Patent Application
20240336909
The instant application contains a Sequence Listing which has been filed electronically in XML format and is hereby incorporated by reference in its entirety. Said XML copy, created on May 29, 2024, is named 47517_747_301.xml and is 1,264,298 bytes in size.
All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference, and as if set forth in their entireties.
T cell engagers transiently tether T cells to tumor cells and mediate T cell-directed tumor killing. T cell engagers, such as blinatumomab (BLINCYTO®), have demonstrated clinical activity in several hematological malignancies. Adoption of T cell engagers in solid tumors is limited by the scarcity of tumor antigens with sufficient differential expression between tumor and normal tissue. T cell engagers that are preferentially active in the tumor microenvironment may enable the safe targeting of more solid tumor antigens.
There is a need to extend the half-life of a therapeutic, diagnostic, or imaging molecule in circulation and also improve its ability to reach its target within an intended location (e.g., a tumor cell) without non-specific binding.
Provided herein is a conditionally active binding protein comprising: a binding moiety (M) which comprises a non-CDR loop, a cleavable linker (L), and a first target antigen binding domain (T1), wherein the binding moiety is capable of masking the binding of the first target antigen binding domain (T1) to its target, wherein the cleavable linker comprises a protease cleavage site that is recognized by at least one protease selected from the group consisting of: Neutrophil elastase, MMP-12, and MMP-13, and wherein the protease cleavage site is not recognized by furin.
In some embodiments, the protease cleavage site is further recognized by at least one protease selected from the group consisting of: a matriptase and a Urokinase-type Plasminogen Activator (uPA). In some embodiments, the protease cleavage site is further recognized by a matriptase but not by a uPA. In some embodiments, the protease cleavage site is not recognized by at least one protease selected from the group consisting of: MMP-14, Cathepsin-G, a matriptase, and a uPA. In some embodiments, the protease cleavable site is not recognized by at least one protease selected from the group consisting of: a matriptase and a uPA. In some embodiments, the protease cleavage site is further recognized by at least one protease selected from the group consisting of: MMP-2, MMP-7, MMP-8, and MMP-9. In some embodiments, the protease cleavage site is further recognized by at least one protease selected from the group consisting of: MMP-1, MMP-2, MMP-8, and MMP-9. In some embodiments, the protease cleavage site is further recognized by at least one protease selected from the group consisting of: MMP-2 and MMP-9. In some embodiments, the protease cleavage site is further recognized by at least one protease selected from the group consisting of: MMP-2, MMP-7, and MMP-9. In some embodiments, the protease cleavage site is further recognized by at least one protease selected from the group consisting of: MMP-2, MMP-8, and MMP-9. In some embodiments, the protease cleavage site is further recognized by at least one protease selected from the group consisting of: MMP-2 and MMP-7. In some embodiments, the protease cleavage site recognition by a protease is assayed by determining a percent cleavage of the cleavable linker comprising the protease cleavage site, in an assay wherein the cleavable linker is incubated with the protease for a period for about 1 hour at a temperature of about 37° C.
Provided herein is a conditionally active binding protein comprising a binding moiety (M) which comprises a non-CDR loop, a cleavable linker (L), and a first target antigen binding domain (T1), wherein the binding moiety is capable of masking the binding of the first target antigen binding domain to its target, wherein the cleavable linker comprises an amino acid sequence selected from the group consisting of: SEQ ID NOs: 910-931 and 985-996, or an amino acid sequence comprising one or more mutations in a sequence selected from the group consisting of SEQ ID NOs: 910-931 and 985-996.
In some embodiments, the conditionally active binding protein further comprises a second target antigen binding domain (T2). In some embodiments, the first (T1) or the second (T2) target antigen binding domain independently binds to a tumor antigen. In some cases, the tumor antigen is selected from the group consisting of: EGFR, PSMA, EpCAM, BCMA, 5T4, AFP, Axl, B7-H3, Cadherin-6, CAIX, CD117, CD123, CD138, CD166, CD19, CD20, CD205, CD22, CD30, CD33, CD352, CD37, CD38, CD44, CD52, CD56, CD70, CD71, CD74, CD79b, CEACAM5, c-MET, DLL3, EphA2, FAP, FGFR2, FGFR3, glypican-3, FLT-3, FOLRI, gpNMB, HER2, HPV-16 E6, HPV-16 E7, ITGA3, SLC39A6, Mesothelin, Muc1, Muc16, NaPi2b, Nectin-4, P-cadherin, Prolactin R, PSCA, PTK7, ROR1, SLC44A4, SLTRK5, SLTRK6, STEAP1, TIM1, Trop2, and WT1. In some embodiments, the first (T1) or the second (T2) target antigen binding domain independently binds to an immune modulatory protein. In some cases, the immune modulatory protein is selected from the group consisting of: CTLA-4, CD27, CD137, 2B4, TIGIT, CD155, ICOS, HVEM, CD40L, LIGHT, TIM-1, OX40, DNAM-1, PD-L1, PD1, PD-L2, CD8, CD40, CEACAM1, CD48, CD70, A2AR, CD39, CD73, B7-H3, B7-H4, BTLA, IDO1, IDO2, TDO, KIR, LAG-3, TIM-3, VISTA, IL6-R, IL-6, TNFα, CD19, CD20, CD22, CD52, integrin a4, integrin a4b7, CD11a, CTLA4-Ig fusion, IL-17, IL12/23, IL12, IL23, and TGF-beta. In some cases, the first (T1) or the second (T2) target antigen binding domain independently binds to an immune cell. In some cases, the first (T1) or the second (T2) target antigen binding domain independently binds to a T-cell. In some cases, the first (T1) or the second (T2) target antigen binding domain independently binds to CD3. In some embodiments, the binding moiety (M), the cleavable linker (L), the first target antigen binding domain (T1), and the second target antigen binding domain (T2) are in one of the following configurations: M:L:T1:T2, M:L:T2:T1, T1:T2:L:M, and T2:T1:L:M.
In some embodiments, the binding moiety is capable of binding to a half-life extending protein. In some embodiments, the binding moiety is a natural peptide, a synthetic peptide, an engineered scaffold, or an engineered bulk serum protein. In some cases, the engineered scaffold comprises an sdAb, an scFv, a Fab, a VHH, a fibronectin type III domain, an immunoglobulin-like scaffold, a DARPin, a cystine knot peptide, a lipocalin, a three-helix bundle scaffold, a protein G-related albumin-binding module, a DNA aptamer scaffold, or an RNA aptamer scaffold. In some embodiments, the non-CDR loop is from a variable domain, a constant domain, a C1-set domain, a C2-set domain, an I-domain, or any combinations thereof. In some embodiments, the binding moiety further comprises complementarity determining regions (CDRs). In some embodiments, the binding moiety comprises a binding site specific for a bulk serum protein. In some cases, the bulk serum protein is selected from the group consisting of: albumin, transferrin, IgG1, IgG2, IgG4, IgG3, IgA monomer, Factor XIII, Fibrinogen, IgE, and pentameric IgM. In some embodiments, the binding moiety further comprises a binding site specific for an immunoglobulin light chain. In some cases, the immunoglobulin light chain is an Igκ free light chain. In some embodiments, the CDRs provide the binding site specific for the bulk serum protein or the immunoglobulin light chain, or any combinations thereof. In some embodiments, the binding moiety is capable of masking the binding of the first target antigen binding domain (T1) to its target via specific intermolecular interactions between the binding moiety and the first target antigen binding domain. In some embodiments, the non-CDR loop provides a binding site specific for binding of the binding moiety to the first target antigen binding domain.
In some embodiments, the conditionally active binding protein further comprises a half-life extension domain bound to the binding moiety, wherein the half-life extension domain provides the binding protein with a safety switch, and wherein upon cleavage of the linker the binding protein is activated by separation of the binding moiety and the half-life extension domain from the first target antigen binding domain, and the binding protein is thereby separated from the safety switch. In some cases, the cleavage of the cleavable linker is in a tumor microenvironment. In some embodiments, the non-CDR loop comprises a CC′ loop of at least one of: a camelid VHH domain, a human VH domain, a humanized VH domain, or a single domain antibody. In some embodiments, the binding moiety comprises a masking sequence, wherein the masking sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 259-301 and 795, or a sequence comprising one or more mutations in a sequence selected from the group consisting of: SEQ ID NOs: 259-301 and 795. In some embodiments, the cleavable linker comprises a sequence selected from the group consisting of SEQ ID NOs: 910-931, or a sequence comprising one or more mutations in a sequence selected from the group consisting of SEQ ID NOs: 910-931. In some embodiments, the cleavable linker comprises a sequence selected from the group consisting of: SEQ ID NOs: 985-996, or a sequence comprising one or more mutations in a sequence selected from the group consisting of SEQ ID NOs: 985-996.
Provided herein is a method of treating a disease comprising administering to a subject an effective amount of a conditionally active binding protein. In some cases, the subject is a human. In some cases, the disease is a tumorous disease or an inflammatory disease. In some cases, the disease is the tumorous disease, and wherein the tumorous disease is characterized by overexpression of at least one of EpCAM, PSMA, EGFR, BCMA, DLL3, FLT3, or combinations thereof.
Provided herein is a cleavable linker comprising a sequence selected from the group consisting of: SEQ ID NOs: 915-917, 919, 920 and 929-931.
The novel features of the disclosure are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present disclosure will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the disclosure are utilized, and the accompanying drawings of which.
While preferred embodiments of the present disclosure have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the disclosure. It should be understood that various alternatives to the embodiments of the disclosure described herein may be employed in practicing the disclosure. It is intended that the following claims define the scope of the disclosure and that methods and structures within the scope of these claims and their equivalents be covered thereby.
Provided herein in certain embodiments are ProTriTAC molecules (also referred to herein as protrisecific molecules) that are T cell engager prodrugs designed to be conditionally active in a tumor microenvironment. In some cases, this enables targeting of a wider selection of tumor antigens (e.g., solid tumor antigens). The ProTriTAC molecules, in some examples, combine the desirable attributes of several prodrug approaches, including, but not limited to: combination of steric and specific masking, wherein the steric masking is, in some cases, is through albumin that is recognized by an anti-albumin domain in a ProTriTAC molecule, and the specific masking, in some cases, is through specific intermolecular interactions between an anti-albumin domain (in some examples) and a target antigen binding domain of the ProTriTAC molecule (such as, an anti-CD3 scFv domain, in some examples); additional safety imparted by half-life differential of prodrug versus an active drug, derived by activation of the conditionally activated ProTriTAC molecule; ability to plug-and-play with different tumor target binders.
The terminology used herein is for the purpose of describing particular cases only and is not intended to be limiting. As used herein, the singular forms “a”, “an” and “the” are intended to include the plural forms as well, unless the context clearly indicates otherwise. Furthermore, to the extent that the terms “including”, “includes”, “having”, “has”, “with”, or variants thereof are used in either the detailed description and/or the claims, such terms are intended to be inclusive in a manner similar to the term “comprising.”
The term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, e.g., the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the given value. Where particular values are described in the application and claims, unless otherwise stated the term “about” should be assumed to mean an acceptable error range for the particular value.
The terms “individual,” “patient,” or “subject” are used interchangeably. None of the terms require or are limited to situation characterized by the supervision (e.g. constant or intermittent) of a health care worker (e.g. a doctor, a registered nurse, a nurse practitioner, a physician's assistant, an orderly, or a hospice worker).
A “single chain Fv” or “scFv”, as used herein, refers to a binding protein in which the variable domains of the heavy chain and of the light chain of a traditional two chain antibody are joined to form one chain. Typically, a linker peptide is inserted between the two chains to allow for proper folding and creation of an active binding site.
A “cleavage site for a protease,” or “protease cleavage site”, as meant herein, is an amino acid sequence that can be cleaved by a protease, such as, for example, a matrix metalloproteinase or a furin. Examples of such sites include Gly-Pro-Leu-Gly-Ile-Ala-Gly-Gln (SEQ ID NO: 1120) or Ala-Val-Arg-Trp-Leu-Leu-Thr-Ala (SEQ ID NO: 1121), which can be cleaved by metalloproteinases, and Arg-Arg-Arg-Arg-Arg-Arg, which is cleaved by a furin. In therapeutic applications, the protease cleavage site can be cleaved by a protease that is produced by target cells, for example cancer cells or infected cells, or pathogens.
As used herein, “elimination half-time” is used in its ordinary sense, as is described in Goodman and Gillman's The Pharmaceutical Basis of Therapeutics 21-25 (Alfred Goodman Gilman, Louis S. Goodman, and Alfred Gilman, eds., 6th ed. 1980). Briefly, the term is meant to encompass a quantitative measure of the time course of drug elimination. The elimination of most drugs is exponential (i.e., follows first-order kinetics), since drug concentrations usually do not approach those required for saturation of the elimination process. The rate of an exponential process may be expressed by its rate constant, k, which expresses the fractional change per unit of time, or by its half-time, t1/2 the time required for 50% completion of the process. The units of these two constants are time−1 and time, respectively. A first-order rate constant and the half-time of the reaction are simply related (k×t1/2=0.693) and may be interchanged accordingly. Since first-order elimination kinetics dictates that a constant fraction of drug is lost per unit time, a plot of the log of drug concentration versus time is linear at all times following the initial distribution phase (i.e., after drug absorption and distribution are complete). The half-time for drug elimination can be accurately determined from such a graph.
A “therapeutic agent,” as used herein, includes a “binding molecule.”
The term “binding molecule,” as used herein is any molecule, or portion or fragment thereof, that can bind to a target molecule, cell, complex and/or tissue, and which includes proteins, nucleic acids, carbohydrates, lipids, low molecular weight compounds, and fragments thereof, each having the ability to bind to one or more of a soluble protein, a cell surface protein, a cell surface receptor protein, an intracellular protein, a carbohydrate, a nucleic acid, a hormone, or a low molecular weight compound (small molecule drug), or a fragment thereof. The binding molecule, in some instances, is a protein belonging to the immunoglobulin superfamily, or a non-immunoglobulin binding molecule. The “binding molecule” does do not include a cytokine.
