CONTINUOUS EVOLUTION FOR STABILIZED PROTEINS

Information

  • Patent Application
  • 20200216833
  • Publication Number
    20200216833
  • Date Filed
    September 18, 2018
    8 years ago
  • Date Published
    July 09, 2020
    6 years ago
Abstract
Some aspects of this disclosure relate to systems, apparatuses, compositions (e.g., isolated nucleic acids and vectors), and methods for improving the stability and/or solubility of proteins evolved using phage-assisted continuous evolution (PACE). In some embodiments, vectors described herein comprise nucleic acids encoding selection systems (e.g., positive and/or negative selection systems) that link expression of genes required for production of infectious phage particles to a desirable physiochemical (e.g., stability or solubility) and/or desired function of an evolved protein.
Description
BACKGROUND

Proteins and nucleic acids employ only a small fraction of the available functionality. There is considerable current interest in modifying proteins and nucleic acids to diversify their functionality. Molecular evolution efforts include in vitro diversification of a starting molecule into related variants from which desired molecules are chosen. Methods used to generate diversity in nucleic acid and protein libraries include whole genome mutagenesis (Hart et al., Amer. Chem. Soc. (1999), 121:9887-9888), random cassette mutagenesis (Reidhaar-Olson et al., Meth. Enzymol. (1991), 208:564-86), error-prone PCR (Caldwell, et al. (1992), PCR Methods Applic. (1992), 2: 28-33), DNA shuffling using homologous recombination (Stemmer (1994) Nature (1994), 370:389-391), and phage-assisted continuous evolution (PACE). After diversification, molecules with novel or enhanced properties can be selected.


SUMMARY

Some aspects of this disclosure relate to systems, apparatuses, compositions (e.g., isolated nucleic acids and vectors), and methods for improving the stability and/or solubility of proteins evolved using PACE.


Phage-assisted continuous evolution (PACE) can serve as a rapid, high-throughput system for evolving genes of interest. One advantage of the PACE technology is that both the time and human effort required to evolve a gene of interest are dramatically decreased as compared to conventional iterative evolution methods. During PACE, a phage vector carrying a gene encoding a gene of interest replicates in a flow of host cells through a fixed-volume vessel (a “lagoon”). For example, in some embodiments of PACE described herein, a population of bacteriophage vectors replicates in a continuous flow of bacterial host cells through the lagoon, wherein the flow rate of the host cells is adjusted so that the average time a host cell remains in the lagoon is shorter than the average time required for host cell division, but longer than the average life cycle of the vector, e.g., shorter than the average M13 bacteriophage life cycle. As a result, the population of vectors replicating in the lagoon can be varied by inducing mutations, and then enriching the population for desired variants by applying selective pressure, while the host cells do not effectively replicate in the lagoon.


Often, proteins (e.g., engineered proteins, wild-type proteins, etc.) have certain physiochemical properties, such as decreased stability (e.g., thermostability) and/or solubility that render them unsuitable for therapeutic or commercial use. Some aspects of this disclosure provide systems for improving the stability and/or solubility of proteins evolved during PACE. The systems, including recombinant expression constructs, also referred to as vectors if they are in the form of a plasmid, described herein can enhance selection of evolved proteins that are properly folded, have increased stability (e.g., thermodynamic stability), and/or solubility (e.g., enhanced soluble expression in bacteria, such as E. coli) while maintaining desired protein function.


In some embodiments, the disclosure relates to isolated nucleic acids encoding expression constructs that enable stability-based and/or solubility-based selection of evolved proteins during PACE. In some embodiments, the disclosure relates to vectors, for example plasmids, comprising isolated nucleic acids described herein. The skilled artisan will appreciate that a vector as described herein can comprise one, or more than one (e.g., 2, 3, 4, 5, etc.), isolated nucleic acids (e.g., expression constructs) described by the disclosure. Typically, isolated nucleic acids and vectors described herein are contained within a host cell (e.g., a bacterial cell, such as an E. coli cell). A host cell may comprise one or more (e.g., 1, 2, 3, 4, 5, etc.) isolated nucleic acids as described herein and/or one or more vectors as described herein.


