase separator, further extracting with DCM (5 mL). The organic phase was concentrated onto silica (500 mg) and the crude product was purified by chromatography on silica [12 g column, 0-100% EtOAc (2% MeOH)/iso-hexanes] to afford N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(5-(trifluoromethyl)pyridin-3-yl)benzamide (46 mg, 0.085 mmol, 49% yield) as a colourless solid. Rt 1.99 min (HPLC, acidic); m/z 511 (M+H)+ (ES+); 1H NMR (400 MHz, DMSO-d6) δ 12.60 (s, 1H), 9.30 (d, J=2.1 Hz, 1H), 9.03 (d, J=2.1 Hz, 1H), 8.74 (d, J=8.3 Hz, 1H), 8.56 (s, 1H), 8.09-7.97 (m, 4H), 6.56 (s, 1H), 4.90 (q, J=7.9 Hz, 1H), 2.64-2.51 (m, 1H), 1.98-1.74 (m, 2H), 0.98-0.81 (m, 7H).


The racemic mixture R2 was separated by chiral preparative HPLC using chiral method A. A salt exchange (TFA to HCl) was undertaken by adding 1.25 M HCl (EtOH, 2 mL×5) and removing solvent to afford:


Peak 1: Stereochemistry of Product was not Defined R3


N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(5-(trifluoromethyl)pyridin-3-yl)benzamide. HCl R3 (13 mg, 0.023 mmol, 37% yield) was isolated as a colourless solid. Rt=1.30 min (UPLC, acidic); m/z 511 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 12.61 (s, 1H), 9.30 (s, 1H), 9.03 (d, J=2.2 Hz, 1H), 8.75 (d, J=8.3 Hz, 1H), 8.56 (s, 1H), 8.09-8.04 (m, 2H), 8.03-7.98 (m, 2H), 6.57 (s, 1H), 4.94-4.87 (m, 1H), 2.64-2.51 (m, 1H), 1.97-1.74 (m, 2H), 0.96-0.85 (m, 7H). Signal for HCl not observed


The product was analysed by Chiral HPLC, chiral IA method 1: [Daicel Chiralpak IA, 5 um, 4.6×250 mm, 45 min method, 1.0 mL/min, 5-95% (gradient over 45 min) EtOH (0.2% TFA) in iso-hexanes (0.2% TFA)]; Rt=14.8 min, >98% @ 254 nm.


Peak 2: Stereochemistry of Product was not Defined R4


N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(5-(trifluoromethyl)pyridin-3-yl)benzamide. HCl R4 (12 mg, 0.021 mmol, 34% yield) was obtained as a colourless solid. Rt=1.30 min (UPLC, acidic); m/z 511 (M+H)+ (ES+); 1H NMR (500 MHz, DMSO-d6) δ 12.61 (s, 1H), 9.30 (d, J=2.2 Hz, 1H), 9.03 (d, J=2.1 Hz, 1H), 8.75 (d, J=8.1 Hz, 1H), 8.56 (s, 1H), 8.08-8.04 (m, 2H), 8.03-7.99 (m, 2H), 6.57 (s, 1H), 4.95-4.85 (m, 1H), 2.64-2.51 (m, 1H), 1.97-1.73 (m, 2H), 0.97-0.82 (m, 7H). Signal for HCl not observed


The product was analysed by Chiral HPLC, chiral IA method 1: [Daicel Chiralpak IA, 5 um, 4.6×250 mm, 45 min method, 1.0 mL/min, 5-95% (gradient over 45 min) EtOH (0.2% TFA) in iso-hexanes (0.2% TFA)]; Rt=16.8 min, >98% @ 254 nm.


Representative for Method 1c
N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide R5



embedded image


A solution of 4-(6-(trifluoromethyl)pyrazin-2-yl)benzoic acid INTF28 (15.4 mg, 0.057 mmol) and N-(4-(1-aminopropyl)thiazol-2-yl)cyclopropanesulfonamide INTE10 (15 mg, 0.057 mmol) in DMF (0.25 mL) was treated with pyridine (0.014 mL, 0.172 mmol) and T3P (50% wt. in DMF, 0.125 mL, 0.172 mmol). The reaction mixture was allowed to stir at RT over 16 hrs. The crude product was treated with water (0.05 mL) and purified by reverse phase chromatography on C18 silica (12 g column, 10-50% MeCN/10 mM ammonium bicarbonate) to afford N-(1-(2-(cyclopropanesulfonamido)thiazol-4-yl)propyl)-4-(6-(trifluoromethyl)pyrazin-2-yl)benzamide (2.5 mg, 0.004 mmol, 8% yield) as a colourless solid. Rt 1.34 min (UPLC, acidic); m/z 512 (M+H)+ (ES+). 1H NMR (400 MHz, Chloroform-d) δ 9.30 (s, 1H), 8.95 (s, 1H), 8.18 (d, J=8.3 Hz, 2H), 8.12 (d, J=84 Hz, 2H), 8.04 (d, J=8.1 Hz, 1H), 6.51 (s, 1H), 5.09-4.95 (m, 1H), 2.56.2.53 (m, 1H), 2.17-1.89 (m, 2H), 1.32-1.09 (m, 2H), 1.09-0.71 (m, 5H), N—H not observed.


Representative for Method 2a
N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(6-ethoxypyrazin-2-yl)-2-fluorobenzamide R6



embedded image


A solution of N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-2-fluoro-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzamide INTE20 (80 mg, 0.157 mmol), 2 M potassium carbonate (aq, 0.16 mL, 0.314 mmol) and 2-chloro-6-ethoxypyrazine (25 mg, 0.157 mmol) in MeCN (15 mL) and water (2 mL) was degassed (N2) at 40° C. whereupon PdCl2(dppf)-CH2Cl2 (6.4 mg, 0.008 mmol) was added to form a suspension. The mixture was degassed (N2) then heated to 90° C. for 3 hrs. The reaction was cooled to RT, concentrated directly onto silica (1 g) and was purified by chromatography on silica (12 g column, 0-100% EtOAc/iso-hexanes) to afford N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(6-ethoxypyrazin-2-yl)-2-fluorobenzamide (13 mg, 0.025 mmol, 16% yield) as a colourless solid. Rt 1.34 min (UPLC, acidic); m/z 506 (M+H)+ (ES+). 1H NMR (400 MHz, DMSO-d6) δ 12.58 (s, 1H), 8.93 (s, 1H), 8.36 (s, 1H), 8.32 (s, 1H), 8.11-7.96 (m, 2H), 7.84 (t, J=7.7 Hz, 1H), 6.50 (d, J=8.5 Hz, 1H), 4.50 (q, J=7.0 Hz, 2H), 2.63-2.54 (m, 1H), 1.63 (s, 6H), 1.41 (t, J=7.0 Hz, 3H), 0.95-0.83 (m, 4H).


Representative for Method 2b
N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(6-ethoxypyrazin-2-yl)-2-methoxybenzamide R7



embedded image


A suspension of 4-bromo-N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-2-methoxybenzamide INTE18 (100 mg, 0.211 mmol), Bispin (59 mg, 0.232 mmol) and KOAc (41 mg, 0.422 mmol) in dioxane (5 mL) was degassed (N2) then charged with PdCl2(dppf)-CH2Cl2 (8.6 mg, 0.011 mmol) and degassed (N2). The reaction mixture was heated to 90° C. for 16 hrs. The reaction mixture was allowed to cool then filtered through celite. This was then recharged with KOAc (41 mg, 0.422 mmol), Bispin (59 mg, 0.232 mmol) and PdCl2(dppf)-CH2Cl2 (8.6 mg, 0.011 mmol), degassed (N2) then heated to 90° C. for 2 hrs. To the reaction mixture was added 2-chloro-6-ethoxypyrazine (33.4 mg, 0.211 mmol) and 2 M potassium carbonate (aq, 0.21 mL, 0.422 mmol) and heated to 90° C. for 16 hrs. The reaction mixture was allowed to cool to RT then diluted with EtOAc (10 mL) and water (10 mL), filtered over celite eluting with EtOAc (10 mL). The phases were then partitioned, washed with brine (10 mL), dried (Na2SO4), filtered and concentrated onto silica (500 mg). The crude product was purified by chromatography on silica (12 g cartridge, 0-100% EtOAc/iso-hexanes). The resulting product was re-purified by preparative HPLC (Varian, Basic (0.1% ammonium bicarbonate), 15-5 0% MeCN in water) to afford N-(2-(2-(cyclopropanesulfonamido)thiazol-4-yl)propan-2-yl)-4-(6-ethoxypyrazin-2-yl)-2-methoxybenzamide (20 mg, 0.037 mmol, 17% yield) as a colourless solid. Rt 2.17 min (HPLC acidic); m/z 518 (M+H)+ (ES+). 1H NMR (500 MHz, DMSO-d6) δ 12.56 (s, 1H), 8.94 (s, 1H), 8.39 (s, 1H), 8.30 (s, 1H), 7.91 (d, J=8.1 Hz, 1H), 7.86 (d, J=1.5 Hz, 1H), 7.82 (dd, J=8.1, 1.5 Hz, 1H), 6.49 (s, 1H), 4.50 (q, J=7.0 Hz, 2H), 4.07 (s, 3H), 2.59-2.52 (m, 1H), 1.65 (s, 6H), 1.41 (t, J=7.0 Hz, 3H), 0.95-0.76 (m, 4H).









TABLE 6







The following final compounds were made according to general methods











Name/Structure
Synthesis Method,




(All examples containing
[LCMS Method],




chiral centres are racemic
m/z (M + H)+,

1H NMR Chemical Shift Data



R
unless stated)
(RT/Min)
(DMSO-d6 unless stated)





R8 
N-((2-(cyclopropanesulfon-
Method 1a, Using
12.55 (s, 1H), 9.26 (t, J = 6.2 Hz,



amido)thiazol-4-yl)methyl)-5-
INTE9 and
1H), 8.99 (dd, J = 2.3, 0.8 Hz, 1H),



phenylpicolinamide
commercial acid,
8.31 (dd, J = 8.2, 2.3 Hz, 1H),





embedded image


[UPLC Basic], 415, (1.23)
8.13 (dd, J = 8.2, 0.8 Hz, 1H), 7.87-7.77 (m, 2H), 7.61-7.53 (m, 2H), 7.52-7.43 (m, 1H), 6.50 (s, 1H), 4.38 (dd, J = 6.3, 1.2 Hz, 2H), 2.62-2.55 (m, 1H), 0.96- 0.81 (m, 4H).





R9 
N-((2-(cyclopropanesulfon-
Method 1a, Using
12.58 (s, 1H), 8.97 (t, J = 5.6 Hz,



amido)thiazol-4-yl)methyl)-
INTE9 and
1H), 8.05-7.95 (m, 2H), 7.84-



[1,1′-biphenyl]-4-carboxamide
commercial acid
7.70 (m, 4H), 7.55-7.46 (m, 2H),





embedded image


[HPLC Basic], 414, (1.72)
7.45-7.36 (m, 1H), 6.53 (s, 1H), 4.34 (d, J = 5.4 Hz, 2H), 2.63- 2.54 (m, 1H), 0.93-0.86 (m, 4H).





R10
N-((2-(cyclopropanesulfon-
Method 1a, Using
12.60 (s, 1H), 9.73 (s, 1H), 9.24



amido)thiazol-4-yl)methyl)-2-
INTE9 and INTF34,
(s, 1H), 9.04-8.78 (m, 1H), 8.23-



fluoro-4-(6-(trifluoromethyl)-
[UPLC Acidic], 502,
8.08 (m, 2H), 7.98-7.81 (m, 1H),



pyrazin-2-yl)benzamide
(1.24)
6.54 (s, 1H), 4.35 (d, J = 5.6 Hz,





embedded image



2H), 2.62-2.55 (m, 1H), 0.94- 0.79 (m, 4H).





R11
N-((2-(cyclopropanesulfon-
Method 1a, Using
12.58 (s, 1H), 8.93 (s, 1H), 8.88-



amido)thiazol-4-yl)methyl)-4-
INTE9 and INTF35,
8.83 (m, 1H), 8.32 (s, 1H), 8.11-



(6-ethoxypyrazin-2-yl)-2-
[UPLC Acidic], 478,
8.04 (m, 2H), 7.88-7.79 (m, 1H),



fluorobenzamide
(1.22)
6.54 (s, 1H), 4.50 (q, J = 7.0 Hz,





embedded image



2H), 4.34 (d, J = 5.6 Hz, 2H), 2.62- 2.54 (m, 1H), 1.41 (t, J = 7.0 Hz, 3H), 0.93-0.81 (m, 4H).





R12
N-((2-(cyclopropanesulfon-
Method 1a, Using
12.60 (s, 1H), 9.71 (s, 1H), 9.20



amido)thiazol-4-yl)methyl)-4-
INTE9 and INTF28,
(s, 1H), 9.14-9.01 (m, 1H), 8.35-



(6-(trifluoromethyl)pyrazin-2-
[UPLC Acidic], 484,
8.31 (m, 2H), 8.11-8.06 (m, 2H),



yl)benzamide
(1.21)
6.55 (s, 1H), 4.35 (d, J = 5.5 Hz,





embedded image



2H), 2.61-2.55 (m, 1H), 0.94- 0.77 (m, 4H).





R13
N-((2-(cyclopropanesulfon-
Method 1a, Using
12.59 (s, 1H), 9.05-8.99 (m, 1H),



amido)thiazol-4-yl)methyl)-4-
INTE9 and INTF30,
8.87 (s, 1H), 8.26-8.19 (m, 3H),



(6-isopropoxypyrazin-2-
[UPLC Acidic], 474,
8.05-8.01 (m, 2H), 6.54 (s, 1H),



yl)benzamide
(1.28)
5.48-5.37 (m, 1H), 4.35 (d, J =





embedded image



5.4 Hz, 2H), 2.61-2.55 (m, 1H), 1.39 (d, J = 6.1 Hz, 6H), 0.92- 0.82 (m, 4H).





R14
N-((2-(cyclopropanesulfon-
Method 1a, Using
12.60 (s, 1H), 9.03 (t, J = 5.6 Hz,



amido)thiazol-4-yl)methyl)-4-
INTE9 and INTE37,
1H), 8.90 (s, 1H), 8.30 (s, 1H),



(6-ethoxypyrazin-2-
[UPLC Acidic], 460,
8.28-8.22 (m, 2H), 8.08-8.00



yl)benzamide
(1.18)
(m, 2H), 6.54 (s, 1H), 4.51 (q, J =





embedded image



7.1 Hz, 2H), 4.35 (d, J = 5.4 Hz, 2H), 2.61-2.55 (m, 1H), 1.42 (t, J = 7.0 Hz, 3H), 0.95-0.84 (m, 4H).





R15
N-(3-(2-(cyclopropanesulfon-
Method 1b, Using
12.52 (s, 1H), 9.30 (d, J = 2.1 Hz,



amido)thiazol-4-yl)pentan-3-
INTE17 and
1H), 9.02 (dd, J = 2.1, 0.9 Hz, 1H),



yl)-4-(5-(trifluoromethyl)
INTF25, [HPLC
8.56 (s, 1H), 8.12-7.95 (m, 5H),



pyridin-3-yl)benzamide
acidic], 539, (2.13)
6.50 (s, 1H), 2.60-2.53 (m, 1H),





embedded image



2.27-2.13 (m, 2H), 1.91-1.70 (m, 2H), 0.93-0.85 (m, 4H), 0.77- 0.69 (m, 6H).