The term “proteins belonging to immunoglobulin superfamily,” or “immunoglobulin molecules,” as used herein, include proteins that comprise an immunoglobulin fold, such as antibodies and target antigen binding fragments thereof, antigen receptors, antigen presenting molecules, receptors on natural killer cells, antigen receptor accessory molecules, receptors on leukocytes, IgSF cellular adhesion molecules, growth factor receptors, and receptor tyrosine kinases/phosphatases.
The term “antibodies” include antibodies or immunoglobulins of any isotype, fragments of antibodies that retain specific binding to antigen, including, but not limited to, Fab, Fv, scFv, and Fd fragments, chimeric antibodies, humanized antibodies, single-chain antibodies (scAb), single domain antibodies (dAb), single domain heavy chain antibodies, a single domain light chain antibodies, bi-specific antibodies, multi-specific antibodies, and fusion proteins comprising an antigen-binding (also referred to herein as antigen binding) portion of an antibody and a non-antibody protein. The antibodies, in some examples, are detectably labeled, e.g., with a radioisotope, an enzyme that generates a detectable product, a fluorescent protein, and the like. The antibodies, in some cases, are further conjugated to other moieties, such as members of specific binding pairs, e.g., biotin (member of biotin-avidin specific binding pair), and the like. The antibodies, in some cases, are bound to a solid support, including, but not limited to, polystyrene plates or beads, and the like. Also encompassed by the term are Fab′, Fv, F(ab′)2, and or other antigen binding fragments that retain specific binding to antigen, and monoclonal antibodies. As used herein, a monoclonal antibody is an antibody produced by a group of identical cells, all of which were produced from a single cell by repetitive cellular replication. That is, the clone of cells only produces a single antibody species. While a monoclonal antibody can be produced using hybridoma production technology, other production methods known to those skilled in the art can also be used (e.g., antibodies derived from antibody phage display libraries). An antibody, in some instances, is monovalent or bivalent. An antibody, in some instances, is an Ig monomer, which is a “Y-shaped” molecule that consists of four polypeptide chains: two heavy chains and two light chains connected by disulfide bonds.
The term “non-immunoglobulin binding molecules,” as used herein, include, but is not limited to examples such as a growth factor, a hormone, a signaling protein, an inflammatory mediator, ligand, a receptor, or a fragment thereof, a native hormone or a variant thereof being able to bind to its natural receptor; a nucleic acid or polynucleotide sequence being able to bind to complementary sequence or a soluble cell surface or intracellular nucleic acid/polynucleotide binding proteins, a carbohydrate binding moiety being able to bind to other carbohydrate binding moieties, cell surface or intracellular proteins, a low molecular weight compound (drug) that binds to a soluble or cell surface or intracellular target protein. The non-immunoglobulin binding molecules, in some cases, include coagulation factors, plasma proteins, fusion proteins, and imaging agents. The non-immunoglobulin binding molecules do not include a cytokine.
A “cytokine,” as meant herein, refers to intercellular signaling molecules, and active fragments and portions thereof, which are involved in the regulation of mammalian somatic cells. A number of families of cytokines, for example, interleukins, interferons, and transforming growth factors are included.
As used herein, “non-CDR loops” within immunoglobulin (Ig) molecules are regions of a polypeptide other than the complementarity determining regions (CDRs) of an antibody. These regions may be derived from an antibody or an antibody fragment. These regions may also be synthetically or artificially derived, such as through mutagenesis or polypeptide synthesis.
In an Ig, Ig-like, or beta-sandwich scaffold that has 9 beta-strands (e.g., a VH, a VL, a camelid VHH, a sdAb), the non-CDR loops can refer to the AB, CC′, C″D, EF loops or loops connecting beta-strands proximal to the C-terminus. In an Ig, Ig-like, or beta-sandwich scaffold that has 7 beta-strands (e.g., a CH, a CL, an adnectin, a Fn-III), the non-CDR loops can refer to the AB, CD, and EF loops or loops connecting beta-strands proximal the C-terminus. In other Ig-like or beta-sandwich scaffolds, the non-CDR loops are the loops connecting beta-strands proximal to the C-terminus or topologically equivalent residues using the framework established in the Halaby 1999 publication (Prot Eng Des Sel 12:563-571).
In a non-beta-sandwich scaffold (e.g., a DARPin, an affimer, an affibody), the “non-CDR loops” refer to an area that is (1) amenable for sequence randomization to allow engineered specificities to a second antigen, and (2) distal to the primary specificity determining region(s) typically used on the scaffold to allow simultaneous engagement of the scaffold to both antigens without steric interference. For this purpose, the primary specificity determining region(s) can be defined using the framework established in the Skrlec 2015 publication (Trends in Biotechnol, 33:408-418). An excerpt of the framework is listed below.
“Target antigen binding domain”, as used herein, refers to a region which targets a specific antigen. A target antigen binding domain comprises, for example an sdAb, an scFv, a variable heavy chain antibody (VHH), a variable heavy (VH) or a variable light domain (VL), a full-length antibody, or any other peptide that has a binding affinity towards a specific antigen. The target antigen binding domain does do not include a cytokine.
“TriTAC,” as used herein refers to a trispecific binding protein that is not conditionally activated.
This disclosure provides, in some embodiments, binding moieties that are capable of masking the interaction of binding molecules with their targets. In some embodiments, a binding moiety of this disclosure comprises a masking moiety and a cleavable linker, such as a protease cleavable linker. In some embodiments, a binding moiety of this disclosure comprises a masking moiety (e.g., a modified non-CDR loop sequence) and a non-cleavable linker. As illustrated in
In some embodiments, the ProTriTAC molecule is protease-activated. In some embodiments, the protease-activated ProTriTAC molecule is about 2 times, 5 times, 10 times, 20 times, 30 times, 40 times, 50 times, 60 times, 70 times, 80 times, 90 times, 100 times, 120 times, 140 times, 150 times, 160 times, 180 times, 200 times, 220 times, 250 times, 270 times, 300 times, 325 times, 350 times, 375 times, 400 times, 425 times, 450 times, 475 times, or 500 times more potent in binding CD3 as compared to a non-cleavable ProTriTAC molecule in CD3 binding and T cell mediated cell killing. In some embodiments, the protease-activated ProTriTAC molecule is about 2 times, 5 times, 10 times, 20 times, 30 times, 40 times, 50 times, 60 times, 70 times, 80 times, 90 times, 100 times, 120 times, 140 times, 150 times, 160 times, 180 times, 200 times, 220 times, 250 times, 270 times, 300 times, 325 times, 350 times, 375 times, 400 times, 425 times, 450 times, 475 times, or 500 times more potent in binding CD3 as compared to a recombinant active drug fragment mimicking the protease-activated ProTriTAC molecule, in CD3 binding and T cell mediated cell killing. In some embodiments, the ProTriTAC molecules target EGFR. In some embodiments, an EGFR targeting protease-activated cleavable ProTriTAC molecule is about 1.1 times, 1.2 times, 1.3. times, 1.5 times, 2 times, 3 times, 4 times, 5 times, or about 10 times more potent in arresting tumor growth compared to an EGFR targeting non-cleavable ProTriTAC molecule. IN some embodiments, the protease-activated cleavable ProTriTAC molecule has about 2 fold, 5 fold, 10 fold, 20 fold, 30 fold, 40 fold, 50 fold, 60 fold, 70 fold, 80 fold, 90 fold, 100 fold, 120 fold, 140 fold, 160 fold, 180 fold, 200 fold or 250 fold longer circulating exposure compared to a non-cleavable ProTriTAC molecule.
Provided herein, in a first embodiment, is a binding moiety that masks the binding of a target antigen binding domain and is capable of binding to a bulk-serum protein, such as a half-life extending protein. The binding moiety of the first embodiment, in certain instances, further comprises a cleavable linker attached to it. The cleavable linker, for example, comprises a protease cleavage site or a pH dependent cleavage site. The cleavable linker, in certain instances, is cleaved only in a tumor micro-environment. Thus, in some examples, the binding moiety of the first embodiment, bound to the half-life extending protein, connected to the cleavable linker, and further bound to the target antigen binding domain, maintains the target antigen binding domain in an inert state in circulation until the cleavable linker is cleaved off in a tumor microenvironment. The half-life of the target antigen binding domain, such as an antibody or an antigen binding fragment thereof, is thus extended in systemic circulation by using the binding moiety of the first embodiment which acts as a safety switch that keeps the target antigen binding moiety in an inert state until it reaches the tumor microenvironment where it is conditionally activated by cleavage of the linker and is able to bind its target antigen. In some embodiments, a protease cleavage site comprises an amino acid sequence selected from a group consisting of SEQ ID NOs: 1108-1117, 1120, and/or 1121.
In a second embodiment is provided a binding moiety that masks the interaction between a non-immunoglobulin binding molecule and its target. The binding moiety of the second embodiment, in certain instances, is capable of binding to a bulk serum protein. In some instances, the binding moiety of the second embodiment further comprises a cleavable linker attached to it. The cleavable linker, for example, comprises a protease cleavage site or a pH dependent cleavage site. In some embodiments, the cleavable linker comprises a protease cleavage site comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1108-1117, 1120, and/or 1121. The cleavable linker, in certain instances, is cleaved only in a tumor micro-environment. The non-immunoglobulin binding molecule is, in some cases, maintained in an inert state by the binding moiety of the second embodiment and activated by cleavage of the linker, for example in a target environment. In some instances, the cleavable linker is cleaved off in a tumor microenvironment and in such cases the tumor microenvironment is the target environment. The half-life of the non-immunoglobulin binding molecule is thus extended in systemic circulation by using the binding moiety of the second embodiment which acts as a safety switch that keeps the non-immunoglobulin binding molecule in an inert state until it reaches the target environment where it is conditionally activated by cleavage of the linker. In some examples of the second embodiment where the non-immunoglobulin binding molecule is an imaging agent, said agent is activated in a target environment upon cleavage of the cleavable linker. The target environment, in such cases, is a tissue or a cell or any biological environment that is to be imaged using the imaging agent.
The safety switch described above provides several advantages: some examples including (i) expanding the therapeutic window of the immunoglobulin molecule, such as a target antigen binding domain, a non-immunoglobulin binding molecule; (ii) reducing target-mediated drug disposition by maintaining the immunoglobulin molecule, such as a target antigen binding domain, the non-immunoglobulin binding molecule, in an inert state when a conditionally active protein comprising a binding moiety according to the first or second embodiments is in systemic circulation; (iii) reducing the concentration of undesirable activated proteins in systemic circulation, thereby minimizing the spread of chemistry, manufacturing, and controls related impurities, e.g., pre-activated drug product, endogenous viruses, host-cell proteins, DNA, leachables, anti-foam, antibiotics, toxins, solvents, heavy metals; (iv) reducing the concentration of undesirable activated proteins in systemic circulation, thereby minimizing the spread of product related impurities, aggregates, breakdown products, product variants due to: oxidation, deamidation, denaturation, loss of C-term Lys in MAbs; (v) preventing aberrant activation of the immunoglobulin molecule, such as a target antigen binding domain, or the non-immunoglobulin binding molecule in circulation; (vi) reducing the toxicities associated with the leakage of activated species from diseased tissue or other pathophysiological conditions, e.g., tumors, autoimmune diseases, inflammations, viral infections, tissue remodeling events (such as myocardial infarction, skin wound healing), or external injury (such as X-ray, CT scan, UV exposure); and (vii) reducing non-specific binding of the immunoglobulin molecule, such as a target antigen binding domain, or the non-immunoglobulin binding molecule. Furthermore, post-activation, or in other words post breaking of the safety switch, the immunoglobulin molecule, such as a target antigen binding domain, the non-immunoglobulin binding molecule is separated from the safety switch which provided extended half-life, and thus is cleared from circulation.
In addition, the binding moieties of the first, second, and the third embodiments, in some cases, are used to generate a “biobetter” version of a biologic. Generally, preparing a biobetter form of a molecule, e.g., an antibody or an antigen binding fragment thereof, involves taking the originator molecule and making specific alterations in it to improve its parameters and thereby make it a more efficacious, less frequently dosed, better targeted, and/or a better tolerated drug. Thus, a target antigen binding domain masked by the binding moiety of the first embodiment which is bound to a half-life extending protein, and conditionally activated in a tumor microenvironment by cleavage of the cleavable linker, gives the target antigen binding domain a significantly longer serum half-life and reduces the likelihood of its undesirable activation in circulation, thereby producing a “biobetter” version of the target antigen binding domain. Similarly, the binding moieties of the second embodiment are, in some cases, utilized to generate biobetter versions of the non-immunoglobulin binding molecules. Accordingly, in various embodiments, biobetter versions of immunoglobulin molecules, non-immunoglobulin binding molecules are provided, wherein the biobetter function is attributed to a binding moiety, respectively, according to the first or second embodiments.
The binding moieties described herein comprise at least one non-CDR loop. In some embodiments, a non-CDR loop provides a binding site for binding of the binding moiety of the first embodiment to a target antigen binding domain. In some examples of the first embodiment, a non-CDR loop provides a binding site for binding of the binding moiety of the first embodiment to an immunoglobulin molecule, such as a target antigen binding domain. In some examples of the second embodiment, a non-CDR loop provides a binding site for binding of the binding moiety of the second embodiment to a non-immunoglobulin binding molecule. In some cases, the binding moiety of the first embodiment masks binding of the target binding domain to the target antigen, e.g., via steric occlusion, via specific intermolecular interactions, or a combination of both. The binding moieties of the second embodiment also, in some cases, mask binding of a non-immunoglobulin binding molecule to their targets, via steric occlusion, via specific intermolecular interactions, or a combination of both.