In some aspects, the disclosure relates to the use of the endogenous bacterial heat shock response for selection against unstable proteins during PACE. As described further in the Examples, accumulation of misfolded proteins in E. coli results in release of σ32 transcription factor and expression of heat shock proteins. However, by using promoters of certain E. coli sigma factors (e.g., σ32) to drive expression of a dominant-negative pIII protein (e.g., pIII-neg), expression constructs described herein allow for negative selection of misfolded proteins during PACE.


Accordingly, in some embodiments, the disclosure provides an isolated nucleic acid comprising an E. coli sigma 32 (σ32) promoter operably linked to a nucleic acid sequence that encodes a dominant negative gene III (pIII-neg). In some aspects, the σ32 promoter comprises a sequence encoding a protein as set forth in SEQ ID NO: 1.


Some aspects of this disclosure provide methods for directed evolution using an expression construct comprising an E. coli σ32 promoter. In some embodiments, the method comprises: contacting a population of bacterial host cells in a culture medium with a population of M13 phages comprising a gene of interest to be evolved and lacking a functional pIII gene required for the generation of infectious phage particles, wherein the M13 phages allow for expression of the gene of interest in the host cells, the host cells are suitable host cells for M13 phage infection, replication, and packaging, wherein the M13 phage comprises all phage genes required for the generation of phage particles, except a full-length pIII gene (e.g., a functional pIII protein); and the host cells comprise an expression construct encoding the pIII protein, wherein expression of the pIII gene is dependent on a function of a gene product of the gene of interest; incubating the population of host cells under conditions allowing for the mutation of the gene of interest, the production of infectious M13 phage, and the infection of host cells with M13 phage, wherein infected cells are removed from the population of host cells, and wherein the population of host cells is replenished with fresh host cells that are not infected by M13 phage, wherein the function of the gene of interest is a desired function, wherein desired functional library members induce production of pIII and release M13 progeny into the culture medium capable of infecting new host cells, wherein undesired non-functional library members do not produce pIII and release only non-infectious M13 progeny into the culture medium; and isolating a mutated M13 phage replication product encoding an evolved protein from the population of host cells, wherein the host cells comprise an expression construct encoding a dominant-negative pIII protein (pIII-neg) operably linked to an E. coli sigma 32 (σ32) promoter.


In some aspects, the disclosure relates to expression constructs engineered to couple expression of gIII protein to reconstitution of a split T7 RNA polymerase during PACE for selection of evolved proteins having increased stability and/or solubility (e.g., having increased stability and/or solubility relative to an unevolved protein). Without wishing to be bound by any particular theory, expression of a fusion protein comprising the T7 RNAP N-terminal domain in a cell expressing a T7 RNAP C-terminal domain and comprising a gene encoding a gIII protein operably linked to a T7 promoter results in reconstitution of a functional T7 RNAP and expression of the gIII protein. Accordingly, in some aspects, the disclosure provides an isolated nucleic acid comprising a sequence encoding a gene of interest to be evolved fused to a sequence encoding a T7 RNA polymerase (RNAP) N-terminal domain.


In some embodiments, sequence encoding a T7 RNAP N-terminal domain is contiguous with the 5′-end or the 3′-end of a sequence encoding a gene of interest to be evolved. In some embodiments, T7 RNAP N-terminal domain is represented by (or encodes a protein having) the sequence set forth in SEQ ID NO: 2 or 10. In some embodiments, a T7 RNAP C-terminal domain comprises (or encodes a protein having) the sequence set forth in SEQ ID NO: 3.


Some aspects of this disclosure provide methods for directed evolution using an expression construct comprising a gene of interest to be evolved fused to a sequence encoding a T7 RNA polymerase (RNAP) N-terminal domain. In some embodiments, the method comprises contacting a population of bacterial host cells expressing a T7 RNAP C-terminal domain with a population of M13 phages comprising a gene of interest to be evolved fused to a T7 RNAP N-terminal domain, wherein the M13 phages are deficient in a full-length pIII gene (e.g., a functional pIII protein), wherein the phage allows for expression of the gene of interest in the host cells, the host cells are suitable host cells for M13 phage infection, replication, and packaging; and the host cells comprise an expression construct encoding the pIII protein operably linked to a T7 promoter, wherein expression of the pIII gene is dependent on reconstitution of the T7 RNAP N-terminus and T7 RNAP C-terminus; incubating the population of host cells under conditions allowing for the mutation of the gene of interest, the production of infectious M13 phage, and the infection of host cells with M13 phage, wherein infected cells are removed from the population of host cells, and wherein the population of host cells is replenished with fresh host cells that are not infected by M13 phage; and isolating a mutated M13 phage replication product encoding an evolved protein from the population of host cells.