R16
N-(3-(2-(cyclopropanesulfon-
Method 1b, Using
12.50 (s, 1H), 8.89 (t, J = 1.8 Hz,



amido)thiazol-4-yl)pentan-3-
INTE17 and
1H), 8.62 (d, J = 2.7 Hz, 1H), 8.17



yl)-4-(5-fluoropyridin-3-
INTF26, [HPLC
(ddd, J = 10.3, 2.8, 1.9 Hz, 1H),



yl)benzamide
Acidic], 489, (1.9)
8.07-7.98 (m, 3H), 7.97-7.86





embedded image



(m, 2H), 6.48 (s, 1H), 2.60-2.52 (m, 1H), 2.29-2.15 (m, 2H), 1.87- 1.71 (m, 2H), 0.92-0.82 (m, 4H), 0.73 (t, J = 7.3 Hz, 6H).





R17
N-(3-(2-(cyclopropanesulfon-
Method 1b, Using
12.50 (s, 1H), 8.77 (d, J = 2.2 Hz,



amido)thiazol-4-yl)pentan-3-
INTE17 and
1H), 8.46 (dd, J = 2.0, 0.8 Hz, 1H),



yl)-4-(5-methylpyridin-3-
INTF24, [HPLC
8.08-7.96 (m, 4H), 7.89-7.79



yl)benzamide
acidic], 485, (1.36)
(m, 2H), 6.49 (s, 1H), 2.61-2.55





embedded image



(m, 1H), 2.40 (s, 3H), 2.29-2.12 (m, 2H), 1.88-1.75 (m, 2H), 0.94- 0.83 (m, 4H), 0.73 (t, J = 7.2 Hz, 6H).





R18
N-(3-(2-(cyclopropanesulfon-
Method 1b, Using
12.50 (s, 1H), 8.98 (dd, J = 2.4,



amido)thiazol-4-yl)pentan-3-
INTE17 and
0.9 Hz, 1H), 8.62 (dd, J = 4.8, 1.6



yl)-4-(pyridin-3-yl)benzamide
commercial acid,
Hz, 1H), 8.20-8.12 (m, 1H), 8.07-





embedded image


[HPLC Acidic], 471, (1.36)
7.97 (m, 3H), 7.91-7.82 (m, 2H), 7.53 (ddd, J = 8.1, 4.8, 0.9 Hz, 1H), 6.49 (s, 1H), 2.61-2.54 (m, 1H), 2.28-2.12 (m, 2H), 1.89- 1.73 (m, 2H), 0.94-0.82 (m, 4H), 0.74 (t, J = 7.3 Hz, 6H).





R19
N-(3-(2-(cyclopropanesulfon-
Method 1b, Using
12.53 (s, 1H), 9.72 (s, 1H), 9.21



amido)thiazol-4-yl)pentan-3-
INTE17 and
(s, 1H), 8.35-8.28 (m, 2H), 8.17-



yl)-4-(6-(trifluoromethyl)
INTF28, [UPLC
8.04 (m, 3H), 6.51 (s, 1H), 2.59-



pyrazin-2-yl)benzamide
acidic], 540, (1.44)
2.53 (m, 1H), 2.28-2.14 (m, 2H),





embedded image



1.87-1.74 (m, 2H), 0.92-0.84 (m, 4H), 0.74 (t, J = 7.4 Hz, 6H).





R20
4-(6-chloropyrazin-2-yl)-N-(3-
Method 1b, Using
12.52 (s, 1H), 9.38 (s, 1H), 8.81



(2-(cyclopropanesulfonamido)
INTE17 and
(s, 1H), 8.29-8.21 (m, 2H), 8.15-



thiazol-4-yl)pentan-3-
INTF27, [HPLC
8.02 (m, 3H), 6.49 (s, 1H), 2.60-



yl)benzamide
acidic], 506 35Cl
2.50 (m, 1H), 2.28-2.12 (m, 2H),





embedded image


isotope, (2.06)
1.90-1.72 (m, 2H), 0.92-0.82 (m, 4H), 0.78-0.61 (m, 6H).





R21
N-(3-(2-(cyclopropanesulfon-
Method 1b, Using
12.52 (s, 1H), 9.15 (s, 1H), 8.57



amido)thiazol-4-yl)pentan-3-
INTE17 and
(s, 1H), 8.28-8.20 (m, 2H), 8.08-



yl)-4-(6-methylpyrazin-2-
INTF29, [HPLC
8.01 (m, 3H), 6.50 (s, 1H), 2.60 (s,



yl)benzamide
Acidic], 486, (1.89)
3H), 2.60-2.54 (m, 1H), 2.26-





embedded image



2.16 (m, 2H), 1.86-1.76 (m, 2H), 0.92-0.84 (m, 4H), 0.74 (t, J = 7.4 Hz, 6H).





R22
N-(3-(2-(cyclopropanesulfon-
Method 1b, Using
12.51 (s, 1H), 9.35 (d, J = 1.5 Hz,



amido)thiazol-4-yl)pentan-3-
INTE17 and
1H), 8.77 (dd, J = 2.5, 1.5 Hz, 1H),



yl)-4-(pyrazin-2-yl)benzamide
commercial acid,
8.67 (d, J = 2.5 Hz, 1H), 8.28-





embedded image


[HPLC Acidic], 472, (1.77)
8.22 (m, 2H), 8.08-8.00 (m, 3H), 6.49 (s, 1H), 2.59-2.51 (m, 1H), 2.26-2.14 (m, 2H), 1.86-1.72 (m, 2H), 0.92-0.84 (m, 4H), 0.73 (t, J = 7.3 Hz, 6H).





R23
N-(2-(2-(cyclopropanesulfon-
Method 1a, Using
12.60 (s, 1H), 9.24 (d, J = 1.4 Hz,



amido)thiazol-4-yl)propan-2-
INTE14 and INTF44
1H), 9.02 (s, 1H), 8.59-8.46 (m,



yl)-5-(6-ethoxypyrazin-2-yl)-3-
[HPLC Acidic], 507,
2H), 8.39 (s, 1H), 6.54 (s, 1H),



fluoropicolinamide
(1.99)
4.52 (q, J = 7.0 Hz, 2H), 2.63-





embedded image



2.53 (m, 1H), 1.67 (s, 6H), 1.41 (t, J = 7.0 Hz, 3H), 0.93-0.85 (m, 4H).





R24
N-(2-(2-(cyclopropanesulfon-
Method 1a, Using
12.64 (s, 1H), 9.80 (s, 1H), 9.47



amido)thiazol-4-yl)propan-2-
INTE14 and INTF51
(d, J = 2.1 Hz, 1H), 9.29 (s, 1H),



yl)-5-(6-
[HPLC Acidic], 513,
8.76 (dd, J = 8.2, 2.2 Hz, 1H),



(trifluoromethyl)pyrazin-2-
(2.06)
8.51 (s, 1H), 8.21 (d, J = 8.2 Hz,



yl)picolinamide

1H), 6.58 (s, 1H), 2.60-2.53 (m,





embedded image



1H), 1.71 (s, 6H), 0.94-0.79 (m, 4H).





R25
5-(6-chloropyrazin-2-yl)-N-(2-
Method 1a, Using
12.62 (s, 1H), 9.46 (s, 1H), 9.39



(2-(cyclopropanesulfonamido)
INTE14 and
(d, J = 2.2 Hz, 1H), 8.89 (s, 1H),



thiazol-4-yl)propan-2-
INTF52, [HPLC
8.69 (dd, J = 8.2, 2.2 Hz, 1H),



yl)picolinamide
Acidic], 479 35Cl
8.51 (s, 1H), 8.17 (d, J = 8.1 Hz,





embedded image


isotope, (1.92)
1H), 6.55 (s, 1H), 2.60-2.53 (m, 1H), 1.70 (s, 6H), 0.91-0.81 (m, 4H).





R26
N-(2-(2-(cyclopropanesulfon-
Method 1a, Using
12.62 (s, 1H), 9.41 (d, J = 2.2 Hz,



amido)thiazol-4-yl)propan-2-
INTE14 and INTF53
1H), 8.99 (s, 1H), 8.69 (dd, J =



yl)-5-(6-ethoxypyrazin-2-
[HPLC Acidic], 489,
8.2, 2.2 Hz, 1H), 8.47 (s, 1H), 8.37



yl)picolinamide
(2.04)
(s, 1H), 8.13 (d, J = 8.1 Hz, 1H),





embedded image



6.56 (s, 1H), 4.51 (q, J = 7.0 Hz, 2H), 2.59-2.53 (m, 1H), 1.70 (s, 6H), 1.41 (t, J = 7.0 Hz, 3H), 0.95- 0.83 (m, 4H).





R27
N-(2-(2-(cyclopropanesulfon-
Method 1a, Using
12.59 (s, 1H), 9.13 (d, J = 2.2 Hz,



amido)thiazol-4-yl)propan-2-
INTE14 and
1H), 8.81-8.74 (m, 1H), 8.59 (s,



yl)-[2,2′-bipyridine]-5-
commercial acid
1H), 8.51-8.45 (m, 2H), 8.45 (s,



carboxamide
[HPLC Acidic], 444,
1H), 8.09-7.92 (m, 1H), 7.52





embedded image


(1.39)
(ddd, J = 7.5, 4.7, 1.2 Hz, 1H), 6.52 (s, 1H), 2.62-2.54 (m, 1H), 1.65 (s, 6H), 0.96-0.84 (m, 4H).





R28
4-(5-chloropyridin-3-yl)-N-(2-
Method 1a, Using
12.57 (s, 1H), 8.98-8.93 (m, 1H),



(2-(cyclopropanesulfon-
INTE14 and
8.72-8.65 (m, 1H), 8.40-8.32



amido)thiazol-4-yl)propan-2-
INTF31, [UPLC
(m, 2H), 8.04-7.97 (m, 2H), 7.97-



yl)benzamide
Acidic], 477 35Cl
7.89 (m, 2H), 6.46 (s, 1H), 2.63-





embedded image


isotope, (1.2)
2.53 (m, 1H), 1.64 (s, 6H), 0.94- 0.82 (m, 4H).





R29
N-(2-(2-(cyclopropanesulfon-
Method 2a, Using
12.59 (s, 1H), 9.31 (d, J = 2.2 Hz,



amido)thiazol-4-yl)propan-2-
INTE20 and
1H), 9.04-9.01 (m, 1H), 8.60 (s,



yl)-2-fluoro-4-(5-
commercial coupling
1H), 8.39 (s, 1H), 7.92 (d, J = 11.9



(trifluoromethyl)pyridin-3-
partner, [UPLC
Hz, 1H), 7.89-7.82 (m, 2H), 6.49



yl)benzamide
Acidic], 529, (1.32)
(s, 1H), 2.62-2.54 (m, 1H), 1.63





embedded image



(s, 6H), 0.94-0.84 (m, 4H).





R30
4-(5-chloropyridin-3-yl)-N-(2-
Method 1a, Using
12.59 (s, 1H), 8.98 (d, J = 2.1 Hz,



(2-(cyclopropanesulfon-
INTE14 and
1H), 8.69 (d, J = 2.2 Hz, 1H), 8.40



amido)thiazol-4-yl)propan-2-
INTF33, [UPLC
(t, J = 2.2 Hz, 1H), 8.37 (s, 1H),



yl)-2-fluorobenzamide
Acidic], 495 35Cl
7.87-7.81 (m, 2H), 7.78 (dd, J =





embedded image


isotope, (1.24)
8.1, 1.7 Hz, 1H), 6.48 (s, 1H), 2.62- 2.54 (m, 1H), 1.63 (s, 6H), 0.96- 0.81 (m, 4H).





R31
N-(2-(2-(cyclopropanesulfon-
Method 2a, Using
12.58 (s, 1H), 8.91 (d, J = 1.9 Hz,



amido)thiazol-4-yl)propan-2-
INTE20 and
1H), 8.64 (d, J = 2.6 Hz, 1H), 8.37



yl)-2-fluoro-4-(5-fluoropyridin-
commercial coupling
(s, 1H), 8.27-8.15 (m, 1H), 7.88-



3-yl)benzamide
partner, [UPLC
7.74 (m, 3H), 6.49 (s, 1H), 2.65-





embedded image


Acidic], 479, (1.15)
2.51 (m, 1H), 1.62 (s, 6H), 0.94- 0.81 (m, 4H).





R32
N-(2-(2-(cyclopropanesulfon-
Method 2b, Using
12.56 (s, 1H), 9.31 (d, J = 2.2 Hz,



amido)thiazol-4-yl)propan-2-
INTE18 and
1H), 9.02 (dd, J = 2.1, 0.9 Hz, 1H),



yl)-2-methoxy-4-(5-
commercial coupling
8.59 (t, J = 2.3 Hz, 1H), 8.51-



(trifluoromethyl)pyridin-3-
partner, [HPLC
8.26 (m, 1H), 7.91 (d, J = 7.9 Hz,



yl)benzamide
Acidic], 541, (2.16)
1H), 7.61 (d, J = 1.7 Hz, 1H), 7.54





embedded image



(dd, J = 8.1, 1.7 Hz, 1H), 6.48 (s, 4.08 (s, 3H), 2.59-2.53 (m, 1H), 1.65 (s, 6H), 0.94-0.78 (m, 4H).





R33
N-(2-(2-
Method 2a, Using
12.55 (s, 1H), 8.49 (dd, J = 4.8,



(cyclopropanesulfonamido)
INTE19 and
1.8 Hz, 1H), 8.30 (s, 1H), 8.00-



thiazol-4-yl)propan-2-yl)-4-(2-
commercial coupling
7.91 (m, 2H), 7.62 (dd, J = 7.7, 1.8



methylpyridin-3-yl)benzamide
partner, [HPLC
Hz, 1H), 7.53-7.47 (m, 2H), 7.33





embedded image


acidic], 457, (1.04)
(dd, J = 7.7, 4.8 Hz, 1H), 6.46 (s, 1H), 2.60-2.52 (m, 1H), 2.44 (s, 3H), 1.63 (s, 6H), 0.94-0.77 (m, 4H).





R34
4-(5-acetylpyridin-3-yl)-N-(2-(2-
Method 2a, Using
12.57 (s, 1H), 9.19 (d, J = 2.3 Hz,



(cyclopropanesulfon-
INTE19 and
1H), 9.14 (d, J = 2.0 Hz, 1H), 8.55



amido)thiazol-4-yl)propan-2-
commercial coupling
(t, J = 2.2 Hz, 1H), 8.34 (s, 1H),



yl)benzamide
partner, [HPLC
8.08-8.00 (m, 2H), 7.98-7.91





embedded image


acidic], 485, (1.59)
(m, 2H), 6.47 (s, 1H), 2.72 (s, 3H), 2.61-2.51 (m, 1H), 1.64 (s, 6H), 0.93-0.82 (m, 4H).