In some embodiments, the binding moieties described herein further comprise complementarity determining regions (CDRs). In some instances, the binding moieties are domains derived from an immunoglobulin molecule (Ig molecule). The Ig may be of any class or subclass (IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM etc). A polypeptide chain of an Ig molecule folds into a series of parallel beta strands linked by loops. In the variable region, three of the loops constitute the “complementarity determining regions” (CDRs) which determine the antigen binding specificity of the molecule. An IgG molecule comprises at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding fragment thereof. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs) with are hypervariable in sequence and/or involved in antigen recognition and/or usually form structurally defined loops, interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. In some embodiments of this disclosure, at least some or all of the amino acid sequences of FR1, FR2, FR3, and FR4 are part of the “non-CDR loop” of the binding moieties described herein. As shown in
Within the variable domain, the CDRs are believed to be responsible for antigen recognition and binding, while the FR residues are considered a scaffold for the CDRs. However, in certain cases, some of the FR residues play an important role in antigen recognition and binding. Framework region residues that affect Ag binding are divided into two categories. The first are FR residues that contact the antigen, thus are part of the binding-site, and some of these residues are close in sequence to the CDRs. Other residues are those that are far from the CDRs in sequence but are in close proximity to it in the 3-D structure of the molecule, e.g., a loop in heavy chain.
In some embodiments, the non-CDR loop is modified to generate an antigen binding site specific for a bulk serum protein, such as albumin. It is contemplated that various techniques can be used for modifying the non-CDR loop, e.g., site-directed mutagenesis, random mutagenesis, insertion of at least one amino acid that is foreign to the non-CDR loop amino acid sequence, amino acid substitution. An antigen peptide is inserted into a non-CDR loop, in some examples. In some examples, an antigenic peptide is substituted for the non-CDR loop. The modification, to generate an antigen binding site, is in some cases in only one non-CDR loop. In other instances, more than one non-CDR loop are modified. For instance, the modification is in any one of the non-CDR loops shown in
In certain examples, the binding moiety of the first embodiment is bound to a target antigen binding domain via one or more of AB, CC′, C″ D, and E-F loop and is bound to a bulk-serum protein, such as albumin, via one or more of BC, C′C″, and FG loop. In certain examples, the binding moiety of the first embodiment is bound to a bulk serum protein, such as albumin, via its AB, CC′, C″ D, or EF loop and is bound to a target antigen binding domain via its BC, C′C″, or FG loop. In certain examples, the binding moiety of the first embodiment is bound to a bulk serum protein, such as albumin, via its AB, CC′, C″ D, and EF loop and is bound to a target antigen binding domain via its BC, C′C″, and FG loop. In certain examples, the binding moiety of the first embodiment is bound to a bulk serum protein, such as albumin, via one or more of AB, CC′, C″ D, and E-F loop and is bound to the target antigen binding protein, via one or more of BC, C′C″, and FG loop.
In certain examples, the binding moiety of the second embodiment is bound to a non-immunoglobulin molecule via one or more of AB, CC′, C″ D, and E-F loop and is bound to a bulk-serum protein, such as albumin, via one or more of BC, C′C″, and FG loop. In certain examples, the binding moiety of the second embodiment is bound to a bulk serum protein, such as albumin, via its AB, CC′, C″ D, or EF loop and is bound to a non-immunoglobulin molecule via its BC, C′C″, or FG loop. In certain examples, the binding moiety of the second embodiment is bound to a bulk serum protein, such as albumin, via its AB, CC′, C″ D, and EF loop and is bound to a non-immunoglobulin molecule via its BC, C′C″, and FG loop. In certain examples, the binding moiety of the second embodiment is bound to a bulk serum protein, such as albumin, via one or more of AB, CC′, C″ D, and E-F loop and is bound to a non-immunoglobulin molecule, via one or more of BC, C′C″, and FG loop.
The binding moieties are any kinds of polypeptides. For example, in certain instances the binding moieties are natural peptides, synthetic peptides, or fibronectin scaffolds, or engineered bulk serum proteins. The bulk serum protein comprises, for example, albumin, fibrinogen, or a globulin. In some embodiments, the binding moieties are engineered scaffolds. Engineered scaffolds comprise, for example, sdAb, a scFv, a Fab, a VHH, a fibronectin type III domain, immunoglobulin-like scaffold (as suggested in Halaby et al., 1999. Prot Eng 12(7):563-571), DARPin, cystine knot peptide, lipocalin, three-helix bundle scaffold, protein G-related albumin-binding module, or a DNA or RNA aptamer scaffold.
In some cases, the binding moiety of the first embodiment binds to at least one target antigen binding domain. In further embodiments, the non-CDR loops within the binding moiety of the first embodiment provide a binding site for the at least one target antigen binding domain. The target antigen binding domain, in some cases, binds to target antigens expressed on the surface of a diseased cell or tissue, for example a tumor or a cancer cell. Target antigens include but are not limited to EpCAM, EGFR, HER-2, HER-3, c-Met, FoIR, PSMA, CD38, BCMA, and CEA. 5T4, AFP, B7-H3, CDH-6, CAIX, CD117, CD123, CD138, CD166, CD19, CD20, CD205, CD22, CD30, CD33, CD352, CD37, CD44, CD52, CD56, CD70, CD71, CD74, CD79b, DLL3, EphA2, FAP, FGFR2, FGFR3, GPC3, gpA33, FLT-3, gpNMB, HPV-16 E6, HPV-16 E7, ITGA2, ITGA3, SLC39A6, MAGE, mesothelin, Muc1, Muc16, NaPi2b, Nectin-4, CDH-3, CDH-17, EPHB2, ITGAV, ITGB6, NY-ESO-1, PRLR, PSCA, PTK7, ROR1, SLC44A4, SLITRK5, SLITRK6, STEAP1, TIM1, Trop2, or WT1.
In some cases, the binding moiety of the first embodiment is bound to a first target antigen binding domain via its non-CDR loops and the first target antigen binding domain is further connected to a second target antigen binding domain. Examples of first and second target antigen binding domains include, but are not limited to, a T cell engager, a bispecific T cell engager, a dual-affinity re-targeting antibody, a variable heavy domain (VH), a variable light domain (VL), a scFv comprising a VH and a VL domain, a soluble TCR fragment comprising a Valpha and Vbeta domain, a single domain antibody (sdAb), or a variable domain of camelid derived nanobody (VHH), a non-Ig binding domain, i.e., antibody mimetic, such as anticalins, affilins, affibody molecules, affimers, affitins, alphabodies, avimers, DARPins, fynomers, kunitz domain peptides, and monobodies, a ligand or peptide. In some examples, the first or the second target antigen binding domain is a VHH domain. In some examples, the first or the second target antigen binding domain is a sdAb. In some instances, the first target antigen binding domain is specific for a tumor antigen, such as EGFR, and the second target antigen binding domain is specific for CD3. The binding of the first target antigen binding domain to its target, e.g., a tumor antigen such as EGFR, is masked by the binding moiety of the first embodiment, via its non-CDR loops. One exemplary conditionally active protein, comprising a binding moiety according to the first embodiment, is shown in
In some cases, the non-CDR loops within the binding moiety of the second embodiment provide a binding site for a non-immunoglobulin binding molecule.
In some cases, the binding moieties comprise a binding site for a bulk serum protein. In some embodiments, the CDRs within the binding moieties provide a binding site for the bulk serum protein. The bulk serum protein is, in some examples, a globulin, albumin, transferrin, IgG1, IgG2, IgG4, IgG3, IgA monomer, Factor XIII, Fibrinogen, IgE, or pentameric IgM. In some embodiments, the binding moieties comprise a binding site for an immunoglobulin light chain. In some embodiments, the CDRs provide a binding site for the immunoglobulin light chain. The immunoglobulin light chain is, in some examples, an IgK free light chain or an Ig, free light chain.
In some examples, the binding moieties comprise any type of binding domain, including but not limited to, domains from a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody. In some embodiments, the binding moiety is a single chain variable fragment (scFv), a soluble TCR fragment, a single-domain antibody such as a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain (VHH) of camelid derived nanobody. In other embodiments, the binding moieties are non-Ig binding domains, i.e., antibody mimetic, such as anticalins, affilins, affibody molecules, affimers, affitins, alphabodies, avimers, DARPins, fynomers, kunitz domain peptides, and monobodies.
It is contemplated herein that in some embodiments of this disclosure the binding moieties described herein comprise at least one cleavable linker. In one aspect, the cleavable linker comprises a polypeptide having a sequence recognized and cleaved in a sequence-specific manner. The cleavage, in certain examples, is enzymatic, based on pH sensitivity of the cleavable linker, or by chemical degradation.
In some embodiments, the cleavable linker, for example, comprises a protease cleavage site that is not cleavable by an endogenous protease (e.g., an endogenous protease from a T cell). In some instances, the endogenous protease is MMP9. In some instances, the cleavable site is a selective substrate for MMP2, MMP7, or a combination thereof. The cleavable linker, in certain instances, is cleaved only in a tumor microenvironment. Thus, the binding moiety, connected to the cleavable linker, and further bound to the target antigen binding domain, in some examples, maintains the target antigen binding domain in an inert state in circulation until the cleavable linker is cleaved off in a tumor microenvironment. In some embodiments, the binding moiety binds to the target antigen binding domain. In some embodiments, a non-CDR loop provides a binding site for binding of the moiety to the target antigen binding domain. In some embodiments, the binding moiety masks binding of the target binding domain to the target antigen, e.g., via steric occlusion, via specific intramolecular interactions, such as interactions within the different domains of the polypeptide comprising the binding moiety. In some embodiments, the binding moiety further comprises complimentary determining regions (CDRs). In some embodiments, the linker is not cleavable by activated T cells.
In some embodiments, the cleavable linker is not cleavable by an endogenous protease in-vitro. In some embodiments, the endogenous protease is MMP9. In some embodiments, the cleavable linker is cleavable by an endogenous protease in-vitro. In some embodiments, the endogenous protease is MMP7. In some embodiments, the cleavable linker is cleavable by MMP7 in vitro but not cleavable by MMP9 in vitro. In some embodiments, the linker is L077 e.g., (SEQ ID NO: 1095). In some embodiments, the linker is L276 e.g., (SEQ ID NO: 1119). In some embodiments, the linker may further comprise an amino acid sequence selected from G4S or G4T at the N terminal. In some embodiments, the linker may further comprise an amino acid sequence selected from G4S or G4T at the C terminal. In some embodiments, the linker may comprise an amino acid sequence selected from G4S or G4T at the N terminal and may further an amino acid sequence selected from G4S or G4T at the C terminal. In some embodiments, the linker may further comprise an G4S amino acid sequence at the N terminal. In some embodiments, the linker may further comprise an G4S amino acid sequence at the C terminal. In some embodiments, the linker may comprise an G4S amino acid sequence at the N terminal and may further an G4S amino acid sequence at the C terminal.
In some embodiments, the linker sequence lacks an arginine. In some embodiments, the arginine is substituted by glycine. In some embodiments, a ProTriTAC molecule comprising a linker lacking an arginine exhibit improved folding and stability of compared to a ProTriTAC molecule comprising a linker comprising an arginine. In some embodiments, a linker lacking an arginine improve expression of a ProTriTAC molecule compared to a ProTriTAC molecule comprising a linker comprising an arginine. In some embodiments, a linker lacking an arginine improve bioactivity of a ProTriTAC molecule compared to a ProTriTAC molecule comprising a linker comprising an arginine. In some embodiments, a ProTriTAC molecule comprising a linker lacking an arginine exhibit greater serum stability compared to a comparable ProTriTAC molecule comprising a linker comprising an arginine. In some embodiments, a ProTriTAC molecule comprising a linker lacking an arginine exhibit is more stable in a cell culture, e.g., CHO cell culture compared to a comparable ProTriTAC molecule comprising a linker comprising an arginine. In some embodiments, a ProTriTAC molecule comprising a linker lacking an arginine has improved manufacturing compared to a comparable ProTriTAC molecule comprising a linker comprising an arginine. In some embodiments, a ProTriTAC molecule comprising a linker lacking an arginine is more stable compared to a comparable ProTriTAC molecule comprising a linker comprising an arginine when the ProTriTAC molecules are expressed in a T cell. In some embodiments, the linker lacks a serine protease.
In some embodiments, a ProTriTAC molecule comprising a linker lacking an arginine exhibit superior therapeutic activity, compared to a comparable ProTriTAC molecule comprising a linker comprising an arginine. In some embodiments a ProTriTAC molecule comprising a linker lacking an arginine exhibit more stability compared to a comparable ProTriTAC molecule comprising a linker comprising an arginine. In some embodiments a ProTriTAC molecule comprising a linker lacking an arginine is less cleavable compared to a comparable ProTriTAC molecule comprising a linker comprising an arginine. In some embodiments a ProTriTAC molecule comprising a linker lacking an arginine exhibit higher titer (mg/ml) compared to a comparable ProTriTAC molecule comprising a linker comprising an arginine.
The conditionally active binding proteins contemplated herein, in some cases, comprise a protease cleavable linker recognized in a sequence-specific manner by a matrix metalloprotease (MMP), for example a MMP9. In some cases, the protease cleavable linker is recognized by a MMP9 comprises a polypeptide having an amino acid sequence PR(S/T)(L/I)(S/T). In some cases, the protease cleavable linker recognized by a MMP9 comprises a polypeptide having an amino acid sequence LEATA. In some cases, the protease cleavable linker is recognized in a sequence-specific manner by a MMP11. In some cases, the protease cleavable linker recognized by a MMP11 comprises a polypeptide having an amino acid sequence GGAANLVRGG (SEQ IN NO: 3). In some cases, the protease cleavable linker is recognized by a protease disclosed in Table 3. In some cases, the protease cleavable linker is recognized by a protease disclosed in Table 3 comprises a polypeptide having an amino acid sequence selected from a sequence disclosed in Table 3 (SEQ ID NOS: 1-42, 53, and 58-62). In some cases, the protease cleavable linker comprises a polypeptide having an amino acid sequence selected from a sequence disclosed in Table 16 (SEQ ID NOS: 11, 53, 58-60, 62, 909-996). In some cases, the cleavable linker has an amino acid sequence as set forth in SEQ ID No. 59. In some cases, the cleavable linker is recognized by MMP9, matriptase, Urokinase plasminogen activator (uPA) and has an amino acid sequence as set forth in SEQ ID No. 59.