In some aspects, the disclosure relates to engineering of expression constructs comprising Nostoc punctiforme (Npu) split intein for simultaneous selection of protein function and solubility during PACE. As described further in the Examples, a PACE selection system comprising 1) an expression construct comprising a portion of gIII protein signal peptide fused to a Npu split intein fragment; and 2) an expression construct comprising a portion of gIII protein signal peptide (e.g., the remainder of the gIII signal peptide missing from the expression construct described in (1)) fused to a Npu split intein fragment complementary to the Npu split intein fragment described in (1), allows for selection of evolved proteins based upon the activity, stability (e.g., thermostability) and/or solubility of the protein of interest.


Accordingly, in some embodiments the disclosure provides an isolated nucleic acid comprising a sequence encoding a T7 promoter operably linked to an expression cassette comprising, in the following order: a sequence encoding a Npu split intein C-terminal portion, and a sequence encoding a M13 phage gIII protein, wherein the sequence encoding the gIII protein lacks one or more nucleic acid bases in the signal peptide domain.


In some embodiments, a sequence encoding a gIII protein lacks nucleic acid bases 1-10 of a signal peptide domain. In some embodiments, an isolated nucleic acid comprises a sequence encoding a protein comprising a sequence as set forth in SEQ ID NO: 4.


In some aspects, the disclosure provides isolated nucleic acid comprising a sequence encoding a RNA polymerase I promoter operably linked to an expression cassette comprising, in the following order, a sequence encoding a M13 phage gIII protein signal peptide; and a sequence encoding a Npu split intein N-terminal portion, wherein the sequence encoding the gIII protein signal peptide lacks one or more nucleic acid bases of the signal peptide domain (e.g., nucleic acid bases 1-10 of a gIII protein signal peptide, such as the sequence as set forth in SEQ ID NO: 5).


In some embodiments, an isolated nucleic acid further comprises a sequence encoding a repressor protein binding site. In some embodiments, a repressor protein is a lambda phage repressor protein, such as 434cI.


In some aspects, the disclosure provides a method of phage-assisted continuous evolution (PACE) comprising contacting a population of bacterial host cells with a population of M13 phages comprising a gene of interest to be evolved fused to a T7 RNAP, a RNAP omega subunit (rpoZ), and a HA4 monobody, wherein the M13 phages are deficient in a full-length pIII gene, wherein the phage allows for expression of the gene of interest in the host cells, the host cells are suitable host cells for M13 phage infection, replication, and packaging; and the host cells comprise an expression construct encoding one or more isolated nucleic acids comprising a Npu split intein, wherein expression of the pIII gene is dependent on reconstitution of Npu split intein N- and C-terminal portions; incubating the population of host cells under conditions allowing for the mutation of the gene of interest, the production of infectious M13 phage, and the infection of host cells with M13 phage, wherein infected cells are removed from the population of host cells, and wherein the population of host cells is replenished with fresh host cells that are not infected by M13 phage; and isolating a mutated M13 phage replication product encoding an evolved protein from the population of host cells.


In some aspects, the disclosure relates to compositions and methods for non-fusion-based solubility selection during PACE. Without wishing to be bound by any particular theory, fusion of small inclusion body chaperone proteins (e.g., ibpA, ibpB) to expression constructs comprising a split T7 RNAP fragment allows for sequestration of misfolded or insoluble proteins within host cells (e.g., E. coli cells). Thus, in some embodiments, the disclosure provides an isolated nucleic acid comprising a heat shock chaperone protein fused to a T7 RNAP N-terminal domain. In some embodiments, a heat shock chaperone protein is ibpA or ibpB. In some embodiments, a nucleic acid comprising a hear shock chaperone protein comprises (or encodes a protein having) the sequence set forth in SEQ ID NO: 6 or 7.