R35
N-(2-(2-(cyclopropanesulfon-
Method 2a, Using
12.57 (s, 1H), 9.29 (d, J = 2.1 Hz,



amido)thiazol-4-yl)propan-2-
INTE19 and
1H), 9.03-8.97 (m, 1H), 8.58-



yl)-4-(5-(trifluoromethyl)pyridin-
commercial coupling
8.50 (m, 1H), 8.36 (s, 1H), 8.06-



3-yl)benzamide
partner, [HPLC
7.96 (m, 4H), 6.47 (s, 1H), 2.59-





embedded image


Basic], 511, (1.79)
2.51 (m, 1H), 1.63 (s, 6H), 0.92- 0.80 (m, 4H).





R36
N-(2-(2-(cyclopropanesulfon-
Method 2a, Using
12.56 (s, 1H), 8.91-8.84 (m, 1H),



amido)thiazol-4-yl)propan-2-
INTE19 and
8.62 (d, J = 2.7 Hz, 1H), 8.34 (s,



yl)-4-(5-fluoropyridin-3-
commercial coupling
1H), 8.20-8.13 (m, 1H), 8.04-



yl)benzamide
partner, [HPLC
7.97 (m, 2H), 7.96-7.89 (m, 2H),





embedded image


Basic], 461, (1.54)
6.47 (s, 1H), 2.58-2.52 (m, 1H), 1.63 (s, 6H), 0.91-0.83 (m, 4H).





R37
N-(2-(2-(cyclopropanesulfon-
Method 1b, Using
12.55 (s, 1H), 8.77 (d, J = 2.2 Hz,



amido)thiazol-4-yl)propan-2-
INTE14 and
1H), 8.46 (dd, J = 2.1, 0.8 Hz, 1H),



yl)-4-(5-methylpyridin-3-
INTF24, [UPLC
8.31 (s, 1H), 8.02-7.93 (m, 3H),



yl)benzamide
Acidic], 457, (0.74)
7.89-7.81 (m, 2H), 6.48 (s, 1H),





embedded image



2.61-2.53 (m, 1H), 2.40 (s, 3H), 1.64 (s, 6H), 0.97-0.71 (m, 4H).





R38
N-(2-(2-(cyclopropanesulfon-
Method 1b, Using
12.56 (s, 1H), 8.57 (d, J = 1.9 Hz,



amido)thiazol-4-yl)propan-2-
INTE14 and
1H), 8.34 (d, J = 2.8 Hz, 1H), 8.31



yl)-4-(5-methoxypyridin-3-
commercial acid,
(s, 1H), 8.05-7.96 (m, 2H), 7.92-



yl)benzamide
[UPLC Acidic], 473,
7.83 (m, 2H), 7.70 (dd, J = 2.8, 1.9





embedded image


(0.9)
Hz, 1H), 6.48 (s, 1H), 3.94 (s, 3H), 2.63-2.50 (m, 1H), 1.64 (s, 6H), 0.96-0.82 (m, 4H).





R39
N-(2-(2-(cyclopropanesulfon-
Method 1b, Using
12.56 (s, 1H), 8.98 (dd, J = 2.5,



amido)thiazol-4-yl)propan-2-
INTE14 and
0.9 Hz, 1H), 8.62 (dd, J = 4.7, 1.6



yl)-4-(pyridin-3-yl)benzamide
commercial acid,
Hz, 1H), 8.31 (s, 1H), 8.17 (ddd,





embedded image


[HPLC Acidic], 443, (1.18)
J = 8.0, 2.5, 1.6 Hz, 1H), 8.04-7.96 (m, 2H), 7.90-7.82 (m, 2H), 7.53 (ddd, J = 8.0, 4.8, 0.9 Hz, 1H), 6.48 (s, 1H), 1.64 (s, 6H), 1.00- 0.78 (m, 4H), 1 × CH obscured





R40
N-(2-(2-(cyclopropanesulfon-
Method 1a, Using
12.57 (s, 1H), 8.33 (s, 1H), 8.11-



amido)thiazol-4-yl)propan-2-
INTE14 and
8.04 (m, 2H), 8.04-7.99 (m, 2H),



yl)-3′-(trifluoromethyl)-[1,1′-
commercial acid,
7.91-7.85 (m, 2H), 7.80-7.69



biphenyl]-4-carboxamide
[HPLC Acidic], 510,
(m, 2H), 6.48 (s, 1H), 2.60-2.54





embedded image


(2.35)
(m, 1H), 1.64 (s, 6H), 0.93-0.84 (m, 4H).





R41
N-(2-(2-(cyclopropanesulfon-
Method 1a, Using
12.59 (s, 1H), 9.19 (s, 1H), 8.62



amido)thiazol-4-yl)propan-2-
INTE14 and
(s, 1H), 8.38 (d, J = 2.5 Hz, 1H),



yl)-4-(6-ethylpyrazin-2-yl)-2-
INTF39, [HPLC
8.13-8.03 (m, 2H), 7.89-7.82



fluorobenzamide
Acidic], 490, (1.97)
(m, 1H), 6.50 (s, 1H), 2.96-2.84





embedded image



(m, 2H), 2.64-2.55 (m, 1H), 1.64 (s, 6H), 1.33 (t, J = 7.6 Hz, 3H), 0.97-0.82 (m, 4H).





R42
N-(2-(2-(cyclopropane
Method 2a, Using
12.60 (s, 1H), 9.73 (s, 1H), 9.23



sulfonamido)thiazol-4-
INTE20 and
(s, 1H), 8.47 (s, 1H), 8.17-8.08



yl)propan-2-yl)-2-fluoro-4-(6-
commercial coupling
(m, 2H), 7.95-7.86 (m, 1H), 6.50



(trifluoromethyl)pyrazin-2-
partner, [UPLC
(s, 1H), 2.63-2.53 (m, 1H), 1.63



yl)benzamide
Acidic], 530, (1.36)
(s, 6H), 0.97-0.73 (m, 4H).





embedded image









R43
N-(2-(2-(cyclopropane
Method 1a, Using
12.59 (s, 1H), 8.96-8.79 (m, 1H),



sulfonamido)thiazol-4-
INTE14 and
8.42-8.32 (m, 1H), 8.31-8.20 (m,



yl)propan-2-yl)-2-fluoro-4-(6-
INTF36, [UPLC
1H), 8.12-7.95 (m, 2H), 7.89-



isopropoxypyrazin-2-
Acidic], 520, (1.42)
7.76 (m, 1H), 6.50 (s, 1H), 5.46-



yl)benzamide

5.34 (m, 1H), 2.64-2.55 (m, 1H),





embedded image



1.71-1.53 (m, 6H), 1.50-1.25 (m, 6H), 0.96-0.85 (m, 4H).





R44
N-(2-(2-(cyclopropanesulfon-
Method 1a, Using
12.59 (s, 1H), 9.09 (s, 1H), 8.52



amido)thiazol-4-yl)propan-2-
INTE14 and
(s, 1H), 8.40 (s, 1H), 8.18-8.09



yl)-2-fluoro-4-(6-(2,2,2-
INTF40, [UPLC
(m, 2H), 7.92-7.82 (m, 1H), 6.50



trifluoroethoxy)pyrazin-2-
Acidic], 560, (1.4)
(s, 1H), 5.24 (q, J = 9.0 Hz, 2H),



yl)benzamide

2.62-2.55 (m, 1H), 1.63 (s, 6H),





embedded image



0.98-0.81 (m, 4H).





R45
N-(2-(2-(cyclopropane
Method 1a, Using
12.61 (s, 1H), 9.66 (s, 1H), 9.17



sulfonamido)thiazol-4-
INTE14 and INTF43
(s, 1H), 8.46 (s, 1H), 8.14-8.02



yl)propan-2-yl)-2-methyl-4-(6-
[HPLC Acidic], 526,
(m, 2H), 7.71 (d, J = 7.9 Hz, 1H),



(trifluoromethyl)pyrazin-2-
(2.09)
6.50 (s, 1H), 2.61-2.55 (m, 1H),



yl)benzamide

2.42 (s, 3H), 1.62 (s, 6H), 0.94-





embedded image



0.85 (m, 4H).





R46
N-(2-(2-
Method 1a, Using
12.58 (s, 1H), 8.84 (s, 1H), 8.38



(cyclopropanesulfonamido)
INTE14 and
(s, 1H), 8.26 (s, 1H), 8.01-7.93



thiazol-4-yl)propan-2-yl)-4-(6-
INTF38, [HPLC
(m, 2H), 7.64 (d, J = 8.0 Hz, 1H),



ethoxypyrazin-2-yl)-2-
Acidic], 502, (2.04)
6.49 (s, 1H), 4.49 (q, J = 7.0 Hz,



methylbenzamide

2H), 2.56-2.51 (m, 1H), 2.40 (s,





embedded image



3H), 1.61 (s, 6H), 1.41 (t, J = 7.0 Hz, 3H), 0.95-0.81 (m, 4H).





R47
N-(2-(2-
Method 1a, Using
12.63 (s, 1H), 8.99 (s, 1H), 8.73



(cyclopropanesulfonamido)
INTE14 and
(s, 1H), 8.50 (dd, J = 8.1, 1.7 Hz,



thiazol-4-yl)propan-2-yl)-4-(6-
INTF42, [HPLC
1H), 8.43 (d, J = 1.6 Hz, 1H), 8.34



ethoxypyrazin-2-yl)-2-
Acidic], 556, (2.17)
(s, 1H), 7.98 (d, J = 8.1 Hz, 1H),



(trifluoromethyl)benzamide

6.53 (s, 1H), 4.50 (q, J = 7.0 Hz,





embedded image



2H), 2.62-2.56 (m, 1H), 1.59 (s, 6H), 1.41 (t, J = 7.0 Hz, 3H), 0.95- 0.85 (m, 4H).





R48
N-(2-(2-
Method 2b, Using
12.55 (s, 1H), 9.75 (s, 1H), 9.21



(cyclopropanesulfonamido)
INTE18 and
(s, 1H), 8.38 (s, 1H), 7.95-7.70



thiazol-4-yl)propan-2-yl)-2-
commercial coupling
(m, 3H), 6.51 (s, 1H), 4.07 (s, 3H),



methoxy-4-(6-
partner, [HPLC
2.59-2.54 (m, 1H), 1.65 (s, 6H),



(trifluoromethyl)pyrazin-2-
Acidic], 542, (2.2)
0.96-0.80 (m, 4H).



yl)benzamide







embedded image









R49
4-(6-chloropyrazin-2-yl)-N-(2-
Method 2b, Using
12.55 (s, 1H), 9.42 (s, 1H), 8.82



(2-
INTE18 and
(s, 1H), 8.37 (s, 1H), 7.91 (d, J =



(cyclopropanesulfonamido)
commercial coupling
8.0 Hz, 1H), 7.86-7.81 (m, 2H),



thiazol-4-yl)propan-2-yl)-2-
partner, [HPLC
6.51 (s, 1H), 4.06 (s, 3H), 2.60-



methoxybenzamide
Acidic], 508 35Cl
2.51 (m, 1H), 1.64 (s, 6H), 1.02-





embedded image


isotope, (2.07)
0.74 (m, 4H).





R50
4-(6-cyanopyrazin-2-yl)-N-(2-
Method 2b, Using
12.55 (s, 1H), 9.70 (s, 1H), 9.23



(2-
INTE18 and
(s, 1H), 8.39 (s, 1H), 7.96-7.82



(cyclopropanesulfonamido)
commercial coupling
(m, 3H), 6.51 (s, 1H), 4.07 (s, 3H),



thiazol-4-yl)propan-2-yl)-2-
partner, [HPLC
2.62-2.53 (m, 1H), 1.64 (s, 6H),



methoxybenzamide
Acidic], 499, (1.94)
0.96-0.74 (m, 4H).





embedded image









R51
N-(2-(2-(cyclopropanesulfon-
Method 1b, Using
12.59 (s, 1H), 9.72 (s, 1H), 9.21



amido)thiazol-4-yl)propan-2-
INTE14 and INF28,
(s, 1H), 8.42 (s, 1H), 8.34-8.27



yl)-4-(6-(trifluoromethyl)
[UPLC Acidic], 512,
(m, 2H), 8.13-8.04 (m, 2H), 6.50



pyrazin-2-yl)benzamide
(1.31)
(s, 1H), 2.62-2.54 (m, 1H), 1.65





embedded image



(s, 6H), 0.93-0.86 (m, 4H).





R52
4-(6-chloropyrazin-2-yl)-N-(2-
Method 1b, Using
12.58 (s, 1H), 9.39 (s, 1H), 8.82



(2-(cyclopropanesulfon-
INTE14 and
(s, 1H), 8.40 (s, 1H), 8.29-8.21



amido)thiazol-4-yl)propan-2-
INTF27, [HPLC
(m, 2H), 8.09-8.03 (m, 2H), 6.48



yl)benzamide
acidic], 478 35Cl
(s, 1H), 2.54-2.50 (m, 1H), 1.64





embedded image


isotope, (1.87)
(s, 6H), 0.94-0.76 (m, 4H).





R53
N-(2-(2-(cyclopropanesulfon-
Method 1b, Using
12.58 (s, 1H), 9.15 (s, 1H), 8.56



amido)thiazol-4-yl)propan-2-
INTE14 and INF29,
(s, 1H), 8.35 (s, 1H), 8.28-8.20



yl)-4-(6-methylpyrazin-2-
[HPLC Acidic], 458,
(m, 2H), 8.06-7.98 (m, 2H), 6.49



yl)benzamide
(1.68)
(s, 1H), 2.63-2.55 (m, 4H), 1.64





embedded image



(s, 6H), 0.96-0.79 (m, 4H).





R54
N-(2-(2-(cyclopropanesulfon-
Method 2a, Using
12.57 (s, 1H), 8.93 (s, 1H), 8.34



amido)thiazol-4-yl)propan-2-
INTE19 and
(s, 1H), 8.32 (s, 1H), 8.27-8.23



yl)-4-(6-methoxypyrazin-2-
commercial coupling
(m, 2H), 8.06-7.94 (m, 2H), 6.48



yl)benzamide
partner, [HPLC
(s, 1H), 4.04 (s, 3H), 2.54-2.51





embedded image


Basic], 474, (1.63)
(m, 1H), 1.63 (s, 6H), 0.93-0.82 (m, 4H).





R55
N-(2-(2-(cyclopropanesulfon-
Method 2a, Using
12.56 (s, 1H), 8.91 (s, 1H), 8.33



amido)thiazol-4-yl)propan-2-
INTE19 and
(s, 1H), 8.29 (s, 1H), 8.25-8.20



yl)-4-(6-ethoxypyrazin-2-
commercial coupling
(m, 2H), 8.04-7.98 (m, 2H), 6.47



yl)benzamide
partner, [HPLC
(s, 1H), 4.50 (q, J = 7.0 Hz, 2H),





embedded image


Basic], 488, (1.79)
2.59-2.53 (m, 1H), 1.63 (s, 6H), 1.41 (t, J = 7.0 Hz, 3H), 0.92- 0.81 (m, 4H).





R56
N-(2-(2-(cyclopropanesulfon-
Method 1a, Using
12.57 (s, 1H), 8.89 (s, 1H), 8.34



amido)thiazol-4-yl)propan-2-
INTE14 and
(s, 1H), 8.27-8.17 (m, 3H), 8.04-



yl)-4-(6-isopropoxypyrazin-2-
INTF30, [UPLC
7.98 (m, 2H), 6.48 (s, 1H), 5.49-



yl)benzamide
Basic], 502, (1.2)
5.24 (m, 1H), 2.60-2.53 (m, 1H),





embedded image



1.64 (s, 6H), 1.40 (d, J = 6.2 Hz, 6H), 0.92-0.78 (m, 4H).