The cleavability of linker sequences by different proteases can be determined using an in vitro assay that shows the percentage of linkers cleaved. In some cases, the percentage cleaved was calculated after incubating the molecules at 37° C. for 1 hr. If the percentage of linkers cleaved under this condition for a certain protease is above zero, then this protease cleavage site is recognized by the corresponding protease.
In some cases, the cleavable linker comprises a protease cleavage site that is recognized by at least one protease selected from the group consisting of: Neutrophil elastase, MMP-12, and MMP-13, and wherein the protease cleavage site is not recognized by furin. In some cases, the protease cleavage site is further recognized by at least one protease selected from the group consisting of: a matriptase and a Urokinase-type Plasminogen Activator (uPA). In some cases, the protease cleavage site is recognized by a matriptase but not by a uPA. In some cases, the protease cleavage site is not recognized by at least one protease selected from the group consisting of: a matriptase and a uPA. In some cases, the protease cleavage site is recognized by at least one protease selected from the group consisting of: MMP-2, MMP-7, MMP-8, and MMP-9. In some cases, the protease cleavage site is recognized by at least one protease selected from the group consisting of: MMP-1, MMP-2, MMP-8, and MMP-9. In some cases, the protease cleavage site is recognized by at least one protease selected from the group consisting of: MMP-2 and MMP-9. In some cases, the protease cleavage site is recognized by at least one protease selected from the group consisting of: MMP-2, MMP-7, and MMP-9. In some cases, the protease cleavage site is recognized by at least one protease selected from the group consisting of: MMP-2, MMP-8, and MMP-9. In some cases, the protease cleavage site is recognized by at least one protease selected from the group consisting of: MMP-2 and MMP-7.
In some cases, the cleavable linkers are less toxic than others. A panel toxicity experiment was performed using control linkers and EGFR-targeting ProTriTAC molecules, and the percentage of change in body weight in mice was monitored, less body weight loss in mice indicates less toxicity. As shown in
In some embodiments of this disclosure the binding moieties described herein comprise at least one non-cleavable linker. The non-cleavable linker comprises, in some examples, a sequence as set forth in SEQ ID No. 51, SEQ ID No. 302, SEQ ID No. 303, SEQ ID No. 304, or SEQ ID No. 305.
Proteases are proteins that cleave proteins, in some cases, in a sequence-specific manner. Proteases include but are not limited to serine proteases, cysteine proteases, aspartate proteases, threonine proteases, glutamic acid proteases, metalloproteases, asparagine peptide lyases, serum proteases, cathepsins, Cathepsin B, Cathepsin C, Cathepsin D, Cathepsin E, Cathepsin K, Cathepsin L, kallikreins, hK1, hK10, hK15, plasmin, collagenase, Type IV collagenase, stromelysin, Factor Xa, chymotrypsin-like protease, trypsin-like protease, elastase-like protease, subtilisin-like protease, actinidain, bromelain, calpain, caspases, caspase-3, Mir1-CP, papain, HIV-1 protease, HSV protease, CMV protease, chymosin, renin, pepsin, matriptase, legumain, plasmepsin, nepenthesin, metalloexopeptidases, metalloendopeptidases, matrix metalloproteases (MMP), MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP13, MMP11, MMP14, urokinase plasminogen activator (uPA), enterokinase, prostate-specific antigen (PSA, hK3), interleukin-1β converting enzyme, thrombin, FAP (FAP-α), dipeptidyl peptidase, type II transmembrane serine proteases (TTSP), neutrophil serine protease, cathepsin G, proteinase 3, neutrophil serine protease 4, mast cell chymase, and mast cell tryptases.
In some embodiments, the protease cleavage site is recognized by a serine protease, a cysteine protease, an aspartate protease, a threonine protease, a glutamic acid protease, a metalloproteinase, a gelatinase, or a asparagine peptide lyase, and the protease is not an endogenous protease (e.g., an endogenous protease from a T cell). In some instances, the endogenous protease is MMP9. In some instances, the cleavable site is a selective substrate for MMP2, MMP7, or a combination thereof. In some embodiments, the protease cleavage site is recognized by a Cathepsin B, a Cathepsin C, a Cathepsin D, a Cathepsin E, a Cathepsin K, a Cathepsin L, a kallikrein, a hK1, a hK10, a hK15, a plasmin, a collagenase, a Type IV collagenase, a stromelysin, a Factor Xa, a chymotrypsin-like protease, a trypsin-like protease, a elastase-like protease, a subtilisin-like protease, an actinidain, a bromelain, a calpain, a caspase, a caspase-3, a Mir1-CP, a papain, a HIV-1 protease, a HSV protease, a CMV protease, a chymosin, a renin, a pepsin, a matriptase, a legumain, a plasmepsin, a nepenthesin, a metalloexopeptidase, a metalloendopeptidase, a matrix metalloprotease (MMP), a MMP1, a MMP2, a MMP3, a MMP7, a MMP8, a MMP10, a MMP11, a MMP12, a MMP13, a MMP14, an ADAM10, an ADAM12, an urokinase plasminogen activator (uPA), an enterokinase, a prostate-specific target (PSA, hK3), an interleukin-1o converting enzyme, a thrombin, a FAP (FAP-α), a type II transmembrane serine protease (TTSP), a neutrophil elatase, a cathepsin G, a proteinase 3, a neutrophil serine protease 4, a mast cell chymase, a mast cell tryptase, a dipeptidyl peptidase, or a dipeptidyl peptidase IV (DPPIV/CD26). In some embodiments, the target antigen binding domains comprises an sdAb, a scFv, a Fab, a variable heavy chain domain (VHH), or a combination thereof.
Proteases are known to be secreted by some diseased cells and tissues, for example tumor or cancer cells, creating a microenvironment that is rich in proteases or a protease-rich microenvironment. In some case, the blood of a subject is rich in proteases. In some cases, cells surrounding the tumor secrete proteases into the tumor microenvironment. Cells surrounding the tumor secreting proteases include but are not limited to the tumor stromal cells, myofibroblasts, blood cells, mast cells, B cells, NK cells, regulatory T cells, macrophages, cytotoxic T lymphocytes, dendritic cells, mesenchymal stem cells, polymorphonuclear cells, and other cells. In some cases, proteases are present in the blood of a subject, for example proteases that target amino acid sequences found in microbial peptides. This feature allows for targeted therapeutics such as antigen binding proteins to have additional specificity because T cells will not be bound by the antigen binding protein except in the protease rich microenvironment of the targeted cells or tissue.
The binding moiety comprising the cleavable linker thus masks the binding of a first or a second target antigen binding domain to their respective targets. In some embodiments, the binding moiety is bound to a first target antigen binding domain, which is further bound to a second target antigen binding domain, in the following order: binding moiety (M): cleavable linker (L): first target antigen binding domain (T1): second antigen binding domain (T2). In other examples, the domains are organized in any one of the following orders: M:L:T2:T1; T2:T1:L:M, T1:T2:L:M. The binding moiety is further bound to a half-life extending protein, such as albumin or any other of its targets as described below. In some instances, the binding moiety is albumin or comprises a binding site for albumin. In some instances the binding moiety comprises a binding site for IgE. In some embodiments, the binding moiety comprises a binding site for Igκ free light chain.
The conditionally active binding proteins described herein are activated by cleavage of the at least one cleavable linker attached to the binding moieties within said conditionally active proteins. It is contemplated that in some cases the activated binding protein binds to a target antigen involved in and/or associated with a disease, disorder or condition. In particular, target antigens associated with a proliferative disease, a tumorous disease, an inflammatory disease, an immunological disorder, an autoimmune disease, an infectious disease, a viral disease, an allergic reaction, a parasitic reaction, a graft-versus-host disease or a host-versus-graft disease are contemplated to be the target for the activated binding proteins disclosed herein.
In some embodiments, the target antigen is a tumor antigen expressed on a tumor cell. Tumor antigens are well known in the art and include, for example, EpCAM, EGFR, HER-2, HER-3, c-Met, FoIR, PSMA, CD38, BCMA, and CEA. 5T4, AFP, B7-H3, CDH-6, CAIX, CD117, CD123, CD138, CD166, CD19, CD20, CD205, CD22, CD30, CD33, CD352, CD37, CD44, CD52, CD56, CD70, CD71, CD74, CD79b, DLL3, EphA2, FAP, FGFR2, FGFR3, GPC3, gpA33, FLT-3, gpNMB, HPV-16 E6, HPV-16 E7, ITGA2, ITGA3, SLC39A6, MAGE, mesothelin, Muc1, Muc16, NaPi2b, Nectin-4, CDH-3, CDH-17, EPHB2, ITGAV, ITGB6, NY-ESO-1, PRLR, PSCA, PTK7, ROR1, SLC44A4, SLITRK5, SLITRK6, STEAP1, TIM1, Trop2, or WT1.
In some embodiments, the target antigen is an immune checkpoint protein. Examples of immune checkpoint proteins include but are not limited to CD27, CD137, 2B4, TIGIT, CD155, ICOS, HVEM, CD40L, LIGHT, OX40, DNAM-1, PD-L1, PD1, PD-L2, CTLA-4, CD8, CD40, CEACAM1, CD48, CD70, A2AR, CD39, CD73, B7-H3, B7-H4, BTLA, IDO1, IDO2, TDO, KIR, LAG-3, TIM-3, or VISTA.
In some embodiments, a target antigen is a cell surface molecule such as a protein, lipid or polysaccharide. In some embodiments, a target antigen is a on a tumor cell, virally infected cell, bacterially infected cell, damaged red blood cell, arterial plaque cell, inflamed or fibrotic tissue cell.
In some embodiments, the target antigen comprises an immune response modulator that is not a cytokine. Examples of immune response modulator include but are not limited to B7-1 (CD80), B7-2 (CD86), CD3, or GITR.
In some embodiments, the first target antigen binding domain or the second target antigen binding domain comprises an anti-EGFR domain, an anti-EpCAM domain, an anti-DLL3 domain, an anti-MSLN domain, an anti-PSMA domain, an anti-BDMA domain, or any combinations thereof. In some embodiments, the first target antigen binding domain or the second target antigen binding domain comprises an anti-EGFR sdAb, an anti-EpCAM sdAb, an anti-DLL3 sdAb, an anti-MSLN sdAb, an anti-PSMA sdAb, an anti-BDMA sdAb, or any combinations thereof.
In some embodiments, an anti-EGFR domain of this disclosure comprises an amino acid selected from the group consisting of SEQ ID Nos. 55, and 737-785. In some embodiments, an anti-PSMA domain of this disclosure comprises an amino acid selected from the group consisting of SEQ ID Nos. 57-73. In some embodiments, an anti-BCMA domain of this disclosure comprises an amino acid selected from the group consisting of SEQ ID Nos. 91-214.
In some embodiments, an anti-MSLN domain of this disclosure comprises an amino acid selected from the group consisting of SEQ ID Nos. 215-258. In some embodiments, an anti-DLL3 domain of this disclosure comprises an amino acid selected from the group consisting of SEQ ID Nos. 306-736. In some embodiments, an anti-EpCAM domain of this disclosure comprises an amino acid selected from the group consisting of SEQ ID Nos. 804-841.
In some embodiments, the first target antigen binding domain or the second target antigen binding domain comprises an anti-CD3 domain. In some embodiments, the anti-CD3 domain comprises an anti-CD3 scFV. In some embodiments, the anti-CD3 scFv comprises an amino acid sequence selected from the group consisting of: SEQ ID Nos. 74-90, and 794.
As used herein, the term “binding protein variants” refers to variants and derivatives of the conditionally active target-binding proteins described herein, containing a binding moiety as described above, comprising non-CDR loops that bind to an immunoglobulin binding molecule, such as a first or a second target antigen binding domain, a non-immunoglobulin binding molecule. In certain embodiments, amino acid sequence variants of the conditionally active target-binding proteins described herein are contemplated. For example, in certain embodiments amino acid sequence variants of the conditionally active target-binding proteins described herein are contemplated to improve the binding affinity and/or other biological properties of the binding proteins. Exemplary method for preparing amino acid variants include, but are not limited to, introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody.
Any combination of deletion, insertion, and substitution can be made to the various domains to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., antigen-binding. In certain embodiments, binding protein variants having one or more amino acid substitutions are provided. Sites of interest for substitution mutagenesis include the CDRs and framework regions. Amino acid substitutions may be introduced into the variable domains of a conditionally active protein of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved antibody-dependent cell mediated cytotoxicity (ADCC) or complement dependent cytotoxicity (CDC). Both conservative and non-conservative amino acid substitutions are contemplated for preparing the antibody variants.
In another example of a substitution to create a variant conditionally active antibody, one or more hypervariable region residues of a parent antibody are substituted. In general, variants are then selected based on improvements in desired properties compared to a parent antibody, for example, increased affinity, reduced affinity, reduced immunogenicity, increased pH dependence of binding. For example, an affinity matured variant antibody can be generated, e.g., using phage display-based affinity maturation techniques such as those described herein and known in the field.
In another example, substitutions are made in hypervariable regions (HVR) of a parent conditionally active antibody to generate variants and variants are then selected based on binding affinity, i.e., by affinity maturation. In some embodiments of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity. Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. Substitutions can be in one, two, three, four, or more sites within a parent antibody sequence.
In some embodiments, a conditionally active binding protein, as described herein comprises a VL domain, or a VH domain, or both, with amino acid sequences corresponding to the amino acid sequence of a naturally occurring VL or VH domain, respectively, but that has been “humanized”, i.e., by replacing one or more amino acid residues in the amino acid sequence of said naturally occurring VL or VH domains (and in particular in the framework sequences) by one or more of the amino acid residues that occur at the corresponding position(s) in a VL or VH domain from a conventional 4-chain antibody from ahuman being (e.g., as indicated above). This can be performed in a manner known in the field, which will be clear to the skilled person, for example on the basis of the further description herein. Again, it should be noted that such humanized conditionally active target-binding antibodies of the disclosure are obtained in any suitable manner known per se and thus are not strictly limited to polypeptides that have been obtained using a polypeptide that comprises a naturally occurring VL and/or VH domain as a starting material. In some additional embodiments, an conditionally active target-binding antibody, as described herein, comprises a VL and a VH domain with amino acid sequences corresponding to the amino acid sequence of a naturally occurring VL or VH domain, respectively, but that has been “camelized”, i.e., by replacing one or more amino acid residues in the amino acid sequence of a naturally occurring VL or VH domain from a conventional 4-chain antibody by one or more of the amino acid residues that occur at the corresponding position(s) in a VL or a VH domain of a heavy chain antibody. Such “camelizing” substitutions are preferably inserted at amino acid positions that form and/or are present at the VH-VL interface, and/or at the so-called Camelidae hallmark residues (see for example WO 94/04678 and Davies and Riechmann (1994 and 1996)). Preferably, the VH sequence that is used as a starting material or starting point for generating or designing the camelized single domain is preferably a VH sequence from a mammal, more preferably the VH sequence of a human being, such as a VH3 sequence. However, it should be noted that such camelized conditionally active antibodies of the disclosure, in certain embodiments, are obtained in any suitable manner known in the field and thus are not strictly limited to polypeptides that have been obtained using a polypeptide that comprises a naturally occurring VL and/or VH domain as a starting material. For example, both “humanization” and “camelization” is performed by providing a nucleotide sequence that encodes a naturally occurring VL and/or VH domain, respectively, and then changing, one or more codons in said nucleotide sequence in such a way that the new nucleotide sequence encodes a “humanized” or “camelized” conditionally active antibody, respectively. This nucleic acid can then be expressed, so as to provide the desired target-antigen binding capability. Alternatively, in other embodiments, a “humanized” or “camelized” conditionally active antibody is synthesized de novo using known peptide synthesis technique from the amino acid sequence of a naturally occurring antibody comprising a VL and/or VH domain. In some embodiments, a “humanized” or “camelized” conditionally active antibody is synthesized de novo using known peptide synthesis technique from the amino acid sequence or nucleotide sequence of a naturally occurring antibody comprising a VL and/or VH domain, respectively, a nucleotide sequence encoding the desired humanized or camelized conditionally active domain antibody of the disclosure, respectively, is designed and then synthesized de novo using known techniques for nucleic acid synthesis, after which the nucleic acid thus obtained is expressed in using known expression techniques, so as to provide the desired conditionally active antibody of the disclosure.
Other suitable methods and techniques for obtaining the conditionally active binding protein of the disclosure and/or nucleic acids encoding the same, starting from naturally occurring sequences for VL or VH domains for example comprises combining one or more parts of one or more naturally occurring VL or VH sequences (such as one or more framework (FR) sequences and/or complementarity determining region (CDR) sequences), and/or one or more synthetic or semi-synthetic sequences, and/or a naturally occurring sequence for a CH2 domain, and a naturally occurring sequence for a CH3 domain comprising amino acid substitutions that favor formation of heterodimer over homodimer, in a suitable manner, so as to provide a conditionally active binding protein of the disclosure or a nucleotide sequence or nucleic acid encoding the same.
In some embodiments, the disclosure provides a conditionally active chimeric antigen receptor that comprises a single polypeptide chain, comprising a binding moiety comprising a non-CDR loop and a cleavable linker, a target antigen binding domain; a transmembrane domain; and an intracellular signaling domain. In some embodiments, the cleavable linker is not cleavable by an endogenous protease. In some embodiments, the binding moiety is capable of masking the binding of the target antigen binding domain to its target.
In designing conditionally active binding proteins for therapeutic applications, it is desirable to create proteins that, for example, modulate a functional activity of a target, and/or improved binding proteins such as binding proteins with higher specificity and/or affinity and/or and binding proteins that are more bioavailable, or stable or soluble in particular cellular or tissue environments.
The conditionally active binding proteins described in the present disclosure exhibit improved the binding affinities towards the target, for example a tumor antigen expressed on a cell surface. In some embodiments, the conditionally active binding protein of the present disclosure is affinity matured to increase its binding affinity to the target, using any known technique for affinity-maturation (e.g., mutagenesis, chain shuffling, CDR amino acid substitution). Amino acid substitutions may be conservative or semi-conservative. For example, the amino acids glycine, alanine, valine, leucine and isoleucine can often be substituted for one another (amino acids having aliphatic side chains). Of these possible substitutions, typically glycine and alanine are used to substitute for one another since they have relatively short side chains and valine, leucine and isoleucine are used to substitute for one another since they have larger aliphatic side chains which are hydrophobic. Other amino acids which may often be substituted for one another include but are not limited to: phenylalanine, tyrosine and tryptophan (amino acids having aromatic side chains); lysine, arginine and histidine (amino acids having basic side chains); aspartate and glutamate (amino acids having acidic side chains); asparagine and glutamine (amino acids having amide side chains); and cysteine and methionine (amino acids having sulphur-containing side chains). In some embodiments, the conditionally active target-binding proteins are isolated by screening combinatorial libraries, for example, by generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics towards a target antigen, such as a tumor antigen expressed on a cell surface.
The conditionally active binding proteins described herein encompass derivatives or analogs in which (i) an amino acid is substituted with an amino acid residue that is not one encoded by the genetic code, (ii) the mature polypeptide is fused with another compound such as polyethylene glycol, or (iii) additional amino acids are fused to the protein, such as a leader or secretory sequence or a sequence to block an immunogenic domain and/or for purification of the protein.
Typical modifications include, but are not limited to, acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphatidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent crosslinks, formation of cystine, formation of pyroglutamate, formylation, gamma carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination.
Modifications are made anywhere in the conditionally active binding proteins described herein, including the peptide backbone, the amino acid side-chains, and the amino or carboxyl termini. Certain common peptide modifications that are useful for modification of the conditionally active binding proteins include glycosylation, lipid attachment, sulfation, gamma-carboxylation of glutamic acid residues, hydroxylation, blockage of the amino or carboxyl group in a polypeptide, or both, by a covalent modification, and ADP-ribosylation.
In some embodiments, the conditionally active binding proteins of the disclosure are conjugated with drugs to form antibody-drug conjugates (ADCs). In general, ADCs are used in oncology applications, where the use of antibody-drug conjugates for the local delivery of cytotoxic or cytostatic agents allows for the targeted delivery of the drug moiety to tumors, which can allow higher efficacy, lower toxicity, etc.
Also provided, in some embodiments, are polynucleotide molecules encoding the binding moieties as described herein. In some embodiments, the polynucleotide molecules are provided as a DNA construct. In other embodiments, the polynucleotide molecules are provided as a messenger RNA transcript.
Also provided, in some embodiments, are polynucleotide molecules encoding the conditionally active binding proteins as described herein. In some embodiments, the polynucleotide molecules are provided as a DNA construct. In other embodiments, the polynucleotide molecules are provided as a messenger RNA transcript.
The polynucleotide molecules are constructed by known methods such as by combining the genes encoding the various domains (e.g. binding moiety, target antigen binding domain, etc.) either separated by peptide linkers or, in other embodiments, directly linked by a peptide bond, into a single genetic construct operably linked to a suitable promoter, and optionally a suitable transcription terminator, and expressing it in bacteria or other appropriate expression system such as, for example CHO cells. Depending on the vector system and host utilized, any number of suitable transcription and translation elements, including constitutive and conditionally active promoters, may be used. The promoter is selected such that it drives the expression of the polynucleotide in the respective host cell.
In some embodiments, the polynucleotides described herein are inserted into vectors, such as expression vectors, which represent further embodiments. This recombinant vector can be constructed according to known methods. Vectors of particular interest include plasmids, phagemids, phage derivatives, virii (e.g., retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, lentiviruses, and the like), and cosmids.
A variety of expression vector/host systems may be utilized to contain and express the polynucleotide encoding the polypeptide of the described conditionally active binding protein. Examples of expression vectors for expression in E. coli are pSKK (Le Gall et al., J Immunol Methods. (2004) 285(1):111-27) or pcDNA5 (Invitrogen) for expression in mammalian cells.
Thus, the binding moieties or the conditionally active binding proteins comprising the binding moieties as described herein, in some embodiments, are produced by introducing vectors encoding the binding moieties or the binding proteins as described above into host cells and culturing said host cells under conditions whereby the binding moieties or the binding proteins, or domains thereof are expressed.
Also provided, in some embodiments, are pharmaceutical compositions comprising a therapeutically effective amount of a conditionally active binding protein of the present disclosure, and at least one pharmaceutically acceptable carrier. The term “pharmaceutically acceptable carrier” includes, but is not limited to, any carrier that does not interfere with the effectiveness of the biological activity of the ingredients and that is not toxic to the patient to whom it is administered. Examples of suitable pharmaceutical carriers are well known in the art and include phosphate buffered saline solutions, water, emulsions, such as oil/water emulsions, various types of wetting agents, sterile solutions etc. Such carriers can be formulated by conventional methods and can be administered to the subject at a suitable dose. Preferably, the compositions are sterile. These compositions may also contain adjuvants such as preservative, emulsifying agents and dispersing agents. Prevention of the action of microorganisms is, in some cases, ensured by the inclusion of various antibacterial and antifungal agents.
The conditionally active binding proteins described herein are contemplated for use as medicaments. Administration is effected by different ways, e.g., by intravenous, intraperitoneal, subcutaneous, intramuscular, topical or intradermal administration. In some embodiments, the route of administration depends on the kind of therapy and the kind of compound contained in the pharmaceutical composition. The dosage regimen will be determined by the attending physician and other clinical factors. Dosages for any one patient depends on many factors, including the patient's size, body surface area, age, sex, the particular compound to be administered, time and route of administration, the kind of therapy, general health and other drugs being administered concurrently. An “effective dose” refers to amounts of the active ingredient that are sufficient to affect the course and the severity of the disease, leading to the reduction or remission of such pathology and may be determined using known methods.
Also provided herein, in some embodiments, are methods and uses for stimulating the immune system of an individual in need thereof comprising administration of a conditionally active binding protein as described herein. In some instances, administration induces and/or sustains cytotoxicity towards a cell expressing a target antigen. In some instances, the cell expressing a target antigen is a cancer or tumor cell, a virally infected cell, a bacterially infected cell, an autoreactive T or B cell, damaged red blood cells, arterial plaques, or fibrotic tissue. In some embodiments, the target antigen is an immune checkpoint protein.
Also provided herein are methods and uses for a treatment of a disease, disorder or condition associated with a target antigen comprising administering to an individual in need thereof a conditionally active binding protein as described herein. Diseases, disorders or conditions associated with a target antigen include, but are not limited to, viral infection, bacterial infection, auto-immune disease, transplant rejection, atherosclerosis, or fibrosis. In other embodiments, the disease, disorder or condition associated with a target antigen is a proliferative disease, a tumorous disease, an inflammatory disease, an immunological disorder, an autoimmune disease, an infectious disease, a viral disease, an allergic reaction, a parasitic reaction, a graft-versus-host disease or a host-versus-graft disease. In some embodiment, the disease, disorder or condition associated with a target antigen is cancer. In some embodiments, the cancer is an EGFR over-expressing cancer. In some embodiments, the cancer is an CTLA4 over-expressing cancer. In some embodiments, the cancer is a cancer exhibiting low expression of a matrix metalloprotease, e.g., MMP. In one instance, the cancer is a hematological cancer. In another instance, the cancer is a melanoma. In a further instance, the cancer is non-small cell lung cancer. In yet further instance, the cancer is breast cancer. In yet further instance, the cancer is an ovarian cancer, e.g., epithelial ovarian cancer.
As used herein, in some embodiments, “treatment” or “treating” or “treated” refers to therapeutic treatment wherein the object is to slow (lessen) an undesired physiological condition, disorder or disease, or to obtain beneficial or desired clinical results. For the purposes described herein, beneficial or desired clinical results include, but are not limited to, alleviation of symptoms; diminishment of the extent of the condition, disorder or disease; stabilization (i.e., not worsening) of the state of the condition, disorder or disease; delay in onset or slowing of the progression of the condition, disorder or disease; amelioration of the condition, disorder or disease state; and remission (whether partial or total), whether detectable or undetectable, or enhancement or improvement of the condition, disorder or disease. Treatment includes eliciting a clinically significant response without excessive levels of side effects. Treatment also includes prolonging survival as compared to expected survival if not receiving treatment. In other embodiments, “treatment” or “treating” or “treated” refers to prophylactic measures, wherein the object is to delay onset of or reduce severity of an undesired physiological condition, disorder or disease, such as, for example is a person who is predisposed to a disease (e.g., an individual who carries a genetic marker for a disease such as breast cancer).
In some embodiments of the methods described herein, the conditionally active binding proteins described herein are administered in combination with an agent for treatment of the particular disease, disorder or condition. Agents include but are not limited to, therapies involving antibodies, small molecules (e.g., chemotherapeutics), hormones (steroidal, peptide, and the like), radiotherapies (γ-rays, X-rays, and/or the directed delivery of radioisotopes, microwaves, UV radiation and the like), gene therapies (e.g., antisense, retroviral therapy and the like) and other immunotherapies. In some embodiments, the conditionally active binding proteins described herein are administered in combination with anti-diarrheal agents, anti-emetic agents, analgesics, opioids and/or non-steroidal anti-inflammatory agents. In some embodiments, the conditionally active binding proteins described herein is administered before, during, or after surgery.
In some embodiments, the disclosure provides a kit comprising a ProTriTAC molecule described herein. In some embodiments, the kit is used to treat a disease described herein.
The examples below further illustrate the described embodiments without limiting the scope of the disclosure.
The sequence of an engineered protein scaffold comprising CDR loops capable of binding albumin and non-CDR loops is obtained. Overlapping PCR is used to introduce random mutations in the non-CDR loop regions, thereby generating a library. The resultant sequences are cloned into a phage display vector, thereby generating a phage display library. Escherichia coli cells are transformed with the library and used to construct a phage display library. ELISA is performed using an immobilized target antigen binding domain with specificity for EGFR. A clone with high specificity for EGFR is selected. Affinity maturation is performed by re-randomizing residues in the non-CDR loop regions as before.