R57
N-(2-(2-(cyclopropanesulfon-
Method 1a, Using
12.58 (s, 1H), 9.08 (s, 1H), 8.50



amido)thiazol-4-yl)propan-2-
INTE14 and
(s, 1H), 8.37 (s, 1H), 8.34-8.25



yl)-4-(6-(2,2,2-
INTF41, [UPLC
(m, 2H), 8.08-7.99 (m, 2H), 6.49



trifluoroethoxy)pyrazin-2-
Acidic], 542, (1.38)
(s, 1H), 5.23 (q, J = 9.0 Hz, 2H),



yl)benzamide

2.60-2.54 (m, 1H), 1.64 (s, 6H),





embedded image



0.96-0.83 (m, 4H).





R58
N-(2-(2-(cyclopropanesulfon-
Method 1b, Using
12.57 (s, 1H), 9.35 (d, J = 1.6 Hz,



amido)thiazol-4-yl)propan-2-
INTE14 and
1H), 8.76 (dd, J = 2.5, 1.5 Hz, 1H),



yl)-4-(pyrazin-2-yl)benzamide
commercial acid,
8.67 (d, J = 2.5 Hz, 1H), 8.36 (s,





embedded image


[HPLC Acidic], 444, (1.59)
1H), 8.29-8.22 (m, 2H), 8.09- 7.95 (m, 2H), 6.48 (s, 1H), 2.60- 2.52 (m, 1H), 1.63 (s, 6H), 0.91- 0.83 (m, 4H).





R59
RACEMIC, N-(1-(2-
Method 1b, Using
12.60 (s, 1H), 8.91-88 (m, 1H),



(cyclopropanesulfonamido)
INTE10 and
8.72 (d, J = 8.3 Hz, 1H), 8.64 (d,



thiazol-4-yl)propyl)-4-(5-
INTF26, [HPLC
J = 2.7 Hz, 1H), 8.21-8.16 (m, 1H),



fluoropyridin-3-yl)benzamide
acidic], 461, (1.74)
8.08-8.02 (m, 2H), 7.99-7.92





embedded image



(m, 2H), 6.56 (s, 1H), 4.94-4.85 (m, 1H), 2.64-2.55 (m, 1H), 1.97- 1.72 (m 2H), 0.97-0.76 (m, 7H).





R60
RACEMIC, N-(1-(2-
Method 1b, Using
12.57 (s, 1H), 8.76 (d, J = 2.3 Hz,



(cyclopropanesulfonamido)
INTE10 and
1H), 8.68 (d, J = 8.2 Hz, 1H), 8.46



thiazol-4-yl)propyl)-4-(5-
INTF24, [HPLC
(dd, J = 2.0, 0.8 Hz, 1H), 8.06-



methylpyridin-3-yl)benzamide
acidic], 457, (1.22)
7.95 (m, 3H), 7.90-7.82 (m, 2H),





embedded image



6.54(s, 1H), 4.94-4.83 (m, 1H), 2.62-2.55 (m, 1H), 2.39 (s, 3H), 1.97-1.71 (m, 2H), 0.97-0.81 (m, 7H).





R61
RACEMIC, N-(1-(2-
Method 1b, Using
12.58 (s, 1H), 9.00-8.96 (m, 1H),



(cyclopropanesulfonamido)
INTE10 and
8.72-8.66 (m, 1H), 8.63 (dd, J =



thiazol-4-yl)propyl)-4-(pyridin-3-
commercial acid,
4.7, 1.6 Hz, 1H), 8.20-8.14 (m,



yl)benzamide
[HPLC acidic], 443,
1H), 8.05-8.01 (m, 2H), 7.91-





embedded image


(1.2)
7.85 (m, 2H), 7.53 (dd, J = 7.9, 4.6 Hz, 1H), 6.55 (s, 1H), 4.95-4.83 (m, 1H), 2.64-2.55 (m, 1H), 1.98- 1.71 (m, 2H), 0.99-0.81 (m, 7H).





R62
RACEMIC, N-(1-(2-
Method 1a, Using
12.63 (s, 1H), 8.93 (s, 1H), 8.71



(cyclopropanesulfonamido)
INTE10 and
(d, J = 8.3 Hz, 1H), 8.33 (s, 1H),



thiazol-4-yl)propyl)-4-(6-
INTF35, [HPLC
8.11-8.01 (m, 2H), 7.79 (t, J =



ethoxypyrazin-2-yl)-2-
Acidic], 506, (2.12)
7.8 Hz, 1H), 6.55 (s, 1H), 4.93-



fluorobenzamide

4.82 (m, 1H), 4.51 (q, J = 7.0 Hz,





embedded image



2H), 2.62-2.55 (m, 1H), 1.94- 1.81 (m, 1H), 1.81-1.66 (m, 1H), 1.42 (t, J = 7.0 Hz, 3H), 1.01- 0.83 (m, 7H).





R63
RACEMIC, N-(1-(2-
Method 1a, Using
12.75 (s, 1H), 8.90 (d, J = 5.1 Hz,



(cyclopropanesulfonamido)
INTE11 and
1H), 8.31 (d, J = 4.7 Hz, 1H), 8.15-



thiazol-4-yl)propyl)-4-(6-
INTF35, [HPLC
7.98 (m, 2H), 7.69 (s, 1H), 6.73



ethoxypyrazin-2-yl)-2-fluoro-N-
Acidic], 520, (2.22)
(s, 1H), 5.50 (s, 1H), 4.53-4.47



methylbenzamide

(m, 2H), 2.66-2.62 (m, 4H), 2.11-





embedded image



1.74 (m, 2H), 1.45-1.35 (m, 3H), 0.99-0.84 (m, 7H).





R64
RACEMIC, N-(1-(2-
Method 1a, Using
12.62 (s, 1H), 8.90 (s, 1H), 8.70



(cyclopropanesulfonamido)
INTE10 and INF36
(d, J = 8.3 Hz, 1H), 8.27 (s, 1H),



thiazol-4-yl)propyl)-2-fluoro-4-(6-
[HPLC Acidic], 520,
8.10-7.97 (m, 2H), 7.78 (t, J =



isopropoxypyrazin-2-
(2.24)
7.8 Hz, 1H), 6.54 (s, 1H), 5.45-



yl)benzamide

5.33 (m, 1H), 4.87 (q, J = 7.9 Hz,





embedded image



1H), 2.62-2.54 (m, 1H), 1.96- 1.83 (m, 1H), 1.81-1.64 (m, 1H), 1.39 (d, J = 6.1 Hz, 6H), 0.98- 0.80 (m, 7H).





R65
RACEMIC, 4-(6-chloropyrazin-
Method 1b, Using
12.60 (s, 1H), 9.38 (d, J = 0.6 Hz,



2-yl)-N-(1-(2-
INTE10 and INTF27
1H), 8.82 (s, 1H), 8.76 (d, J = 8.2



(cyclopropanesulfonamido)
[HPLC acidic], 478
Hz, 1H), 8.31-8.20 (m, 2H), 8.07



thiazol-4-yl)propyl)benzamide

35Cl isotope, (1.91)

(d, J = 8.4 Hz, 2H), 6.55 (s, 1H),





embedded image



4.90 (q, J = 8.5, 7.9 Hz, 1H), 2.62- 2.52 (m, 1H), 2.00-1.60 (m, 2H), 0.97-0.81 (m, 7H).





R66
RACEMIC, N-(1-(2-
Method 1b, Using
12.59 (s, 1H), 9.13 (s, 1H), 8.72



(cyclopropanesulfonamido)
INTE10 and INTF29
(d, J = 8.2 Hz, 1H), 8.56 (s, 1H),



thiazol-4-yl)propyl)-4-(6-
[HPLC Acidic], 458,
8.28-8.21 (m, 2H), 8.07-8.00



methylpyrazin-2-yl)benzamide
(1.73)
(m, 2H), 6.56 (s, 1H), 4.94-4.84





embedded image



(m, 1H), 2.62-2.50 (m, 4H), 2.01- 1.67 (m, 2H), 0.96-0.85 (m, 7H).





R67
RACEMIC, N-(1-(2-
Method 1b, Using
12.59 (s, 1H), 9.35 (d, J = 1.5 Hz,



(cyclopropanesulfonamido)
INTE10 and
1H), 8.77 (dd, J = 2.5, 1.5 Hz, 1H),



thiazol-4-yl)propyl)-4-(pyrazin-2-
commercial acid,
8.74 (d, J = 8.2 Hz, 1H), 8.67 (d,



yl)benzamide
[HPLC Acidic], 444,
J = 2.4 Hz, 1H), 8.30-8.24 (m,





embedded image


(1.81)
2H), 8.11-7.99 (m, 2H), 6.56 (s, 1H), 4.89 (q, J = 7.8 Hz, 1H), 2.62- 2.54 (m, 1H), 1.98-1.72 (m, 2H), 0.96-0.79 (m, 7H).





R68
SINGLE ENANTIOMER -
Method 1b, Using
12.60 (s, 1H), 8.89 (t, J = 1.8 Hz,



stereochemistry unassigned,
INTE10 and
1H), 8.72 (d, J = 8.3 Hz, 1H), 8.64



N-(1-(2-(cyclopropanesulfon-
INTF26, Separation
(d, J = 2.7 Hz, 1H), 8.21-8.16 (m,



amido)thiazol-4-yl)propyl)-4-(5-
using chiral
1H), 8.08-8.02 (m, 2H), 7.99-



fluoropyridin-3-yl)benzamide
method A, [UPLC
7.92 (m, 2H), 6.56 (s, 1H), 4.90 (q,





embedded image


acidic], 461, (1.13) Chiral IA method 1: Peak 1 RT 21.4 mins
J = 8.2 Hz, 1H), 2.64-2.55 (m, 1H), 1.97-1.72 (m, 2H), 0.97- 0.76 (m, 7H).





R69
SINGLE ENANTIOMER -
Method 1b, Using
12.60 (s, 1H), 8.89 (t, J = 1.8 Hz,



stereochemistry unassigned,
INTE10 and
1H), 8.72 (d, J = 8.3 Hz, 1H), 8.64



N-(1-(2-(cyclopropanesulfon-
INTF26, Separation
(d, J = 2.7 Hz, 1H), 8.21-8.16 (m,



amido)thiazol-4-yl)propyl)-4-(5-
using chiral
1H), 8.08-8.02 (m, 2H), 7.99-



fluoropyridin-3-yl)benzamide
method A [UPLC
7.92 (m, 2H), 6.56 (s, 1H), 4.90 (q,





embedded image


acidic], 461, (1.13) Chiral IA method 1: Peak 2 RT 27.5 mins
J = 8.2 Hz, 1H), 2.64-2.55 (m, 1H), 1.97-1.72 (m, 2H), 0.97- 0.76 (m, 7H).





R70
SINGLE ENANTIOMER -
Chiral Sep,
12.62 (s, 1H), 8.93 (s, 1H), 8.70



stereochemistry unassigned,
Method 1a, Using
(dd, J = 8.3, 1.4 Hz, 1H), 8.32 (s,



N-(1-(2-(cyclopropanesulfon-
INTE10 and
1H), 8.11-8.03 (m, 2H), 7.80-



amido)thiazol-4-yl)propyl)-4-(6-
INTF35, Separation
7.73 (m, 1H), 6.55 (s, 1H), 4.93-



ethoxypyrazin-2-yl)-2-
using chiral
4.79 (m, 1H), 4.50 (q, J = 7.0 Hz,



fluorobenzamide
method B, [HPLC
2H), 2.62-2.55 (m, 1H), 1.94-





embedded image


Acidic], 506, (2.11) Chiral IA method 2: Peak 1 RT 16.0 mins
1.82 (m, 1H), 1.80-1.67 (m, 1H), 1.41 (t, J = 7.0 Hz, 3H), 0.98- 0.85 (m, 7H).





R71
SINGLE ENANTIOMER -
Chiral Sep,
12.62 (s, 1H), 8.93 (s, 1H), 8.75-



stereochemistry unassigned,
Method 1a, Using
8.67 (m, 1H), 8.32 (s, 1H), 8.11-



N-(1-(2-(cyclopropanesulfon-
INTE10 and
8.01 (m, 2H), 7.83-7.72 (m, 1H),



amido)thiazol-4-yl)propyl)-4-(6-
INTF35, Separation
6.54 (s, 1H), 4.93-4.79 (m, 1H),



ethoxypyrazin-2-yl)-2-
using chiral
4.50 (q, J = 7.0 Hz, 2H), 2.62-



fluorobenzamide
method B, [HPLC
2.55 (m, 1H), 1.94-1.81 (m, 1H),





embedded image


Acidic], 506, (2.12) Chiral IA method 2: Peak 2 RT 30.2 mins
1.79-1.64 (m, 1H), 1.41 (t, J = 7.0 Hz, 3H), 0.98-0.86 (m, 7H).





R72
N-(2-(2-(cyclopropanesulfon-
Method 1a using
12.07 (s, 1H), 9.40 (d, J = 2.1 Hz,



amido)-5-methylthiazol-4-
INTE32 and
1H), 9.00 (s, 1H), 8.70 (dd, J =



yl)propan-2-yl)-5-(6-
INTF53, [HPLC
8.2, 2.2 Hz, 1H), 8.66 (s, 1H), 8.38



ethoxypyrazin-2-
Acidic], 503, (2.12)
(s, 1H), 8.15 (d, J = 8.2 Hz, 1H),



yl)picolinamide

4.52 (q, J = 7.0 Hz, 2H), 2.57-





embedded image



2.53 (m, 1H), 2.19 (s, 3H), 1.75 (s, 6H), 1.42 (t, J = 7.0 Hz, 3H), 0.94- 0.79 (m, 4H).





R73
N-(2-(5-chloro-2-(cyclopropane-
Method 1a using
12.52 (s, 1H), 9.40 (d, J = 2.1 Hz,



sulfonamido)thiazol-4-
INTE33 and
1H), 9.00 (s, 1H), 8.74-8.67 (m,



yl)propan-2-yl)-5-(6-
INTF53, [HPLC
2H), 8.38 (s, 1H), 8.15 (d, J = 8.1



ethoxypyrazin-2-
Acidic], 523 35Cl
Hz, 1H), 4.52 (q, J = 7.0 Hz, 2H),



yl)picolinamide
isotope, (2.35)
2.71-2.65 (m, 1H), 1.78 (s, 6H),





embedded image



1.42 (t, J = 7.0 Hz, 3H), 0.98- 0.74 (m, 4H).





R74
N-(2-(2-(cyclopropanesulfon-
Method 1a using
11.94 (s, 1H), 8.92 (s, 1H), 8.59-



amido)-5-methylthiazol-4-
INTE32 and
8.52 (m, 1H), 8.32 (s, 1H), 8.08-



yl)propan-2-yl)-4-(6-
INTF35, [HPLC
8.02 (m, 2H), 7.80-7.75 (m, 1H),



ethoxypyrazin-2-yl)-2-
Acidic], 520, (2.16)
4.50 (q, J = 7.0 Hz, 2H), 2.62-



fluorobenzamide

2.53 (m, 1H), 2.22 (s, 3H), 1.66 (s,





embedded image



6H), 1.41 (t, J = 7.0 Hz, 3H), 0.95- 0.80 (m, 4H).