Sequence alignment of non-CDR loop regions of the resultant proteins is performed to determine sequence conservation between proteins with high affinity for the EGFR binding target antigen binding domain. Site directed mutagenesis of one or more amino acids within these regions of sequence conservation is performed to generate additional proteins. Binding of the resultant proteins to an immobilized target antigen binding domain whose target is EGFR is measured in an ELISA. A protein with the highest affinity for the target antigen binding domain is selected.
The sequence of this binding moiety is cloned into a vector comprising a sequence for a cleavable linker, and sequences for a second target antigen binding domain that binds to a second target antigen, e.g., CD3. The resultant vector is expressed in a heterologous expression system to obtain a conditionally active target binding protein that comprises a binding moiety comprising a cleavable linker and non-CDR loops which provide a binding site specific for the target antigen binding domain whose target is EGFR, and CDR loops which are specific for albumin.
The sequence of an engineered protein scaffold comprising CDR loops capable of binding albumin and non-CDR loops is obtained. Overlapping PCR is used to introduce random mutations in the non-CDR loop regions, thereby generating a library. The resultant sequences are cloned into a phage display vector, thereby generating a phage display library. Escherichia coli cells are transformed with the library and used to construct a phage display library. ELISA is performed using an immobilized target antigen binding domain with specificity for CD3. A clone with high specificity for CD3 is selected. Affinity maturation is performed by re-randomizing residues in the non-CDR loop regions as before.
Sequence alignment of non-CDR loop regions of the resultant proteins is performed to determine sequence conservation between proteins with high affinity for the EGFR binding target antigen binding domain. Site directed mutagenesis of one or more amino acids within these regions of sequence conservation is performed to generate additional proteins. Binding of the resultant proteins to an immobilized target antigen binding domain whose target is CD3 is measured in an ELISA. A protein with the highest affinity for the target antigen binding domain is selected.
The sequence of this binding moiety is cloned into a vector comprising a sequence for a cleavable linker, and sequences for a second target antigen binding domain that binds to a second target antigen, e.g., EGFR. The resultant vector is expressed in a heterologous expression system to obtain a conditionally active target binding protein that comprises a binding moiety comprising a cleavable linker and non-CDR loops which provide a binding site specific for the target antigen binding domain whose target is CD3, and CDR loops which are specific for albumin.
Cells overexpressing EGFR and exhibiting low expression of a matrix metalloprotease are separately incubated with an exemplary conditionally active binding protein according to the present disclosure and a non-conditionally active control binding protein. Cells expressing normal levels of EGFR and proteases are also incubated with a conditionally active binding protein according to the present disclosure and a non-conditionally active control binding protein. Both proteins comprise a target antigen binding domain with specificity toward PSMA.
Results indicate that in the absence of protease secretion, the conditionally active binding protein of the present disclosure interacts with the protease expressing cells but does not interact with the EGFR expressed on the surface of the protease deficient cells. In contrast, the non-conditionally active control binding protein lacks the ability to selectively bind the protease expressing cells over the protease deficient ones. Thus, the exemplary conditionally active binding protein receptor of the present disclosure is advantageous, for example, in terms of reducing off-tumor toxicity.
Murine tumor line CT26 is implanted subcutaneously in Balb/c mice and on day 7 post-implantation the average size of the tumor is measured. Test mice are treated with an exemplary conditionally active binding protein which has a target antigen binding domain specific for CTLA4 and another target antigen binding domain specific for CD3, wherein either the CTLA4 or the CD3 specific domain is bound to a binding moiety via its non-CDR loops, the binding moiety comprises a cleavable linker, and is bound to albumin. Control mice are treated with binding protein that contains CD3/CTLA4 specific domains but do not contain the binding moiety or the cleavable linker, and are not conditionally active. Results show that treatment with the exemplary conditionally active binding protein of the present disclosure inhibits tumor more efficiently than the comparator binding protein which does not contain the moiety with non-CDR loops.
Cells overexpressing CTLA-4 and exhibiting low expression of a matrix metalloprotease are separately incubated with an exemplary CTLA4 specific conditionally active binding protein of this disclosure, containing a binding moiety that binds to a CTLA4 binding domain via its non-CDR loops and albumin via its CDRs; or a control CTLA-4 binding antibody which does not contain the binding moiety which binds to a CTLA4 binding domain via its non-CDR loops and to albumin via its CDRs. Cells expressing normal levels of antigens and proteases are also incubated with the exemplary CTLA4 specific conditionally active binding protein, or the control CTLA4 binding antibody.
Results indicate that in the absence of protease secretion, the conditionally active binding protein of the present disclosure binds the protease expressing cells but does not bind the protease-deficient antigen expressing cells. In contrast, the control antibody lacks the ability to selectively bind the protease expressing cells over the protease deficient ones. Thus, the exemplary conditionally active binding protein of the present disclosure is advantageous, for example, in terms of reducing off-tumor toxicity.
Sequences of exemplary ProTriTAC (also referred to as Pro-trispecific) molecules were cloned into mammalian expression vector pcDNA 3.4 (Invitrogen) preceded by a leader sequence and followed by a 6× Histidine Tag. Expi293F cells (Life Technologies A14527) were maintained in suspension in Optimum Growth Flasks (Thomson) between 0.2 to 8×1e6 cells/ml in Expi 293 media. Purified plasmid DNA was transfected into Expi293 cells in accordance with Expi293 Expression System Kit (Life Technologies, A14635) protocols, and maintained for 4-6 days post transfection. Alternatively, sequences of trispecific molecules were cloned into mammalian expression vector pDEF38 (CMC ICOS) transfected into CHO-DG44 dhfr- cells, stable pools generated, and cultured in production media for up to 12 days prior to purification. The amount of the exemplary trispecific proteins in conditioned media was quantitated using an Octet RED 96 instrument with Protein A tips (ForteBio/Pall) using a control trispecific protein for a standard curve. Conditioned media from either host cell was filtered and partially purified by affinity and desalting chromatography. Trispecific proteins were subsequently polished by ion exchange and upon fraction pooling formulated in a neutral buffer containing excipients. Final purity was assessed by SDS-PAGE and analytical SEC using an Acquity BEH SEC 200 1.7u 4.6×150 mm column (Waters Corporation) resolved in an aqueous/organic mobile phase with excipients at neutral pH on a 1290 LC system and peaks integrated with Chemstation CDS software (Agilent). Trispecific proteins purified from CHO host cells were analyzed by running an SDS-PAGE, as shown in
Purified Protrispecific proteins in two formulations were sub-aliquoted into sterile tubes and stressed by five freeze-thaw cycles each comprising greater than 1 hour at −80° C. and room temperature or by incubation at 37° C. for 1 week. Stressed samples were evaluated for concentration and turbidity by UV spectrometry using UV transparent 96 well plates (Corning 3635) with a SpectraMax M2 and SoftMaxPro Software (Molecular Devices), SDS-PAGE, and analytical SEC and compared to the same analysis of control non-stressed samples. An overlay of chromatograms from analytical SEC of control and stressed samples for a single exemplary trispecific ProTriTAC molecule purified from 293 host cells is depicted in
An exemplary ProTriTAC molecule (SEQ ID NO: 46) containing an EGFR binding domain as the target binding domain, a CD3 binding domain and an albumin binding domain comprising a masking moiety (SEQ ID NO: 50) and a cleavable linker (SEQ ID NO: 53) was evaluated for anti-tumor activity in vivo in an HCT116 subcutaneous xenograft tumor admixed with expanded human T cells in immunocompromised NCG mice. A non-cleavable EGFR targeting ProTriTAC molecule (SEQ ID NO: 47) and a GFP targeting ProTriTAC molecule (SEQ ID NO: 49) were also used in the study. Specifically, 5×106 HCT116 cells were admixed with 2.5×106 expanded T cells per mouse on day 0. Dosing of the test molecules (EGFR targeting ProTriTAC, non-cleavable EGFR targeting Pro-TriTAC, and GFP targeting ProTriTAC) were performed starting on the following day with a q.d.×10 (single daily dose for 10 days) schedule via intraperitoneal injection, at a dose of 0.03 mg/kg. Tumor volumes were determined using caliper measurements and calculated using the formula V=(length×width×width)/2, at the indicated times. Results shown in
Single doses of PSMA targeting ProTriTAC (SEQ ID NO: 43) containing a PSMA binding domain as the target binding domain, a CD3 binding domain, and an albumin binding domain comprising a masking moiety (SEQ ID NO: 50) and a cleavable linker (SEQ ID NO: 53), non-cleavable PSMA targeting ProTriTAC (SEQ ID NO: 44), non-masked/non-cleavable TriTAC (SEQ ID NO: 52), and active drug mimicking protease-activated PSMA targeting ProTriTAC (SEQ ID NO: 45) were dosed into cynomolgus monkeys at 0.1 mg/kg via intravenous injection. Plasma samples were collected at the time points indicated in
To calculate the rate of in vivo conversion of the test molecules (i.e., conversion of PSMA targeting ProTriTAC, non-cleavable PSMA targeting ProTriTAC, non-masked/non-cleavable PSMA targeting ProTriTAC) the concentration of active drug in circulation was estimated by solving the following system of differential equations where P is the concentration of prodrug, A is the concentration of active drug, ka is the rate of prodrug activation in circulation, kc,P is the clearance rate of the prodrug, and kc,A is the clearance rate of the active drug.
The clearance rates of the prodrug, active drug, non-masked non-cleavable prodrug control, and a non-cleavable prodrug control (kc,NCLV) were determined empirically in cynomolgus monkeys. To estimate the rate of prodrug activation in circulation, it was assumed that the difference between the clearance rate of cleavable prodrug and the non-cleavable prodrug arose solely from non-specific activation in circulation. Therefore, the rate of prodrug conversion to active drug in circulation was estimated by subtracting the clearance rate of the cleavable prodrug from the non-cleavable prodrug.
The initial concentration of prodrug in circulation was determined empirically and the initial concentration of active drug was assumed to be zero. Further calculations showed that the ProTriTAC comprising the protease cleavable linker was sufficiently stable in circulation, with 50% non-tumor mediated conversion every 194 hours and the t1/2 of the molecule was determined, empirically, to be around 211 hours. This indicated that ProTriTAC molecules are sufficiently stable and protected against off-tumor effects. In contrast, the t1/2 of the active drug fragment mimicking the activated ProTRITAC molecule was determined, empirically, to be 0.97 hours. Thus, active drug was rapidly cleared from circulation. Results are shown in
The aim of this study was to assess the relative potency of protease activatable ProTriTAC molecules, non-cleavable ProTriTAC molecules and recombinant active drug fragment mimicking the protease-activated ProTriTAC molecule, in CD3 binding and T cell mediated cell killing. The active drug fragment mimicking the protease activated ProTriTAC molecule contained the CD3 binding domain and the target antigen binding domain but lacked the albumin binding domain. Whereas the protease activatable ProTriTAC molecule contained the albumin binding domain comprising a masking domain and a protease cleavable site, the CD3 binding domain, and the target antigen binding domain. The non-cleavable ProTriTAC molecule lacked the protease cleavable site but was otherwise identical to the protease activatable ProTriTAC molecule.
Purified ProTriTAC (labeled as prodrug in
For ELISA, soluble test molecules (i.e., active drug, prodrug, and prodrug (non-cleavable) at the indicated concentrations were incubated, in multi-well plates, with immobilized recombinant human CD3ε (R&D Systems) for 1 hour at room temperature in PBS supplemented with 15 mg/mL human serum albumin. Plates were blocked using SuperBlock (Thermo Fisher), washed using PBS with 0.05% Tween-20, and detected using a non-competitive anti-CD3 idiotype monoclonal antibody 11D3 followed by peroxidase-labeled secondary antibody and TMB-ELISA substrate solution (Thermo Fisher). Results shown in
For binding to human primary T cells, determined by flow cytometry, soluble test molecules (i.e., active drug, prodrug, and prodrug (non-cleavable)) at the indicated concentrations (shown in
For functional potency in a T cell-dependent cellular cytotoxicity assays, soluble test molecules (i.e., active drug, prodrug, and prodrug (non-cleavable)) at the indicated concentrations, shown in
The aim of this study was to explore the anti-tumor activity of ProTriTAC molecules containing different linkers. NSG female mice, 7 weeks old, were used for this study. At the commencement of the study, on day 0, the NSG female mice were injected with 2.5×106 expanded human T cells, and 5×106 HCT116 (human colorectal carcinoma) tumor cells. The following day, on day 1, the mice were divided into groups and each group was treated with at least one of the ProTriTAC molecules listed in Table 9 (SEQ ID Nos. 786-790), or with a control GFP TriTAC molecule (SEQ ID No. 792), or with a ProTriTAC molecule that contains a non cleavable linker (NCLV) (SEQ ID No. 791).
The ProTriTAC molecules and the ProTriTAC NCLV molecule used in the following examples were targeted to EGFR and had the following orientation of the individual domains: (anti-albumin binding domain (sdAb): anti-CD3 domain (scFV): anti-EGFR domain (sdAb)). The only differences between the ProTriTAC molecules listed in Table 6 were in the linker sequences. The ProTriTAC molecules, ProTriTAC NCLV molecule, or the GFP TriTAC molecule (the GFP TriTAC molecule had the following orientation of individual domains: anti-GFP sdAb: anti-Alb sdAb: anti-CD3 scFv) were administered daily for a period of 10 days (i.e., final dose was administered on day 10 following injection of tumor cells and expanded cells to the animals) and tumor volumes were measured at regular intervals, beginning a few days prior to the administration of the final dose at day 10.
As shown in
The pharmacokinetics following administration of the various molecules, as described above, were also assessed and the data is shown in
The ProTriTAC molecules listed in Table 9, the control GFP TriTAC molecule, and the ProTriTAC NCLV molecule were evaluated in an admixed xenograft model, in order to determine the efficacy of the ProTriTAC molecules containing different linkers, in vivo. As described in previous example (Example 7), the xenograft tumor model was generated by injecting 7-week-old NSG mice with 2.5×106 expanded human T cells, and 5×106 HCT116 (human colorectal carcinoma) tumor cells. The mice were divided into groups and each group was treated with at least one of the ProTriTAC molecules listed in Table 9, with the control GFP TriTAC molecule, or with the ProTriTAC NCLV molecule. Tumor volumes were measured at regular intervals, starting from day 10 post injection of tumor cells and expanded T cells.
It was observed that in animals treated with the exemplary ProTriTAC molecules containing linker L040 there was a statistically significant delay in tumor growth as compared to the mice group which was treated with the control GFP TriTAC molecule, or the mice group that was treated with the ProTriTAC NCLV molecule. Similar observation was also made for the ProTriTAC molecules containing linker sequences L001, L041, and L045. The data is shown in
It is also possible to carry out a similar study with xenograft models using other cell lines, such as A549 (non-small cell lung carcinoma) cells, DU-145 (prostate) cells, MCF-7 (breast) cells, Colo 205 (colon) cells, 3T3/]GF-IR (mouse fibroblast) cells, NCI H441 cells, HEP G2 (hepatoma) cells, MDA MB 231 (breast) cells, HT-29 (colon) cells, MDA-MB-435s (breast) cells, U266 cells, SH-SYSY cells, Sk-Mel-2 cells, NCI-H929, RPM18226, and A431 cells.
In this study, cynomolgus monkeys were treated with three different concentrations (30 μg/kg; 300 μg/kg; and 1000 μg/kg) of an exemplary EGFR targeting ProTriTAC molecule containing a non-cleavable linker (ProTriTAC (NCLV), or with three different concentrations (10 μg/kg; 30 μg/kg; and 100 μg/kg) of an exemplary EGFR targeting TriTAC molecule (SEQ ID No. 793).
As shown in
In this study, the tolerability of an exemplary EGFR targeting ProTriTAC molecule was assessed. Seven weeks old NSG female tumor free mice were intraperitoneally injected with 2×107 expanded human T cells at the commencement of the study, i.e., at day 0. On day 2, treatment was started by dividing the mice into various groups and administering to them varying concentrations of the exemplary EGFR targeting ProTriTAC molecule, containing the linker sequence L001, an EGFR targeting TriTAC molecule, and an EGFR targeting ProTriTAC molecule containing a non-cleavable linker (ProTriTAC (NCLV). The molecules were administered once daily for 10 days, at the following dosages: 30 μg/kg, 100 μg/kg, 300 μg/kg. Starting from day 2, body weight of the animals was recorded daily.
As shown in
To further explore the role of the linker in tolerability of the EGFR targeting ProTriTAC molecule in mouse, the linker sequence was changed from L001 to that of L040. In this experiment, seven weeks old NSG female tumor free mice were subcutaneously injected with 5×106 HCT116 tumor cells, at the commencement of the study, i.e., at day 0. At day 7 following the tumor cell injection, when the tumor volumes were about 180-200 mm3 (e.g., 183 mm3), the mice were injected intraperitoneally with 2×107 expanded human T cells. Treatment was started on day 9, by dividing the mice into various groups and each group was administered an EGFR targeting TriTAC molecule, an EGFR targeting ProTriTAC molecule with linker sequence L040 (ProTriTAC(L040), and a ProTriTAC molecule containing a non-cleavable linker (ProTriTAC(NCLV). The molecules were administered once daily for 10 days, at the following dosages: 300 μg/kg and 1000 μg/kg. Starting from day 2, body weight of the animals was recorded daily. The results shown in
In this study, mice were treated with various concentrations of an EFGR targeting TriTAC molecule, an EGFR targeting ProTriTAC molecule containing the linker sequence L001 (ProTriTAC (L001), and an EGFR targeting ProTriTAC molecule containing a non-cleavable linker (ProTriTAC(NCLV)). Tolerability was assessed by measuring serum concentration of ALT (alanine aminotransferase) and AST (aspartate aminotransferase). Results are shown in
In another study, cynomolgus monkeys were treated with various concentrations of an EFGR targeting TriTAC molecule, and an EGFR targeting ProTriTAC molecule containing a non-cleavable linker (ProTriTAC(NCLV)). Tolerability was assessed by measuring serum concentration of ALT (alanine aminotransferase) and AST (aspartate aminotransferase). Results are shown in
The aim of this study was to evaluate the expansion of therapeutic window by measuring anti-tumor activity and observable on-target toxicity in the same tumor-bearing mice. NSG female mice, 7 weeks old, were used for this study.
At the commencement of the study, on day 0, the NSG female mice were injected with 2.5×106 expanded human T cells, and 5×106 HCT116 (human colorectal carcinoma) tumor cells. The following day, on day 1, the mice were divided into groups and each group was treated with either GFP TriTAC molecule (SEQ ID No. 792), EGFR TriTAC molecule (SEQ ID No. 793), or an EGFR targeting ProTriTAC molecule containing linker L040, (SEQ ID No. 787) at the indicated dose levels in
On-target EGFR-related toxicity was determined by measuring the radius of the red scarring skin lesion above the original tumor implantation site with a caliper and applying the equation Area=π*(radius oflesion)2 on day 14. Results provided in
Results (from
The sequence of a binding moiety comprising non-CDR loops (AB, EF, C″D, and CC′) was obtained. A portion of the human CD3ε sequence was grafted into the CC′ loop of the non-CDR loops within the binding moiety, along with glycine residues to further extend the CC′ loop.
Further studies were carried out to assay the binding of the binding moiety containing the human CD3ε to CD3. It was observed that, in the presence of human serum albumin, the activated forms of ProTriTAC molecules that contained the binding moiety containing the human CD3ε were about 20 times potent in binding CD3 than their activated forms which did not contain the binding moiety. Results are shown in
Cell killing potential of a ProTriTAC molecule that contained a binding moiety as described herein was also assayed in a study where CaOV4 cell line was treated with the ProTriTAC molecule or its activated form in the presence of human serum albumin. As shown in
To identify locations within the non-CDR loops (AB, CC′, C″D, and EF) that were most amenable to modification, for creating a masking capability, libraries were assembled and generated using four groups of overlapping DNA oligos containing randomized degenerate “NNK” codons and with different loop lengths, as indicated in the schematic below:
Note: “X” denotes a randomized residue (“NNK” codon) that could be any of the 20 natural amino acids as well as stop codon. The goal was to have approximately 20% of each non-CDR loop be wild-type. These wild-type oligos served as internal benchmarks to gauge the tolerance of each loop to modification (sequence composition and/or length changes). A loop that was less tolerable to change could easily revert to wild-type; in contrast, a loop that was highly amenable to change would maintain the diverse sequence repertoire. To this end, 24 clones were sequenced from the naive library to verify the randomization of non-CDR loops prior to panning with HAS, as shown in
Llamas were immunized with purified EpCAM protein expressed in Expi293 cells. A phage display library for expression of heavy variable antibody domains was constructed from circulating B cells. See van der Linden, de Geus, Stok, Bos,van Wassenaar, Verrips, and Frenken. 2000. J Immunol Methods 240:185-195. Phage clones were screened for binding to EpCAM by expressing anti-EpCAM proteins in E coli, preparing periplasmic extracts, and proteins were screened for human and cynomolgus EpCAM binding activity using a colorimetric ELISA. Thirty-eight unique heavy chain only sequences were identified (SEQ ID Nos. 804-841) that produced a signal in the ELISA screening relative to the control with human and/or cynomolgus EpCAM proteins (as shown in Table 10).
Selected anti-EpCAM heavy chain only single domain antibodies from Example 15 were cloned into DNA constructs for expression of recombinant proteins. These expression constructs all encoded a signal peptide. One set of anti-EpCAM constructs (SEQ ID Nos. 842 to 868) was designed to express a fusion protein with a humanized anti-CD3 scFv domain on the N-terminus of the mature secreted fusion protein followed by a llama anti-EpCAM domain, with the two domains linked by the sequence GGGGSGGGS, and with a HHHHHH on the C-terminus. One second of anti-EpCAM constructs (SEQ ID Nos. 869 to 895) was designed to express a fusion protein with a llama anti-EpCAM domain on the N-terminus of the mature secreted fusion protein followed a humanized anti-CD3-scFv domain, with the two domains linked by the sequence GGGGSGGGS, and with aHHHHHH on the C-terminus.
These anti-EpCAM/anti-CD3 (from N-terminus to C-terminus) or anti-CD3/anti-EpCAM (from N terminus to C terminus) fusion protein constructs were transfected into Expi293 cells. The amount of anti-EpCAM/anti-CD3 fusion protein in the conditioned media from the transfected Expi293 cells was quantitated using by using an Octet instrument with streptavidin and loaded with biotinylated CD3-Fc fusion protein using an anti-CD3 fusion protein of similar molecular weight to the anti-EPCAM/ant-CD3 proteins as a standard.
The conditioned media were tested in a T-cell dependent cellular cytotoxicity assay. See Nazarian A A, Archibeque I L, Nguyen Y H, Wang P, Sinclair A M, Powers D A. 2015. J Biomol Screen. 20:519-27. In this assay, luciferase labelled NCI-H508 cells, which express EpCAM, were combined with purified human T cells and a titration of the anti-EpCAM/anti-CD3 fusion protein or the anti-CD3/anti-EpCAM. It was hypothesized that if the fusion protein directs T cells to kill the NCI-H508 cells, the signal in a luciferase assay performed at 48 hours after starting the experiment should decrease.
Using conditioned media with known concentrations of anti-EpCAM/anti-CD3 or anti-CD3/anti-EpCAM fusion proteins, the binding affinities of the fusion proteins for human and cynomolgus monkey EpCAM proteins were measured. An Octet instrument with streptavidin tips were loaded with biotinylated human or cynomolgus EpCAM protein, and KD values were calculated by measuring the on rate and off rate of binding of the anti-EPCAM/anti-CD3 fusion or anti-CD3/anti-EpCAM fusion proteins to the biotinylated EpCAM proteins. The KD measurements were made using a single 50 nM concentration of the anti-EPCAM/anti-CD3 or anti-CD3/anti-EpCAM fusion proteins, which allowed for rank ordering potency. The measured relative affinities are listed in Table 13. All of the fusion proteins bound to cynomolgus EpCAM, with KD values ranging from 1.6 to 56 nM. Most, but not all of the fusion proteins were measured binding to human EpCAM with KD values ranging from 0.8 to 74 nM.
Three of the llama anti-EpCAM antibodies sequences identified in Example 15 were humanized by grafting their CDR sequences onto human germline sequences, while retaining some llama framework sequences to ensure the antibodies did not lose activity (SEQ ID Nos. 896 to 898).
These sequences were cloned into expression constructs for expression of anti-EpCAM/anti-CD3 fusion proteins (SEQ ID Nos. 899 to 901) in Expi293 cells, as described in Example 16.
The amount of anti-EpCAM/anti-CD3 fusion proteins present in the conditioned medium was quantitated as described in Example 16. The affinities of these humanized proteins for human, cynomolgus, and mouse EpCAM were measured as described in Example 16. The relative KD values calculated from these measurements are listed in Table 14. All three sequences bound to human and cynomolgus EpCAM, with relative KD values ranging from about 0.3 to about 18 nM. Two of the sequences also bound to mouse EpCAM, with KD values ranging from about 1.4 to about 1.8 nM.
T cell killing potential of the anti-EpCAM/anti-CD3 fusion proteins present in the conditioned medium was assessed as described in Example 16. Results are provided in Table 15 and in
In this study, the tolerability of an exemplary EpCAM targeting ProTriTAC molecule was assessed. Seven weeks old NSG female tumor free mice were intraperitoneally injected with 2×107 expanded human T cells at the commencement of the study, i.e., at day 0. On day 2, treatment was started by dividing the mice into various groups and administering to them varying concentrations of the exemplary EpCAM targeting ProTriTAC molecule, containing the linker sequence L040, an EpCAMR targeting TriTAC molecule, an EpCAM targeting ProTriTAC molecule containing a non-cleavable linker (EpCAM ProTriTAC (NCLV), and a GFP TriTAC molecule (SEQ ID No. 792) as a control. The molecules were administered once daily for 10 days, at the following dosages: 0.03 mg/kg, 0.1 mg/kg, 0.3 mg/kg, and 1 mg/kg. Starting from day 2, body weight of the animals was recorded daily.
As shown in
An EpCAM targeting fusion protein of this disclosure (e.g., a fusion protein which is a trispecific protein comprising an anti-EpCAM heavy chain only single domain antibody, an anti-CD3 scFv, and an anti-Albumin domain) is evaluated in a xenograft model. In order to determine efficacy of the exemplary EpCAM targeting fusion protein in vivo, multiple xenograft tumor models are used. Examples of common tumor cell lines for use in xenograft tumor studies include A549 (non-small cell lung carcinoma) cells, DU-145 (prostate) cells, MCF-7 (breast) cells, Colo 205 (colon) cells, 3T3 (mouse fibroblast) cells, NCI H441 cells, HEP G2 (hepatoma) cells, MDA MB 231 (breast) cells, HT-29 (colon) cells, MDA-MB-435s (breast) cells, U266 cells, SH-SYSY cells, Sk-Mel-2 cells, NCI-H929, RPM18226, and A431 cells. Immune-deficient NOD/scid mice are sub-lethally irradiated (2 Gy) and subcutaneously inoculated with 1×106 tumor cells (e.g., NCI H441 cells) into their right dorsal flank. When tumors reach 100 to 200 mm3, animals are allocated into 3 treatment groups. Groups 2 and 3 are intraperitoneally injected with 1.5×107 activated human T-cells. Three days later, animals from Group 3 are subsequently treated with the exemplary EPCAM targeting-trispecific antigen-binding protein of Groups 1 and 2 are only treated with vehicle. Body weight and tumor volume are determined for 30 days, beginning at least 5 days post treatment with the exemplary EPCAM targeting trispecific protein.
It is expected that animals treated with the exemplary EpCAM targeting trispecific protein have a statistically significant delay in tumor growth in comparison to the respective vehicle-treated control group.