R75
N-(2-(5-chloro-2-(cyclopropane-
Method 1a using
12.44 (s, 1H), 8.92 (s, 1H), 8.71



sulfonamido)thiazol-4-
INTE33 and
(d, J = 1.8 Hz, 1H), 8.33 (s, 1H),



yl)propan-2-yl)-4-(6-
INTF35, [HPLC
8.11-8.00 (m, 2H), 7.89-7.66



ethoxypyrazin-2-yl)-2-
Acidic], 540 35Cl
(m, 1H), 4.50 (q, J = 7.0 Hz, 2H),



fluorobenzamide
isotope, (2.36)
2.76-2.61 (m, 1H), 1.69 (s, 6H),





embedded image



1.41 (t, J = 7.0 Hz, 3H), 1.02- 0.90 (m, 4H).





R76
N-(2-(2-(cyclopropanesulfon-
Method 1a using
11.96 (s, 1H), 9.66 (s, 1H), 9.18



amido)-5-methylthiazol-4-
INTE32 and
(s, 1H), 8.63 (s, 1H), 8.11-8.01



yl)propan-2-yl)-2-methyl-4-(6-
INTF43, [HPLC
(m, 2H), 7.66-7.56 (m, 1H), 2.61-



(trifluoromethyl)pyrazin-2-
Acidic], 540, (2.16)
2.54 (m, 1H), 2.42 (s, 3H), 2.26



yl)benzamide

(s, 3H), 1.66 (s, 6H), 0.95-0.86





embedded image



(m, 4H).





R77
N-(2-(5-chloro-2-(cycloproane-
Method 1a using
12.45 (s, 1H), 9.66 (s, 1H), 9.18



sulfonamido)thiazol-4-
INTE33 and
(s, 1H), 8.79 (s, 1H), 8.18-7.97



yl)propan-2-yl)-2-methyl-4-(6-
INTF43, [HPLC
(m, 2H), 7.70-7.49 (m, 1H), 2.70-



(trifluoromethyl)pyrazin-2-
Acidic], 560 35Cl
2.66 (m, 1H), 2.43 (s, 3H), 1.69



yl)benzamide
isotope, (2.33)
(s, 6H), 1.02-0.92 (m, 4H).





embedded image









R78
N-(2-(2-(cyclopropanesulfon-
Method 1a using
11.98 (s, 1H), 9.71 (s, 1H), 9.21



amido)-5-methylthiazol-4-
INTE32 and
(s, 1H), 8.59 (s, 1H), 8.33-8.27



yl)propan-2-yl)-4-(6-
INTF28, [HPLC
(m, 2H), 8.12-8.02 (m, 2H), 2.60-



(trifluoromethyl)pyrazin-2-
Acidic], 526, (2.19)
2.54 (m, 1H), 2.18 (s, 3H), 1.69



yl)benzamide

(s, 6H), 0.92-0.84 (m, 4H).





embedded image









R79
N-(2-(5-chloro-2-(cyclopropane-
Method 1a using
12.47 (s, 1H), 9.71 (s, 1H), 9.21



sulfonamido)thiazol-4-
INTE33 and
(s, 1H), 8.74 (s, 1H), 8.39-8.25



yl)propan-2-yl)-4-(6-
INTF28, [HPLC
(m, 2H), 8.15-7.98 (m, 2H), 2.69-



(trifluoromethyl)pyrazin-2-
Acidic], 546 35Cl
2.64 (m, 1H), 1.72 (s, 6H), 0.97-



yl)benzamide
isotope, (2.29)
0.90 (m, 4H).





embedded image









R80
N-(1-(2-(cyclopropanesulfon-
Method 1a using
12.41 (s, 1H), 9.40-9.32 (m, 2H),



amido)thiazol-4-yl)cyclo-
INTE38 and
9.00 (s, 1H), 8.69 (dd, J = 8.2, 2.2



propyl)-5-(6-ethoxypyrazin-2-
INTF53, [HPLC
Hz, 1H), 8.38 (s, 1H), 8.16 (d, J =



yl)picolinamide
Acidic], 487, (1.97)
8.2 Hz, 1H), 6.44 (s, 1H), 4.52 (q,





embedded image



J = 7.0 Hz, 2H), 2.61-2.53 (m, 1H), 1.42 (t, J = 7.0 Hz, 3H), 1.40- 1.34 (m, 2H), 1.29-1.23 (m, 2H), 0.93-0.83 (m, 4H).





R81
N-(1-(2-(cyclopropanesulfon-
Method 1a using
12.32 (s, 1H), 9.14 (s, 1H), 8.97



amido)thiazol-4-yl)cyclo-
INTE38 and
(d, J = 2.4 Hz, 1H), 8.62 (dd, J =



propyl)-4-(pyridin-3-
Commercial acid,
4.8, 1.6 Hz, 1H), 8.18-8.15 (m,



yl)benzamide
[UPLC Basic], 441,
1H), 8.06-7.95 (m, 2H), 7.94-





embedded image


(0.77)
7.77 (m, 2H), 7.53 (dd, J = 7.9, 4.8 Hz, 1H), 6.40 (s, 1H), 2.62-2.54 (m, 1H), 1.43-1.34 (m, 2H), 1.29- 1.21 (m, 2H), 0.98-0.78 (m, 4H).





R82
N-(1-(2-(cyclopropanesulfon-
Method 1a using
12.32 (s, 1H), 9.02 (s, 1H), 8.94



amido)thiazol-4-yl)cyclo-
INTE38 and
(s, 1H), 8.33 (s, 1H), 8.12-8.00



propyl)-4-(6-ethoxypyrazin-2-
INTF35, [HPLC
(m, 2H), 7.86-7.78 (m, 1H), 6.44



yl)-2-fluorobenzamide
Acidic], 504, (2.05)
(s, 1H), 4.51 (q, J = 7.0 Hz, 2H),





embedded image



2.63-2.54 (m, 1H), 1.46-1.33 (m, 5H), 1.25-1.15 (m, 2H), 0.96- 0.85 (m, 4H).





R83
N-(1-(2-(cyclopropanesulfon-
Method 1a using
12.31 (s, 1H), 9.67 (s, 1H), 9.18



amido)thiazol-4-
INTE38 and
(s, 1H), 9.04 (s, 1H), 8.10-8.07



yl)cyclopropyl)-2-methyl-4-(6-
INTF43, [HPLC
(m, 2H), 7.67 (d, J = 7.9 Hz, 1H),



(trifluoromethyl)pyrazin-2-
Acidic], 524, (2.08)
6.47 (s, 1H), 2.63-2.57 (m, 1H),



yl)benzamide

2.44 (s, 3H), 1.43-1.34 (m, 2H),





embedded image



1.25-1.18 (m, 2H), 1.00-0.81 (m, 4H).





R84
N-(1-(2-(cyclopropanesulfon-
Method 1a using
12.37 (s, 1H), 9.72 (s, 1H), 9.29-



amido)thiazol-4-
INTE38 and
9.06 (m, 2H), 8.39-8.28 (m, 2H),



yl)cyclopropyl)-4-(6-
INTF28, [HPLC
8.15-7.96 (m, 2H), 6.40 (s, 1H),



(trifluoromethyl)pyrazin-2-
Acidic], 510, (2.04)
2.61-2.54 (m, 1H), 1.42-1.35



yl)benzamide

(m, 2H), 1.32-1.22 (m, 2H), 0.96-





embedded image



0.84 (m, 4H).





R85
N-(1-(2-(cyclopropanesulfon-
Method 1a using
12.60 (s, 1H), 8.89 (t, J = 1.9 Hz,



amido)thiazol-4-yl)-3-
INTE39 and
1H), 8.74 (d, J = 8.1 Hz, 1H), 8.64



methoxypropyl)-4-(5-
INTF26, [UPLC
(d, J = 2.7 Hz, 1H), 8.21-8.15



fluoropyridin-3-yl)benzamide
Acidic], 491, (1.09)
(m, 1H), 8.09-7.98 (m, 2H), 7.98-





embedded image



7.91 (m, 2H), 6.57 (s, 1H), 5.13- 5.02 (m, 1H), 3.46-3.34 (m, 2H), 3.23 (s, 3H), 2.62-2.54 (m, 1H), 2.18-2.10 (m, 1H), 2.07- 1.98 (m, 1H), 0.95-0.85 (m, 4H).





R86
N-(1-(2-(cyclopropanesulfon-
Method 1ausing
12.64 (s, 1H), 9.18 (s, 1H), 8.71



amido)thiazol-4-yl)-3-
INTE39 and
(d, J = 8.2 Hz, 1H), 8.62 (s, 1H),



methoxypropyl)-4-(6-ethyl-
INTF39, [UPLC
8.14-8.05 (m, 2H), 7.87-7.77



pyrazin-2-yl)-2-
Acidic], 520, (1.24)
(m, 1H), 6.57 (s, 1H), 5.12-5.03



fluorobenzamide

(m, 1H), 3.46-3.37 (m, 2H), 3.25





embedded image



(s, 3H), 2.90 (q, J = 7.6 Hz, 2H), 2.63-2.55 (m, 1H), 2.18-2.05 (m, 1H), 2.05-1.91 (m, 1H), 1.33 (t, J = 7.6 Hz, 3H), 0.97-0.83 (m, 4H).





R87
N-(1-(2-(cyclopropanesulfon-
Method 1a using
12.65 (s, 1H), 9.73 (s, 1H), 9.24



amido)thiazol-4-yl)-3-
INTE39 and
(s, 1H), 8.78 (d, J = 8.0 Hz, 1H),



methoxypropyl)-2-fluoro-4-(6-
INTF34, [UPLC
8.21-8.12 (m, 2H), 7.92-7.83



(trifluoromethyl)pyrazin-2-
Acidic], 560, (1.33)
(m, 1H), 6.57 (s, 1H), 5.12-5.03



yl)benzamide

(m, 1H), 3.49-3.36 (m, 2H), 3.25





embedded image



(s, 3H), 2.64-2.55 (m, 1H), 2.19- 2.07 (m, 1H), 2.05-1.92 (m, 1H), 0.98-0.83 (m, 4H).





R88
N-(1-(2-(cyclopropanesulfon-
Method 1a using
12.63 (s, 1H), 8.93 (s, 1H), 8.66



amido)thiazol-4-yl)-3-
INTE39 and
(s, 1H), 8.33 (s, 1H), 8.11-8.03



methoxypropyl)-4-(6-
INTF35, [HPLC
(m, 2H), 7.85-7.73 (m, 1H), 6.52



ethoxypyrazin-2-yl)-2-
Acidic], 536, (2.08)
(s, 1H), 5.13-4.96 (m, 1H), 4.51



fluorobenzamide

(q, J = 7.0 Hz, 2H), 3.47-3.37 (m,





embedded image



2H), 3.25 (s, 3H), 2.60-2.52 (m, 1H), 2.18-2.08 (m, 1H), 2.02- 1.81 (m, 1H), 1.42 (t, J = 7.0 Hz, 3H), 0.99-0.65 (m, 4H).





R89
N-(1-(2-(cyclopropanesulfon-
Method 1a using
12.64 (s, 1H), 8.91 (s, 1H), 8.71



amido)thiazol-4-yl)-3-
INTE39 and
(d, J = 9.1 Hz, 1H), 8.28 (s, 1H),



methoxypropyl)-2-fluoro-4-(6-
INTF36, [UPLC
8.11-8.02 (m, 2H), 7.85-7.78



isopropoxypyrazin-2-
Acidic], 551, (1.42)
(m, 1H), 6.55 (s, 1H), 5.43 (h, J =



yl)benzamide

6.2 Hz, 1H), 5.12-5.03 (m, 1H),





embedded image



3.47-3.38 (m, 2H), 3.25 (s, 3H), 2.63-2.56 (m, 1H), 2.17-2.10 (m, 1H), 2.03-1.93 (m, 1H), 1.40 (d, J = 6.2 Hz, 6H), 0.96-0.85 (m, 4H).





R90
N-(1-(2-(cyclopropanesulfon-
Method 1a using
12.61 (s, 1H), 8.91 (s, 1H), 8.74



amido)thiazol-4-yl)-3-
INTE39 and
(d, J = 8.1 Hz, 1H), 8.30 (s, 1H),



methoxypropyl)-4-(6-ethoxy-
INTF37, [UPLC
8.28-8.22 (m, 2H), 8.07-8.00



pyrazin-2-yl)benzamide
Acidic], 519, (1.27)
(m, 2H), 6.58 (s, 1H), 5.12-5.04





embedded image



(m, 1H), 4.51 (q, J = 7.0 Hz, 2H), 3.46-3.35 (m, 2H), 3.23 (s, 3H), 2.63-2.55 (m, 1H), 2.18-2.09 (m, 1H), 2.09-1.99 (m, 1H), 1.42 (t, J = 7.0 Hz, 3H), 0.95-0.86 (m, 4H).





R91
N-(1-(2-(cyclopropanesulfon-
Method 1a using
12.66 (s, 1H), 8.93 (s, 1H), 8.81



amido)thiazol-4-ypethyl)-4-(6-
INTE23 and
(d, J = 7.7 Hz, 1H), 8.33 (s, 1H),



ethoxypyrazin-2-yl)-2-
INTF35, [HPLC
8.09-8.01 (m, 2H), 7.84-7.73



fluorobenzamide
Acidic], 492, (2.02)
(m, 1H), 6.54 (s, 1H), 5.06-4.96





embedded image



(m, 1H), 4.51 (q, J = 7.0 Hz, 2H), 2.63-2.53 (m, 1H), 1.46 (d, J = 6.9 Hz, 3H), 1.42 (t, J = 7.0 Hz, 3H), 0.94-0.85 (m, 4H).





R92
SINGLE ENANTIOMER -
Method 1a using
12.64 (s, 1H), 8.94 (s, 1H), 8.74-



stereochemistry unassigned
INTE39 and
8.67 (m, 1H), 8.33 (s, 1H), 8.15-



N-(1-(2-(cyclopropanesulfon-
INTF35,
7.99 (m, 2H), 7.86-7.72 (m, 1H),



amido)thiazol-4-yl)-3-
Chiral IC1 (17.4),
6.58 (s, 1H), 5.16-5.02 (m, 1H),



methoxypropyl)-4-(6-
[HPLC Acidic], 536,
4.51 (q, J = 7.0 Hz, 2H), 3.49-



ethoxypyrazin-2-yl)-2-
(2.08)
3.33 (m, 2H), 3.25 (s, 3H), 2.64-



fluorobenzamide

2.57 (m, 1H), 2.22-2.05 (m, 1H),





embedded image



2.05-1.92 (m, 1H), 1.42 (t, J = 7.0 Hz, 3H), 0.97-0.81 (m, 4H).





R93
SINGLE ENANTIOMER -
Method 1a using
12.64 (s, 1H), 8.94 (s, 1H), 8.79-



stereochemistry unassigned
INTE39 and
8.67 (m, 1H) 8.33 (s, 1H), 8.18-



N-(1-(2-(cyclopropanesulfon-
INTF35, Chiral IC1
8.03 (m, 2H), 7.89-7.73 (m, 1H),



amido)thiazol-4-yl)-3-
(22.7), [HPLC
6.57 (s, 1H), 5.16-5.02 (m, 1H),,



methoxypropyl)-4-(6-
Acidic], 536, (2.08)
4.51 (q, J = 7.0 Hz, 2H), 3.46-



ethoxypyrazin-2-yl)-2-

3.37 (m, 2H), 3.25 (s, 3H), 2.63-



fluorobenzamide

2.56 (m, 1H), 2.21-2.04 (m, 1H),





embedded image



2.02-1.91 (m, 1H), 1.42 (t, J = 7.0 Hz, 3H), 0.96-0.80 (m, 4H).









Biological Examples
Biological Example 1—Human CTPS1 Enzyme Inhibition

The enzyme inhibitory activities of compounds invented against the target of interest were determined using the ADP-Glo™ Max assay (Promega, UK). Assays for human CTPS1 were performed in 1× assay buffer containing 50 mM Tris, 10 mM MgCl2, 0.01% Tween-20, pH to 8.0 accordingly. Finally, immediately before use, L-cysteine was added to the 1× assay buffer to a final concentration of 2 mM. All reagents are from Sigma-Aldrich unless specified otherwise. Human full length active C-terminal FLAG-Hiss-tag CTPS1 (UniProtKB-P17812, CTPS[1-591]-GGDYKDDDDKGGHHHHHHHH) was obtained from Proteros biostructures GmbH.


Assay Procedure


3× human CTPS1 protein was prepared in 1× assay buffer to the final working protein concentration required for the reaction. A 2 uL volume per well of 3× human CTPS1 protein was mixed with 2 uL per well of 3× test compound (compound prepared in 1× assay buffer to an appropriate final 3× compound concentration respective to the concentration response curve designed for the compounds under test) for 10 minutes at 25° C. The enzymatic reaction was then initiated by addition of a 2 uL per well volume of a pre-mixed substrate mix (UltraPure ATP from ADP-Glo™ Max kit (0.31 mM), GTP (0.034 mM), UTP (0.48 mM) and L-glutamine (0.186 mM)) and the mixture was incubated for an appropriate amount of time within the determined linear phase of the reaction at 25° C. under sealed plate conditions with constant agitation at 500 revolutions per minute (rpm). ADP-GIo™ Max reagent was added for 60 minutes (6 uL per well) and subsequently ADP-Glo™ Max development reagent was added for 60 minutes (12 uL per well) prior to signal detection in a microplate reader (EnVision® Multilabel Reader, Perkin Elmer). Following each reagent addition over the course of the assay, assay plates were pulse centrifuged for 30 seconds at 500 rpm.


In all cases, the enzyme converts ATP to ADP and the ADP-Glo™ Max reagent subsequently depletes any remaining endogenous ATP in the reaction system. The ADP-Glo™ Max detection reagent converts the ADP that has been enzymatically produced back into ATP and using ATP as a substrate together with luciferin for the enzyme luciferase, light is generated which produces a detectable luminescence. The luminescent signal measured is directly proportional to the amount of ADP produced by the enzyme reaction and a reduction in this signal upon compound treatment demonstrates enzyme inhibition. The percentage inhibition produced by each concentration of compound was calculated using the equation shown below:







%


Inhibition

=

1
-



(


Mean
Min

-

Mean
Inh


)


(


Mean
Min

-

Mean
Max


)


×
100






Percentage inhibition was then plotted against compound concentration, and the 50% inhibitory concentration (IC50) was determined from the resultant concentration-response curve.









TABLE 7







Human CTPS1 Enzyme Inhibition data grouped by potency range


(± indicates IC50 in the range of >10 to 21 micromolar, +


indicates IC50 in the range >1 to 10 micromolar, ++ indicates


IC50 in the range >0.1 to 1 micromolar, +++ indicates


IC50 of <0.1 micromolar)










R
CTPS1







R1
++



R2
++



R3
++



R4
+++



R5
+++



R6
+++



R7
++



R8
+



R9
+



R10
+++



R11
+++



R12
+++



R13
+++



R14
+++



R15
+++



R16
++



R17
++



R18
++



R19
+++



R20
+++



R21
+++



R22
++



R23
++



R24
++



R25
++



R26
++



R27
±



R28
+++



R29
+++



R30
++



R31
++



R32
++



R33
+



R34
+



R35
+++



R36
++



R37
+++



R38
++



R39
++



R40
++



R41
++



R42
+++



R43
+++



R44
++



R45
++



R46
++



R47
++



R48
++



R49
++



R50
+



R51
+++



R52
+++



R53
++



R54
+++



R55
+++



R56
+++



R57
++



R58
++



R59
++



R60
++



R61
++



R62
++



R63
++



R64
++



R65
+++



R66
++



R67
++



R68
+



R69
+++



R70
++



R71
+++



R72
+



R73
+



R74
++



R75
++



R76
++



R77
+



R78
++



R79
++



R80
+++



R81
++



R82
+++



R83
+++



R84
+++



R85
++



R86
++



R87
++



R88
++



R89
+++



R90
+++



R91
+++



R92
+++



R93
+++










Biological Example 2—RapidFire/MS-Based Enzyme Selectivity Assays

Human CTPS1 Versus CTPS2 Selectivity Assessment by RapidFire/MS Analysis.


The enzyme inhibitory activities against each target isoform of interest were determined for the compounds of the invention using an optimised RapidFire high-throughput mass spectrometry (RF/MS) assay format. RF/MS assays for both human CTPS1 and CTPS2 were performed in assay buffer consisting of 50 mM HEPES (Merck), 20 mM MgCl2, 5 mM KCl, 1 mM DTT, 0.01% Tween-20, pH to 8.0 accordingly. All reagents were from Sigma-Aldrich unless specified otherwise. Human full-length active C-terminal FLAG-His-tag CTPS1 (UniProtKB-P17812, CTPS[1-591]-GGDYKDDDDKGGHHHHHHHH) was obtained from Proteros biostructures GmbH. Human full length active C-terminal FLAG-His-Avi tagged CTPS2 (UniProtKB-Q9NRF8, CTPS2 [1-586]-DYKDDDDKHHHHHHGLNDIFEAQKIEWHE) was obtained from Harker Bio.


Assay Procedure


Human CTPS (1 or 2) protein was prepared in 1× assay buffer to the final working protein concentration required for the reaction. A 2 uL volume per well of 2×CTPS (1 or 2) protein was mixed with 40 nL of compound using acoustic (ECHO) delivery and incubated for 10 minutes at 25° C. Each isoform enzymatic reaction was subsequently initiated by addition of 2 uL per well of a 2× substrate mix in assay buffer. For hCTPS1: ATP (0.3 mM), UTP (0.2 mM), GTP (0.07 mM) and L-glutamine (0.1 mM). For hCTPS2: ATP (0.1 mM), UTP (0.04 mM), GTP (0.03 mM) and L-glutamine (0.1 mM). Each mixture was incubated for an appropriate amount of time per isoform within the determined linear phase of the reaction at 25° C. A 60 uL volume of stop solution (1% formic acid with 0.5 uM 13C9-15N3-CTP in H2O) was added and the plate immediately heat-sealed and centrifuged for 10 minutes at 4,000 rpm. Following centrifugation, plates were loaded onto the Agilent RapidFire microfluidic solid phase extraction system coupled to an API4000 triple quadrupole mass spectrometer (RF/MS) for analysis.


In all cases, the enzyme converts UTP to CTP. Highly specific and sensitive multiple reaction monitoring (MRM) MS methods were optimised for the detection of the enzymatic reaction product, CTP, and the stable isotope labelled product standard 13C9-15N3-CTP. Readout for data analysis was calculated as the ratio between the peak area of the product CTP and the internal standard 13C9-15N3-CTP. For data reporting, the following equation was used:






R
=

P
IS





(R=ratio/readout, P=product signal area, IS=internal standard signal area)


For each screening plate, the means of the negative (DMSO) and positive control values were used for the calculation of the respective assay window (S/B) and Z′ values. The median of the respective control values was used for calculation of percent inhibition according to the following equation:






I
=




R
neg

-

R
sample




[


R
neg

-

R
pos


]



%





(I=Inhibition, Rneg=median of negative control readout values, Rpos=median of positive control readout values, Rsample=sample readout value)


Percentage inhibition was then plotted against compound concentration, and the 50% inhibitory concentration (IC51) was determined from the resultant concentration-response curve.


Fold selectivity between CTPS1 and CTPS2 was subsequently calculated according to the following equation:







Fold


selectivity

=


CTPS

2



IC
50



CTPS

1



IC
50







Certain compounds were tested in the assay above. The data for all compounds tested are presented below.









TABLE 8







Selectivity data split into grouping of 2-30 fold (+), >30-60


fold (++) or >60 fold (+++)










R
Selectivity







R5
+



R6
++



R7
++



R11
++



R19
++



R23
++



R25
++



R26
+++



R41
++



R42
++



R43
++



R45
++



R46
+



R47
+



R48
++



R51
++



R52
+++



R54
+



R55
+++



R56
+++



R62
+++



R63
+



R64
++



R68
++



R69
+++



R70
+++



R71
+++



R73
+



R74
++



R75
+++



R76
+



R78
++



R79
+



R80
+++



R82
+++



R83
+++



R84
+++



R86
+++



R87
++



R88
+++



R89
+++



R90
++



R91
+++



R92
+++



R93
+++










All compounds of the invention which have been tested were found to demonstrate inhibition of CTPS1 enzyme in this assay. Consequently, these compounds may be expected to have utility in the inhibition of CTPS1.


All compounds tested in the assay described in Biological Assay 2 were found to have at least 2 fold selectivity for CTPS1 over CTPS2, with many compounds having a selectivity for CTPS1 of over 60 fold. In particular, these compounds may be expected to have utility in the treatment of diseases whereby a selective CTPS1 compound is beneficial.


The compounds of the invention are also expected to have utility as research tools, for example, for use in CTPS assays.


Throughout the specification and the claims which follow, unless the context requires otherwise, the word ‘comprise’, and variations such as ‘comprises’ and ‘comprising’, will be understood to imply the inclusion of a stated integer, step, group of integers or group of steps but not to the exclusion of any other integer, step, group of integers or group of steps.


The application of which this description and claims forms part may be used as a basis for priority in respect of any subsequent application. The claims of such subsequent application may be directed to any feature or combination of features described herein. They may take the form of product, composition, process, or use claims and may include, by way of example and without limitation, the claims which follow.


All publications, including but not limited to patents and patent applications, cited in this specification are herein incorporated by reference as if each individual publication were specifically and individually indicated to be incorporated by reference herein as though fully set forth.


Clauses of the Invention


Clause 1. A compound of formula (I):




embedded image


wherein

    • R1 is C1-5alkyl, C0-2alkyleneC3-5cycloalkyl which cycloalkyl is optionally substituted by CH3, C1-3alkyleneOC1-2alkyl, or CF3;
    • R3 is H, CH3, halo, OC1-2alkyl or CF3;
    • R4 and R5 are each independently H, C1-6alkyl, C0-2alkyleneC3-6cycloalkyl, C0-2alkyleneC3-6heterocycloalkyl, C1-3alkyleneOC1-3alkyl, C1-6alkylOH or C1-6haloalkyl,
      • or R4 and R5 together with the carbon atom to which they are attached form a C3-6cycloalkyl or C3-6heterocycloalkyl ring;
    • R6 is H or C1-3alkyl;
    • Ar1 is a 6-membered aryl or heteroaryl;
    • Ar2 is a 6-membered aryl or heteroaryl and is attached to Ar1 in the para position relative to the amide;
    • R10 is H, halo, C1-3alkyl, OC1-2alkyl, C1-2haloalkyl, OC1-2haloalkyl or CN;
    • R11 is H, F, Cl, CH3, ethyl, OCH3, CF3, OCF3 or CN;
    • R12 is attached to Ar2 in the meta or ortho position relative to Ar1 and R12 is H, halo, C1-4 alkyl, C2-4alkynyl, C(═O)C1-2alkyl, C0-2alkyleneC3-5cycloalkyl, OC1-4alkyl, C1-3 alkyleneOC1-3alkyl, C1-4haloalkyl, OC1-4haloalkyl, CN, OC0-2alkyleneC3-5cycloalkyl, OCH2CH2N(CH3)2, OH, C1-4alkylOH, NR23R24, SO2CH3, C(O)N(CH3)2, NHC(O)C1-3alkyl, or a C3-6heterocycloalkyl comprising one nitrogen located at the point of attachment to Ar2, or R12 together with a nitrogen atom to which it is attached forms an N-oxide (N+—O);
    • R23 is H or C1-2alkyl; and
    • R24 is H or C1-2alkyl;
    • or a salt and/or solvate thereof and/or derivative thereof.


Clause 2. The compound according to clause 1 which is a compound of formula (I):




embedded image


wherein

    • R1 is C1-4alkyl, C1-2alkyleneOC1-2alkyl or C0-1alkyleneC3-4cycloalkyl which cycloalkyl is optionally substituted by CH3;
    • R3 is H, CH3, F or Cl;
    • R4 and R5 are each independently H, C1-4alkyl, C0-2alkyleneC3-5cycloalkyl, C1-3 alkyleneOC1-3alkyl, C1-4alkylOH or C1-4haloalkyl;
    • R6 is H or C1-3alkyl;
    • Ar1 is a 6-membered aryl or heteroaryl;
    • Ar2 is a 6-membered aryl or heteroaryl and is attached to Ar1 in the para position relative to the amide;
    • R10 is H, halo, C1-3alkyl, OC1-2alkyl, C1-2haloalkyl, OC1-2haloalkyl or CN; and
    • R12 is attached to Ar2 in the meta position relative to Ar1 and R12 is H, halo, C1-4alkyl, C2alkynyl, C(═O)C1-2alkyl, C0-2alkyleneC3-5cycloalkyl, OC1-4alkyl, C1-3alkyleneOC1-3alkyl, C1-4haloalkyl, OC1-4haloalkyl or CN;
    • or a salt and/or solvate thereof and/or derivative thereof.


Clause 3. The compound according to clause 1 which is a compound of formula (I):




embedded image


wherein

    • R1 is C0-1alkyleneC3-4cycloalkyl;
    • R3 is H, CH3 or Cl;
    • R4 and R5 are each independently H, C1-4alkyl or C1-3alkyleneOC1-3alkyl;
      • or R4 together with R5 form a C3-6cycloalkyl ring
    • R6 is H or C1-3alkyl;
    • Ar1 is a 6-membered aryl or heteroaryl;
    • Ar2 is a 6-membered aryl or heteroaryl and is attached to Ar1 in the para position relative to the amide;
    • R10 is H, halo, C1-3alkyl, OC1-2alkyl or C1-2haloalkyl; and
    • R12 is attached to Ar2 in the meta position relative to Ar1 and R12 is H, halo, C1-4alkyl, C(═O)C1-2alkyl, OC1-4alkyl, C1-4haloalkyl, OC1-4haloalkyl or CN;
    • or a salt and/or solvate thereof and/or derivative thereof.


Clause 4. The compound according to any one of clauses 1 to 3 wherein R1 is C1-5alkyl.