This is a Phase I/II clinical trial for studying an exemplary EpCAM targeting trispecific antigen-binding protein of this disclosure as a treatment for an epithelial ovarian cancer.
2.1 A subsequent phase II section will be treated at the MTD with a goal of determining if therapy with therapy of the exemplary EpCAM targeting trispecific protein results in at least a 20% response rate.
Primary Outcome for the Phase II—To determine if therapy of EPCAM targeting trispecific protein results in at least 20% of patients achieving a clinical response (blast response, minor response, partial response, or complete response)
5.3.1A subsequent phase III section will carried out with the exemplary EpCAM targeting trispecific protein, wherein secondary endpoints such as response rate (RR), patient recorded outcomes (PRO), progression-free survival (PFS), duration of progression free survival, time to progression (TIP), overall survival, health-related quality of life assessment, number of participants with overall survival, duration of response, time to response, number of participants with response, and time to tumor growth etc. will be assessed.
To determine the degree of activation of protease-cleavable linkers, ProTriTAC molecules were cloned with various protease cleavable sequences in the linker between the anti-ALB domain and the anti-CD3e-scFv domain. The proteins were expressed in Expi293 cells and purified via Protein A chromatography. The linkers were tested for their susceptibility to cleavage by a panel of proteases by mixing the ProTriTAC with 5-100 nM purified protease and incubating at 37° C. for one hour. To quantify the percentage of each ProTriTAC cleaved, it's association rate to huCD3e was measured using Biolayer interferometry (Octet). A standard curve was generated using a mixture of purified anti-CD3e::anti-Target (C3914) and non-cleavable ProTriTAC (C3912). In vitro assays were performed with both EpCAM and EGFR tumor antigen-targeting protease cleavable ProTriTAC molecules. Table 16 summarizes the linker sequences used in the Examples below. Tables 17 and 18 summarize the results obtained with EGFR-targeting protease-cleavable ProTriTAC.
The results of Tables 17 and 18 were then analyzed to determine which linkers should be selected for further efficacy studies using EpCAM-targeting ProTriTAC molecules. A panel tox screen was performed using control linkers and EGFR-targeting ProTriTAC molecules, and the percent of change in body weight in mice was monitored to aid in selection. In particular, tumor free mice were intraperitoneally injected with human T cells at the commencement of the study, i.e., at day 0. On day 2, treatment was started by dividing the mice into various groups and administering to them the exemplary EGFR targeting ProTriTAC molecule containing the linker sequence L040, an exemplary EGFR targeting ProTriTAC molecule containing the linker sequence L041, an exemplary EGFR targeting ProTriTAC molecule containing the linker sequence L001, an exemplary EGFR targeting ProTriTAC molecule containing the linker sequence L043, and an exemplary EGFR targeting TriTAC containing a non-cleavable linker (NCLV) at 1 mg/kg, daily for 10 days. The non-cleavable linker and linker L001 were used as controls for later studies. The results of this tox screen (i.e., the change in the percent body weight of mice) is demonstrated by
Following these studies, the results were analyzed to determine which linkers should be selected for further efficacy studies. Linker L040, for example, was selected for further efficacy studies based on the small degree of change in body weight demonstrated in subjects treated with them. Table 19 depicts the EGFR-targeting linkers selected for further efficacy studies using EpCAM-targeting molecules. For two of the selected linkers, a version of that linker with a serine protease removed was also selected for further studies. This included a version of linker L040 with a serine protease removed, indicated in Table 19 as L076, and a version of L063 with the serine protease removed, indicated in Table 19 as L073.
Table 20 and 21 summarizes the results for the in vitro assay, conducted using the method of Example 21, with EpCAM-targeting ProTriTAC molecules.
In this example, linker variants were evaluated in reducing the presence of pre-cleaved active drug and improve manufacturability were assessed. 2e6 CHOSource™ CHO-K1 GS null cells (Horizon) were nucleofected with 5 μg linearized expression vector plasmid DNA harboring ProTriTAC sequences comprising L040 or L276 protease cleavable linkers. Cells were passaged in medium containing glutamine for 2 days then switched to selection medium lacking glutamine and supplemented with 50 μM methionine sulfoximine (MSX) for up to three weeks such that stable pools were allowed to recover until they reached >95% viability with less than 24 hr doubling time and then banked.
Stable pools were thawed, expanded in glutamine free media supplemented with 50 μM MSX for two to three passages, and seeded into production media at 0.5e6 viable cells/ml in Optimum Growth™ Flasks (Thomson) shaken at 150 rpm, 5% CO2, 60% relative humidity, and 37° C. Fed-batch cultures were supplemented with feeds and glucose on days 3, 5, and 7 and viability and cell density determined by ViCell. Conditioned media (CM) was harvested on day 10 by centrifugation and sterile filtration. Titer was determined by biolayer interferometry using an OctetRed96 and Protein A tips with binding rates compared against a standard curve prepared from a ProTriTAC of known concentration as reference. CM samples were heated in non-reducing sample buffer and separated on NuPage TRIS-Glycine gels, stained with SimplyBlue Safestain (Invitrogen), and imaged with an Azure c500 near infrared imaging system.
Table 22 and
The following ProCAR constructs were made. Construct C2483 includes an anti-human EpCAM sdAb, a FLAG epitope, a CD8 hinge/transmembrane domain, a 4-1BB intracellular domain, and a CD3 zeta intracellular domain (SEQ ID NO: 1075;
Pan-MAJP Substrates are not Stable when Expressed on T Cells in ProCAR Format.
T cells were infected with lentivirus made from the indicated constructs to generate CAR-T cells, which were subsequently stained with anti-FLAG antibodies and EpCAM-Fc along with fluorescently labeled secondary antibodies and analyzed by flow cytometry.
The following ProCAR constructs were made: Construct C2483 which includes an anti-human EpCAM sdAb, a FLAG epitope, a CD8 hinge/transmembrane domain, a 4-1BB intracellular domain, and a CD3 zeta intracellular domain (SEQ ID NO: 1075;
MMP2-Selective Substrates Show Increased Stability when Expressed on T Cells in ProCAR Format
T cells were infected with lentivirus made from the indicated constructs to generate CAR-T cells, which were subsequently stained with anti-FLAG antibodies and EpCAM-Fc along with fluorescently labeled secondary antibodies and analyzed by flow cytometry.
MMP2-selective substrates show increased stability when expressed on T cells in ProCAR format.
The following ProCAR constructs were made: Construct C2483 which includes an anti-human EpCAM sdAb, a FLAG epitope, a CD8 hinge/transmembrane domain, a 4-1BB intracellular domain, and a CD3 zeta intracellular domain (SEQ ID NO: 1075;
MMP-7-Selective Substrates Show Increased Stability when Expressed on T Cells in ProCAR Format
T cells were infected with lentivirus made from the indicated constructs to generate CAR-T cells, which were subsequently stained with anti-FLAG antibodies and EpCAM-Fc along with fluorescently labeled secondary antibodies and analyzed by flow cytometry. Shown above are dot plots of M2 staining (x-axis; BV421 channel) and EpCAM-Fc staining (y-axis; AlexaFluor 647 channel) of CAR-T cells.
MMP-7-selective substrates show increased stability when expressed on T cells in ProCAR format.
MMP7-Selective Substrates are Cleavable with MMP7
T cells were infected with lentivirus made from the indicated constructs to generate CAR-T cells and either treated with recombinant MMP7 or buffer alone for 1 hour (hr) at 37° C. The CAR-T cells were subsequently stained with anti-FLAG antibodies and EpCAM-Fc along with fluorescently labeled secondary antibodies and analyzed by flow cytometry. Shown above are dot plots of M2 staining (x-axis; BV421 channel) and EpCAM-Fc staining (y-axis; AlexaFluor 647 channel) of CAR-T cells.
The following constructs were made. Construct C2446 includes an anti-human serine albumin sdAb, a protease cleavage site 3, an anti-human EGFR sdAb, a FLAG epitope, a CD8 hinge/transmembrane domain, a 4-1BB intracellular domain, and a CD3 zeta intracellular domain (
In a first assay, 300,000 primary human T cells isolated from healthy donors were infected with 1 mL lentiviral supernatant made from the indicated constructs to generate anti-EGFR CAR-T cells. Twenty-five thousand CAR-T cells were subsequently co-cultured under standard conditions at a 10:1 ratio (CAR-T:Target cells) with EGF-expressing cancer cells that stably express luciferase for 72 hours. Luciferase activity is determined as a proxy for cancer cell viability and normalized to the control CAR-T cells that do not contain scFv.
The data demonstrated that the level of protease side-dependent cell killing activity was reduced in ProCAR constructs that lacked the dimerization activity of the CD8a transmembrane domain (
In a second assay, 300,000 primary human T cells isolated from healthy donors were infected with 1 mL lentiviral supernatant made from the indicated constructs to generate anti-EGFR CAR-T cells, which were subsequently co-cultured at ratios of 10:1, 5:1, 2.5:1, and 1:1 (CAR-T:Target cells) with EGF-expressing cancer cells that stably express luciferase for 72 hours. Luciferase activity is determined as a proxy for cancer cell viability and normalized to the control CAR-T cells that do not contain scFv.
The data demonstrates that dimerization-deficient EGFR CAR has similar killing activity compared to wild-type (
Five NSG mice per group (The Jackson Laboratories, Bar Harbor, ME) were subcutaneously implanted with admixture of 5×106 HCT116 cancer cells and the indicated CAR-T cells (C1081, C1950, or C1824) at a ratio of 1:1 and tumor volumes were measured at the indicated days post-implantation. Significance was determined by using unpaired t test between groups. *** denotes p<0.0005.
These data provide an in vivo demonstration of masking of the anti-EGFR binding domain by the mask in the CC′ loop of the anti-ALB domain using non-cleavable ProCAR. Significance was determined by using unpaired t test between groups. *** denotes p<0.0005.
Epcam targeting ProTriTAC molecules (Epcam H90 Pro with protease cleavable linker L040, EpCAM H90 ProTriTAC with protease cleavable linker 11, EpCAM H90 ProTriTAC with protease cleavable linker 12, and EpCAM H90 ProTriTAC with protease cleavable linker 77) were made comprising different protease cleavable linkers (L040,SEQ ID NO: 787; protease cleavable linker 11, SEQ ID NO: 1091; protease cleavable linker 12, SEQ ID NO: 1093; and protease cleavable linker 77, SEQ ID NO: 1095). All animal experiments were conducted according to the protocol approved by Institutional Animal Care and Use Committee of Harpoon Therapeutics (protocol number HAR-001-2019). Animals were purchased from The Jackson Laboratory then housed in a pathogen free animal facility located at Harpoon Therapeutics in accordance with IACUC guidelines. All studies were performed in NSG™ (NOD-scid IL2Rgammanull) female mice 8 weeks of age with n=5-10 mice per group.
An admixture of HT-29 human colorectal adenocarcinoma tumor cells (5E6) and activated and expanded human T cells (2.5E6) was implanted subcutaneously on the right flank of NSG™ mice, followed 5 days later by treatment. Mice with established tumors (average of 215 mm3) were administered a repeat intraperitoneal dose (q.d.×14) of non-targeting GFP TriTAC (at 0.1 mg/kg) or EpCAM targeting ProTriTACs (at 0.1 mg/kg or at 0.3 mg/kg). Tumor growth was monitored at least twice weekly as indicated. All data shown as mean±SEM. Statistics represent RM one-way ANOVA with Dunnett post-hoc test, all groups compared to control non-targeting GFP TriTAC (****, P<0.0001).
GGLDGNEEPGGLEWVSSISGSGRDTLYADSVKGRFTISRDNA
GGSGGGGSGGVVGGGGT
VVGGGGTQTVVTQEPSLTVSPGGTVTLTCASSTGAVTSGNYP
GGLDGNEEPGGLEWVSSISGSGRDTLYADSVKGRFTISRDNA
GGKPLGLQARVVGGGGT
GGLDGNEEPGGLEWVSSISGSGRDTLYADSVKGRFTISRDNA
GGSGGGGSGGVVGGGGT
VVGGGGTQTVVTQEPSLTVSPGGTVTLTCASSTGAVTSGNYP
GGGGGLDGNEEPGG
GGGGSGGGGSGGVVGGGGT
GGLDGNEEPGGLEWVSSISGSGRDTLYADSVKGRFTISRDNA
GGKPLGLQARVVGGGGT
GGLDGNEEPGG
LEWVSSISGSGRDTLYADSVKGRFTISRDNA
GGLDGNEEPGG
LEWVSSISGSGRDTLYADSVKGRFTISRDNA
GGLDGNEEPGG
LEWVSSISGSGRDTLYADSVKGRFTISRDNA
GGLDGNEEPGG
LEWVSSISGSGRDTLYADSVKGRFTISRDNA
GGLDGNEEPGG
LEWVSSISGSGRDTLYADSVKGRFTISRDNA
MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGNSLRLS
CAASGFTFSKFGMSWVRQRQSTFMAMDMPILEWVSSISGSGR
DTLYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTAVYYCTI
GGSLSVSSQGTLVTVSSGSGGSGGGGSGGGGGSGEVQLLESG
GGLVQPGGSLTLSCAASGFIFRAASMAWYRQSPGNERELVAS
ISSGAFTNYADSVKARFTISRDNSKNTLYLQMNSLRAEDTAV
YYCGATFLRSDGHHTINGQGTLVTVSSTSDYKDDDDKTTTPA
PRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIY
IWAPLAGTCGVLLLSLVITLYKRGRKKLLYIFKQPFMRPVQT
TQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLY
NELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQ
KDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALH
MQALPPR
This application is a continuation of International Application No. PCT/US2022/078178, filed Oct. 14, 2022, and claims the benefit of U.S. Provisional Application No. 63/256,122, filed Oct. 15, 2021, all of which are incorporated herein by reference in their entirety.
| Number | Date | Country | |
|---|---|---|---|
| 63256122 | Oct 2021 | US |
| Number | Date | Country | |
|---|---|---|---|
| Parent | PCT/US2022/078178 | Oct 2022 | WO |
| Child | 18635533 | US |