Clause 5. The compound according to clause 4 wherein R1 is C1-4alkyl.


Clause 6. The compound according to any one of clauses 1 to 3 wherein R1 is C1-3 alkyleneOC1-2alkyl.


Clause 7. The compound according to any one of clauses 1 to 3 wherein R1 is C1-2 alkyleneOC1-2alkyl.


Clause 8. The compound according to any one of clauses 1 to 3 wherein R1 is C0-2alkyleneC3-5cycloalkyl which cycloalkyl is optionally substituted by CH3.


Clause 9. The compound according to clause 8 wherein R1 is C0-1alkyleneC3-4cycloalkyl which cycloalkyl is optionally substituted by CH3.


Clause 10. The compound according to clause 9 wherein R1 is C0-1alkyleneC3-4cycloalkyl.


Clause 11. The compound according to any one of clauses 9 or 10 wherein R1 is C3-4cycloalkyl.


Clause 12. The compound according to clause 11 wherein R1 is cyclopropyl.


Clause 13. The compound according to clause 9 wherein R1 is C0-1alkyleneC3-4cycloalkyl which cycloalkyl is substituted by CH3.


Clause 14. The compound according to any one of clauses 1 to 13 wherein R3 is H.


Clause 15. The compound according to any one of clauses 1 to 13 wherein R3 is Me.


Clause 16. The compound according to any one of clauses 1 to 13 wherein R3 is halo.


Clause 17. The compound according to clause 16 wherein R3 is F.


Clause 18. The compound according to clause 16 wherein R3 is Cl.


Clause 19. The compound according to any one of clauses 1 to 13 wherein R3 is OC1-2alkyl.


Clause 20. The compound according to any one of clauses 1 to 13 wherein R3 is OCF3.


Clause 21. The compound according to any one of clauses 1 to 13 wherein R3 is CF3.


Clause 22. The compound according to any one of clauses 1 to 21 wherein R4 is H.


Clause 23. The compound according to any one of clauses 1 to 21 wherein R4 is C1-6alkyl.


Clause 24. The compound according to clause 23 wherein R4 is C1-4alkyl.


Clause 25. The compound according to clause 24 wherein R4 is methyl or ethyl.


Clause 26. The compound according to any one of clauses 1 to 21 wherein R4 is C0-2alkyleneC3-6cycloalkyl.


Clause 27. The compound according to clause 26 wherein R4 is C0-2alkyleneC3-5cycloalkyl.


Clause 28. The compound according to any one of clauses 1 to 21 wherein R4 is C1-3 alkyleneOC1-3alkyl such as CH2CH2OCH3.


Clause 29. The compound according to any one of clauses 1 to 21 wherein R4 is C0-2alkyleneC3-6heterocycloalkyl.


Clause 30. The compound according to any one of clauses 1 to 21 wherein R4 is C1-6alkylOH.


Clause 31. The compound according to clause 30 wherein R4 is C1-4alkylOH.


Clause 32. The compound according to clause 1 to 21 wherein R4 is C1-6haloalkyl.


Clause 33. The compound according to clause 32 wherein R4 is C1-4haloalkyl.


Clause 34. The compound according to any one of clauses 1 to 33 wherein R5 is H.


Clause 35. The compound according to any one of clauses 1 to 33 wherein R5 is C1-6alkyl.


Clause 36. The compound according to clause 35 wherein R5 is C1-4alkyl.


Clause 37. The compound according to clause 36 wherein R5 is methyl or ethyl.


Clause 38. The compound according to any one of clauses 1 to 33 wherein R5 is C0-2alkyleneC3-6cycloalkyl.


Clause 39. The compound according to clause 38 wherein R5 is C0-2alkyleneC3-5cycloalkyl.


Clause 40. The compound according to any one of clauses 1 to 33 wherein R5 is C0-2alkyleneC3-6heterocycloalkyl.


Clause 41. The compound according to any one of clauses 1 to 33 wherein R5 is C1-3 alkyleneOC1-3alkyl such as CH2CH2OCH3.


Clause 42. The compound according to any one of clauses 1 to 33 wherein R5 is C1-6alkylOH.


Clause 43. The compound according to clause 42 wherein R5 is C1-4alkylOH.


Clause 44. The compound according to any one of clauses 1 to 33 wherein R5 is C1-6 haloalkyl.


Clause 45. The compound according to clause 44 wherein R5 is C1-4haloalkyl.


Clause 46. The compound according to any one of clauses 1 to 21 wherein R4 and R5 together with the carbon atom to which they are attached form a C3-6cycloalkyl such as cyclopropyl.


Clause 47. The compound according to any one of clauses 1 to 21 wherein R4 and R5 together with the carbon atom to which they are attached form a C3-6heterocycloalkyl such as tetrahydropyranyl or piperidinyl.


Clause 48. The compound according to any one of clauses 1 to 47 wherein at least one, such as one, nitrogen atom of a C3-6heterocycloalkyl ring is substituted, for example by C1-4 alkyl, C(O)H, C(O)C1-4alkyl, C(O)OC1-4alkyl, C(O)OC1-4alkylaryl such as C(O)OBz, C(O)NHC1-4 alkyl, C(O)NHC1-4alkylaryl such as C(O)NHBz, an Fmoc group, C(O)C1-4haloalkyl, C(O)OC1-4 haloalkyl or C(O)NHC1-4haloalkyl such as C(O)OtBu.


Clause 49. The compound according to any one of clauses 1 to 47 wherein any nitrogen atom in the C3-6heterocycloalkyl ring is not substituted.


Clause 50. The compound according to any one of clauses 1 to 49 wherein at least one, such as one, sulphur atom of a C3-6heterocycloalkyl ring is substituted, for example by one oxygen atom to form S═O or by two oxygen atoms to form S(O)2.


Clause 51. The compound according to any one of clauses 1 to 49 wherein any sulphur atom in the C3-6heterocycloalkyl ring is not substituted.


Clause 52. The compound according to any one of clauses 1 to 34 wherein R4 and R5 are both H.


Clause 53. The compound according to any one of clauses 1 to 37 wherein R4 and R5 are both methyl.


Clause 54. The compound according to any one of clauses 1 to 37 wherein R4 and R5 are both ethyl.


Clause 55. The compound according to any one of clauses 1 to 34 wherein R4 is ethyl and R5 is H.


Clause 56. The compound according to clause 55 wherein R4 and R5 are arranged in an S configuration.


Clause 57. The compound according to any one of clauses 1 to 56 wherein R6 is H.


Clause 58. The compound according to any one of clauses 1 to 56 wherein R6 is C1-3alkyl.


Clause 59. The compound according to clause 58 wherein R6 is methyl.


Clause 60. The compound according to any one of clauses 1 to 59 wherein Ar1 is phenyl.


Clause 61. The compound according to any one of clauses 1 to 59 wherein Ar1 is 2-pyridyl.


Clause 62. The compound according to any one of clauses 1 to 61 wherein Ar2 is 3-pyridyl.


Clause 63. The compound according to any one of clauses 1 to 61 wherein Ar2 is 2,5-pyrazinyl.


Clause 64. The compound according to any one of clauses 1 to 63 wherein R10 is H.


Clause 65. The compound according to any one of clauses 1 to 63 wherein R10 is halo such as F.


Clause 66. The compound according to any one of clauses 1 to 63 wherein R10 is C1-3alkyl such as methyl.


Clause 67. The compound according to any one of clauses 1 to 63 wherein R10 is OC1-2 alkyl such as OCH3.


Clause 68. The compound according to any one of clauses 1 to 63 wherein R10 is C1-2 haloalkyl such as CF3.


Clause 69. The compound according to any one of clauses 1 to 63 wherein R10 is OC1-2 haloalkyl.


Clause 70. The compound according to any one of clauses 1 to 63 wherein R10 is CN.


Clause 71. The compound according to any one of clauses 65 to 70 wherein R10 ortho to the amide.


Clause 72. The compound according to any one of clauses 1 to 71 wherein R11 is H.


Clause 73. The compound according to any one of clauses 1 to 71 wherein R11 is F.


Clause 74. The compound according to any one of clauses 1 to 71 wherein R11 is Cl.


Clause 75. The compound according to any one of clauses 1 to 71 wherein R11 is CH3.


Clause 76. The compound according to any one of clauses 1 to 71 wherein R11 is ethyl.


Clause 77. The compound according to any one of clauses 1 to 71 wherein R11 is OCH3.


Clause 78. The compound according to any one of clauses 1 to 71 wherein R11 is CF3.


Clause 79. The compound according to any one of clauses 1 to 71 wherein R11 is OCF3.


Clause 80. The compound according to any one of clauses 1 to 71 wherein R11 is CN.


Clause 81. The compound according to any one of clauses 1 to 80 wherein R12 is H.


Clause 82. The compound according to any one of clauses 1 to 80 wherein R12 is halo such as fluoro or chloro.


Clause 83. The compound according to any one of clauses 1 to 80 wherein R12 is C1-4alkyl such as CH3 or ethyl.


Clause 84. The compound according to any one of clauses 1 to 80 wherein R12 is C2-4alkynyl.


Clause 85. The compound according to clause 84 wherein R12 is C2alkynyl.


Clause 86. The compound according to any one of clauses 1 to 80 wherein R12 is C(═O)C1-2 alkyl such as C(═O)CH3.


Clause 87. The compound according to any one of clauses 1 to 80 wherein R12 is C0-2alkyleneC3-5cycloalkyl.


Clause 88. The compound according to any one of clauses 1 to 80 wherein R12 is OC1-4 alkyl such as OCH3, OEt or OiPr.


Clause 89. The compound according to any one of clauses 1 to 80 wherein R12 is C1-3 alkyleneOC1-3alkyl.


Clause 90. The compound according to any one of clauses 1 to 80 wherein R12 is C1-4 haloalkyl such as CF3.


Clause 91. The compound according to any one of clauses 1 to 80 wherein R12 is OC1-4 haloalkyl such as OCH2CF3.


Clause 92. The compound according to any one of clauses 1 to 80 wherein R12 is CN.


Clause 93. The compound according to any one of clauses 1 to 80 wherein R12 is OC0-2alkyleneC3-5cycloalkyl.


Clause 94. The compound according to any one of clauses 1 to 80 wherein R12 is OCH2CH2N(CH3)2.


Clause 95. The compound according to any one of clauses 1 to 80 wherein R12 is OH.


Clause 96. The compound according to any one of clauses 1 to 80 wherein R12 is C1-4alkylOH.


Clause 97. The compound according to any one of clauses 1 to 80 wherein R12 is NR23R24.


Clause 98. The compound according to clause 97 wherein R23 is H.


Clause 99. The compound according to clause 97 wherein R23 is C1-2alkyl such as CH3.


Clause 100. The compound according to any one of clauses 97 to 99 wherein R24 is H.


Clause 101. The compound according to any one of clauses 97 to 99 wherein R24 is C1-2alkyl such as CH3.


Clause 102. The compound according to any one of clauses 1 to 80 wherein R12 is SO2CH3.


Clause 103. The compound according to any one of clauses 1 to 80 wherein R12 is C(O)N(CH3)2.


Clause 104. The compound according to any one of clauses 1 to 80 wherein R12 is NHC(O)C1-3alkyl.


Clause 105. The compound according to any one of clauses 1 to 80 wherein R12 is a C3-6heterocycloalkyl comprising one nitrogen located at the point of attachment to Ar2.


Clause 106. The compound according to any one of clauses 1 to 80 wherein R12 together with a nitrogen atom to which it is attached forms an N-oxide (N+—O).


Clause 107. The compound according to any one of clauses 82 to 106 wherein R12 is attached at the meta position of Ar2.


Clause 108. The compound according to any one of clauses 82 to 106 wherein R12 is attached at the ortho position of Ar2.


Clause 109. A compound of the examples R1 to R71.


Clause 110. A compound of the examples R72 to R93.


Clause 111. A compound of INTE1 to INTE20 or INTF1 to INTF53.


Clause 112. A compound of INTE21 to INTE39.


Clause 113. A compound of formula (II):




embedded image


wherein R1, R3, R4 and R5 are as defined in any one of clauses 1 to 3.


Clause 114. A compound of formula (III):




embedded image


wherein R10, R12, Ar1 and Ar2 are as defined in any one of clauses 1 to 3.


Clause 115. A compound of formula (Ill-A):




embedded image


wherein R10, R11, R12, Ar1 and Ar2 are as defined in any one of clauses 1 to 3.


Clause 116. A compound of formula (VIII):




embedded image


wherein R1, R3 and R4 are as defined in any one of clauses 1 to 3.


Clause 117. A compound according to any one of clauses 113 to 116 which is in the form of a salt.


Clause 118. A compound according to any one of clauses 1 to 110, for use as a medicament.


Clause 119. The compound according to clause 118, for use in the inhibition of CTPS1 in a subject.


Clause 120. The compound according to clause 118, for use in the reduction of T-cell and/or B-cell proliferation in a subject.


Clause 121. The compound according to clause 118, for use in the treatment or prophylaxis of: inflammatory skin diseases such as psoriasis or lichen planus; acute and/or chronic GVHD such as steroid resistant acute GVHD; acute lymphoproliferative syndrome (ALPS); systemic lupus erythematosus, lupus nephritis or cutaneous lupus; or transplantation.


Clause 122. The compound according to clause 118, for use in the treatment or prophylaxis of myasthenia gravis, multiple sclerosis or scleroderma/systemic sclerosis.


Clause 123. A compound according to clause 118, for use in the treatment of cancer.


Clause 124. A method for treating cancer in a subject, by administering to a subject in need thereof a compound according to any one of clauses 1 to 110.


Clause 125. Use of a compound according to any one of clauses 1 to 110, in the manufacture of a medicament for the treatment of cancer in a subject.


Clause 126. The compound according to clause 123, the method according to clause 124 or the use according to clause 125 wherein the cancer is a haematological cancer.


Clause 127. The compound, method or use according to clause 126 wherein the haematological cancer is selected from the group consisting of Acute myeloid leukemia, Angioimmunoblastic T-cell lymphoma, B-cell acute lymphoblastic leukemia, Sweet Syndrome, T-cell Non-Hodgkins lymphoma (including natural killer/T-cell lymphoma, adult T-cell leukaemia/lymphoma, enteropathy type T-cell lymphoma, hepatosplenic T-cell lymphoma and cutaneous T-cell lymphoma), T-cell acute lymphoblastic leukemia, B-cell Non-Hodgkins lymphoma (including Burkitt lymphoma, diffuse large B-cell lymphoma, Follicular lymphoma, Mantle cell lymphoma, Marginal Zone lymphoma), Hairy Cell Leukemia, Hodgkin lymphoma, Lymphoblastic lymphoma, Lymphoplasmacytic lymphoma, Mucosa-associated lymphoid tissue lymphoma, Multiple myeloma, Myelodysplastic syndrome, Plasma cell myeloma, Primary mediastinal large B-cell lymphoma, chronic myeloproliferative disorders (such as chronic myeloid leukemia, primary myelofibrosis, essential thrombocytemia, polycytemia vera) and chronic lymphocytic leukemia.


Clause 128. The compound according to clause 123, the method according to clause 124 or the use according to clause 125 wherein the cancer is a non-haematological cancer such as bladder cancer, breast cancer, melanoma, neuroblastoma, malignant pleural mesothelioma and sarcoma, such as breast cancer and melanoma.


Clause 129. The compound according to clause 118, for use in enhancing recovery from vascular injury or surgery and reducing morbidity and mortality associated with neointima and restenosis in a subject.


Clause 130. A method for enhancing recovery from vascular injury or surgery and reducing morbidity and mortality associated with neointima and restenosis in a subject, by administering to a subject in need thereof a compound according to any one of clauses 1 to 110.


Clause 131. Use of a compound according to any one of clauses 1 to 110, in the manufacture of a medicament for enhancing recovery from vascular injury or surgery and reducing morbidity and mortality associated with neointima and restenosis in a subject.


Clause 132. A method for the inhibition of CTPS1 in a subject, which comprises administering to the subject an effective amount of a compound according to any one of clauses 1 to 110.


Clause 133. Use of a compound according to any one of clauses 1 to 110, in the manufacture of a medicament for the inhibition of CTPS1 in a subject.


Clause 134. A pharmaceutical composition comprising a compound according to any one of clauses 1 to 110.


Clause 135. The compound, method or use according to any one of clauses 118 to 133, for administration to a human subject.


Clause 136. The compound, method, use or composition according to any one of clauses 118 to 135, for administration in conjunction with a further pharmaceutically acceptable active ingredient or ingredients.


Clause 137. The compound, method, use or composition according to any one of clauses 118 to 136, for topical administration to the skin, eye or gut.


Clause 138. The compound according to any one of clauses 1 to 137, which is in natural isotopic form.


REFERENCES



  • Cheng, D. et al. Discovery of Pyridinyl Acetamide Derivatives as Potent, Selective, and Orally Bioavailable Porcupine Inhibitors. Medicinal Chemistry Letters, 7(7), 676-680; (2016).

  • Evans, D. R. & Guy, H. I. Mammalian pyrimidine biosynthesis: fresh insights into an ancient pathway. J. Biol. Chem. 279, 33035-33038; (2004).

  • Fairbanks, L. D., Bofill, M., Ruckemann, K. & Simmonds, H. A. Importance of ribonucleotide availability to proliferating T-lymphocytes from healthy humans. Disproportionate expansion of pyrimidine pools and contrasting effects of de novo synthesis inhibitors. J. Biol. Chem. 270, 29682-29689; (1995).

  • Higgins, M. J., Graves, P. R. & Graves, L. M. Regulation of human cytidine triphosphate synthetase 1 by glycogen synthase kinase 3. J. Biol. Chem. 282, 29493-29503; (2007).

  • Kursula, P., Flodin, S., Ehn, M., Hammarström, M., Schuler, H., Nordlund, P. and Stenmarka, P. Structure of the synthetase domain of human CTP synthetase, a target for anticancer therapy. Acta Crystallogr Sect F Struct Biol Cryst Commun. 62 (Pt7): 613-617; (2006).

  • Lieberman I. Enzymatic amination of uridine triphosphate to cytidine triphosphate. The J. Biol. Chem. 222 (2): 765-75; (1956).

  • Lübbers, T et al. Aminothiazoles as γ-secretase modulators. Bioorganic & Medicinal Chemistry Letters, 21(21), 6554-6558; 2011

  • Martin E. et al.; CTP synthase 1 deficiency in humans reveals its central role in lymphocytes proliferation. Nature. June 12; 510(7504):288-92 (2014). Erratum in: Nature. July 17; 511(7509):370 (2014).

  • McCluskey GD et al., Exploring the Potent Inhibition of CTP Synthase by Gemcitabine-5′-Triphosphate. Chembiochem. 17, 2240-2249 (2016).

  • Ostrander, D. B., O'Brien, D. J., Gorman, J. A. & Carman, G. M. Effect of CTP synthetase regulation by CTP on phospholipid synthesis in Saccharomyces cerevisiae. J. Biol. Chem. 273, 18992-19001; (1998).

  • Sakamoto K, Ishibashi Y, Adachi R, et al. Identification of cytidine-5-triphosphate synthasel-selective inhibitory peptide from random peptide library displayed on T7 phage. Peptides, 94:56-63 (2017).

  • Salu et al. Drug-eluting stents: a new treatment in the prevention of restenosis Part I: experimental studies. Acta Cardiol, 59, 51-61 (2004).

  • Sousa J. E. et al. Drug-Eluting Stents. Circulation, 107 (2003) 2274 (Part I), 2283 (Part II).

  • van den Berg, A. A. et al. Cytidine triphosphate (CTP) synthetase activity during cell cycle progression in normal and malignant T-lymphocytic cells. Eur. J. Cancer 31, 108-112 (1995).

  • van Kuilenburg, A. B. P, Meinsma, R., Vreken, P., Waterham, H. R., van Gennip, A. H. Identification of a cDNA encoding an isoform of human CTP synthetase. Biochimica et Biophysica Acta 1492548-552 (2000).

  • Xing-Li F. et al. Efficient Diphosphane-Based Catalyst for the Palladium-Catalyzed Suzuki Cross-Coupling Reaction of 3-Pyridylboronic Acids. European Journal of Organic Chemistry, (13), 2051-2054; (2009).


Claims
  • 1. A compound of formula (I):
  • 2. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein: R1 is C1-4alkyl, C1-2alkyleneOC1-2alkyl or C0-1alkyleneC3-4cycloalkyl which cycloalkyl is optionally substituted by CH3;R3 is H, CH3, F or Cl;R4 and R5 are each independently H, C1-4alkyl, C0-2alkyleneC3-5cycloalkyl, C1-3alkyleneOC1-3alkyl, C1-4alkylOH or C1-4haloalkyl;R6 is H or C1-3alkyl;Ar1 is a 6-membered aryl or 6-membered heteroaryl;Ar2 is a 6-membered aryl or 6-membered heteroaryl and is attached to Ar1 in the para position relative to the amide;R10 is H, halo, C1-3alkyl, OC1-2alkyl, C1-2haloalkyl, OC1-2haloalkyl or CN;R11 is H; andR12 is attached to Ar2 in the meta position relative to Ar1 and R12 is H, halo, C1-4alkyl, C2alkynyl, C(═O)C1-2alkyl, C0-2alkyleneC3-5cycloalkyl, OC1-4alkyl, C1-3alkyleneOC1-3alkyl, C1-4haloalkyl, OC1-4haloalkyl or CN;or a salt, solvate, or salt and solvate thereof.
  • 3. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein: R1 is C0-1alkyleneC3-4cycloalkyl;R3 is H, CH3 or Cl;R4 and R5 are each independently H, C1-4alkyl or C1-3alkyleneOC1-3alkyl; or R4 together with R5 form a C3-6cycloalkyl ringR6 is H or C1-3alkyl;Ar1 is a 6-membered aryl or 6-membered heteroaryl;Ar2 is a 6-membered aryl or 6-membered heteroaryl and is attached to Ar1 in the para position relative to the amide;R10 is H, halo, C1-3alkyl, OC1-2alkyl or C1-2haloalkyl; andR12 is attached to Ar2 in the meta position relative to Ar1 and R12 is H, halo, C1-4alkyl, C(═O)C1-2alkyl, OC1-4alkyl, C1-4haloalkyl, OC1-4haloalkyl or CN;or a salt, solvate, or salt and solvate thereof.
  • 4. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein R1 is C3-4cycloalkyl.
  • 5. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein R3 is H.
  • 6. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein R4 is H or C1-4alkyl.
  • 7. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein R5 is H or C1-4alkyl.
  • 8. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein R4 and R5 are both H, or R4 and R5 are both methyl, or R4 and R5 are both ethyl.
  • 9. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein R4 is CH2CH2OCH3 and R5 is H.
  • 10. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein R4 and R5 together with the carbon atom to which they are attached form a C3-6 cycloalkyl or C3-6heterocycloalkyl ring.
  • 11. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein R6 is H or methyl.
  • 12. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein: Ar1 is phenyl or 2-pyridyl.
  • 13. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein Ar2 is 3-pyridyl or 2,5-pyrazinyl.
  • 14. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein R10 is H, halo, C1-3alkyl, OC1-2alkyl or C1-2haloalkyl.
  • 15. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein R11 is H.
  • 16. The compound or pharmaceutically acceptable salt thereof according to claim 1 wherein R12 is H, halo, C1-4alkyl, C(═O)C1-2alkyl, OC1-4alkyl, C1-4haloalkyl or OC1-4haloalkyl.
  • 17. The compound or pharmaceutically acceptable salt thereof according to claim 4 wherein R1 is cyclopropyl.
  • 18. The compound or pharmaceutically acceptable salt thereof according to claim 16 wherein R12 is H, fluoro, chloro, CH3, Et, OCH3, OEt, OiPr, CF3 or OCH2CF3.
  • 19. A compound of formula (I):
  • 20. A salt of a compound of formula (I), wherein the salt is a pharmaceutically acceptable salt:
Priority Claims (3)
Number Date Country Kind
17204796 Nov 2017 EP regional
18163766 Mar 2018 EP regional
18175823 Jun 2018 EP regional
PCT Information
Filing Document Filing Date Country Kind
PCT/EP2018/083140 11/30/2018 WO
Publishing Document Publishing Date Country Kind
WO2019/106146 6/6/2019 WO A
US Referenced Citations (7)
Number Name Date Kind
6048884 Maruyama et al. Apr 2000 A
20030176476 Barf et al. Sep 2003 A1
20080139557 Blomgren et al. Jun 2008 A1
20160152583 Arisawa et al. Jun 2016 A1
20210002269 Quddus et al. Jan 2021 A1
20210024507 Quddus et al. Jan 2021 A1
20210387965 Quddus et al. Dec 2021 A1
Foreign Referenced Citations (21)
Number Date Country
104262071 Jan 2015 CN
1659113 May 2006 EP
2292603 Mar 2011 EP
1555007 Nov 1979 GB
1555007 Nov 1979 GB
1575803 Oct 1980 GB
WO 2006010751 Feb 2006 WO
WO 2006010751 Feb 2009 WO
WO 2009075874 Jun 2009 WO
WO 2014090715 Jun 2014 WO
WO 2014170435 Oct 2014 WO
WO 2019106146 Jun 2019 WO
WO 2019106156 Jun 2019 WO
WO 2019179652 Sep 2019 WO
WO 2019180244 Sep 2019 WO
WO 2020083975 Apr 2020 WO
WO 2020053402 Dec 2020 WO
WO 2020245664 Dec 2020 WO
WO 2020245665 Dec 2020 WO
WO 2021053403 Mar 2021 WO
WO 2022087634 Apr 2022 WO
Non-Patent Literature Citations (33)
Entry
International Search Report & Written Opinion PCT Application No. PCT/EP2018/083140, dated Jun. 6, 2019, 12 pages.
International Search Report & Written Opinion PCT Application No. PCT/EP2018/083169, dated Jun. 6, 2019, 12 pages.
Klapers, et al., “Copper-Catalyzed Halogen Exchange in Aryl Halides: An Aromatic Finkelstein Reaction,” J. Am. Chem. Soc., vol. 124, pp. 14844-14845, 2002.
Lai, et al., “A biocompatible inverse electron demand Diels-Alder reaction of aldehyde and tetrazine promoted by proline,” New J. Chem. vol. 40, pp. 8194-8197, 2016.
Mccluskey, et al., “Exploring the Potent Inhibition of CTP Synthase by Gemcitabine-5′-Triphosphate,” ChemBioChem., vol. 17, pp. 2240-2249, 2016.
Meng, et al., “Carboxylation of Aromatic and Aliphatic Bromides and Tritiates with CO2 by Dual Visible-Light-Nickel Catalysis,” Angew. Chem. Int. Ed., vol. 56, pp. 13426-13430, 2017.
Sakamoto, et al., “Identification of cytidine-5-triphosphate synthasel-selective inhibitory peptide from random peptide library displayed on T7 phage,” Peptides, vol. 94, pp. 56-63, 2017.
Thirumoorthi, et al., “A practical metal-free homolytic aromatic alkylation protocol for the synthesis of 3-(pyrazine-2-yl)bicycle[1.1.1]pentane-1-carboxylic acid,” Orig. Biomol. Chem., vol. 14, pp. 9485-9489, 2016.
Wang, et al., “Diamondoid-structured polymolybdate-based metal-organic frameworks as high-capacity anodes for lithium-ion batteries,” Chem. Commun., vol. 53, pp. 5204-5207, 2017.
Zhao, et al., “Design, synthesis and evaluation of aromatic heterocyclic derivatives as potent antifungal agents,” European Journal of Medicinal Chemistry, vol. 137, pp. 96-107, 2017.
Lynch, et al., “Structural basis for isoform-specific inhibition of human CTPS1,” PNAS, vol. 118, No. 40, 9 pages, 2021.
U.S. Appl. No. 17/760,886, Novak et al.
U.S. Appl. No. 17/760,861, Novak et al.
Klapars et al., “Copper-Catalyzed Halogen Exchange in Aryl Halides: An Aromatic Finkelstein Reaction,” Journal of the American Chemical Society, American Chemical Society, 124: 14844-14845 (2002).
Ananthakrishnanadar et al., “The Effects of Substituents on the Rate of Saponification of Biphenyl-4-carboxylates,” Journal of the Chemical Society, Perkin Transactions 2: Physical Organic Chemistry, 11 (1): 35-37 (1984).
Database Registry, Chemical Abstracts Service, XP055772827, Feb. 20, 2014.
Database Registry, Chemical Abstracts Service, XP055772837, Jun. 10, 2009.
Database Registry, Chemical Abstracts Service, XP055772841, Dec. 4, 2017.
Database Registry, Chemical Abstracts Service, XP055772832, Jun. 10, 2009.
Database Registry, Chemical Abstracts Service, XP055772844, Nov. 10, 2011.
Database Registry, Chemical Abstracts Service, XP002801975, Mar. 8, 2019.
Database Registry, Chemical Abstracts Service, XP002801976, Dec. 10, 2013.
Database Registry, Chemical Abstracts Service, XP002801977, Nov. 1, 2013.
Database Registry, Chemical Abstracts Service, XP002801978, Nov. 4, 2013.
Database Registry, Chemical Abstracts Service, XP002801979, Dec. 2, 2013.
Database Registry, Chemical Abstracts Service, XP002801980, Dec. 8, 2013.
Database Registry, Chemical Abstracts Service, XP002801981, Dec. 13, 2013.
Database Registry, Chemical Abstracts Service, XP002801982, Dec. 15, 2013.
Database Registry, Chemical Abstracts Service, XP002801983, Dec. 19, 2013.
Lee et al., “Identification of novel small molecule inhibitors against NS2B/NS3 serine protease from Zika virus,” Antiviral Research, 139: 49-58 (2016).
Lubbers et al., “Aminothiazoles as y-secretase modulators,” Bioorganic & Medicinal Chemistry Letters, 21: 6554-6558 (2011).
Tang et al., “CTP synthase 1, a smooth muscle-sensitive therapeutic target for effective vascular repair,” Atherosclerosis, Thrombosis and Vascular Biology, 33: 2336-2344 (2013).
National Centre for Biotechnology Information, PubChem Substance record for SID69002076, ZINC29974483, May 29, 2009.
Related Publications (1)
Number Date Country
20210380575 A1 Dec 2021 US