In some aspects, the disclosure relates to expression constructs comprising a GNC4 tag for solubility-based selection during PACE. As described further in the Examples, a GCN4 tag is used to allow solubility-based selection of proteins in PACE independent of protein activity. This involves fusion of the leucine zipper domain of the yeast GCN4 transcription factor (“GCN4 tag”) upstream of the protein of interest and running dual PACE selections with an protein binding accessory plasmid (AP) encoding the anti-GCN4 scFv m3, which recognizes the GCN4 tag. In some embodiments, the disclosure provides an isolated nucleic acid comprising a sequence encoding a GCN4 tag, a gene encoding a protein of interest to be evolved, a T7 RNAP, and a RNAP omega subunit (rpoZ).


The skilled artisan will recognize that an isolated nucleic acid as described herein can be situated on a vector. In some embodiments, a vector is a plasmid. In some embodiments, more than one isolated nucleic acid as described herein is situated on a plasmid. For example, in some embodiments, a plasmid comprises 1, 2, 3, 4, 5 or more nucleic acids as described by the disclosure.


The summary above is meant to illustrate, in a non-limiting manner, some of the embodiments, advantages, features, and uses of the technology disclosed herein. Other embodiments, advantages, features, and uses of the technology disclosed herein will be apparent from the Detailed Description, the Drawings, the Examples, and the Claims.





BRIEF DESCRIPTION OF DRAWINGS


FIGS. 1A-1B are schematic overviews of a PACE negative selection strategy against unstable proteins using an E. coli σ32 reporter system.



FIG. 2 shows a Western blot of wild-type (wt) maltose-binding protein (MBP) and a mutant MBP with impaired folding, MalE31, in the soluble and insoluble fractions, respectively, of cell lysate.



FIGS. 3A-3C show luminescence assay data indicating that σ32 promoter-based reporters do not differentiate between expression of MBP vs. MalE31.



FIG. 4 shows luminescence assay data indicating σ32 reporters respond to dnaKJ induction; minimal differentiation was observed after induction of MBP/MalE31 synthesis.



FIG. 5 is a schematic overview of a split T7 RNA polymerase (RNAP) complementation system for PACE selection of properly folded proteins.



FIGS. 6A-6B show representative data for T7 complementation-based selection strategies. FIG. 6A shows luminescence assay data indicating that Voigt T7 RNAP fused to MBP drives increased transcriptional activity relative to Voigt T7 RNAP fused to MalE31. FIG. 6B shows luminescence assay data indicating that Split T7 RNAP fused to MBP drives increased transcriptional activity relative to Split T7 RNAP fused to MalE31. aTc=anhydrotetracycline.



FIGS. 7A-7B show the relationship between T7 RNAP selection and protein stability. FIG. 7A shows ΔΔG (kcal/mol) of proteins in a Voigt T7 RNAP selection system. FIG. 7B shows ΔΔG (kcal/mol) of proteins in a Split T7 RNAP selection system.



FIGS. 8A-8B show the relationship between T7 RNAP selection and protein stability. FIG. 8A shows luminescence assay data indicating that the Voigt T7 RNAP selection system enriches stabilized Colicin immunity protein (Im7). FIG. 8B shows luminescence assay data indicating that the Split T7 RNAP selection system enriches stabilized Im7.



FIG. 9 shows an analytical gel indicating that selection phagemid (SP) encoding MBP outcompete SP encoding misfolded MalE31 during PACE.



FIGS. 10A-10B show PACE experiments with SP encoding MalE31 folding mutant (G32D/I33P). FIG. 10A shows a PACE lagoon with SP encoding MalE31 began recovering after ˜60 hours. FIG. 10B shows a PACE lagoon with SP encoding MalE31 that washed out.



FIG. 11 shows characterization of PACE mutants produced by evolution of MalE31. Luciferase assay data indicate enrichment of MalE31 mutants with increased stability relative to un-mutated MalE31.



FIG. 12 shows an analytical gel indicating increased expression of MalE31 PACE mutants in the soluble fraction of cell lysates relative to un-mutated MalE31.



FIG. 13 shows melting temperatures of MalE31 PACE mutants, MBP and un-mutated MalE31.



FIG. 14 shows equilibrium urea denaturing for MalE31 PACE mutants, MBP and un-mutated MalE31, as measured by tryptophan fluorescence.



FIG. 15 shows luminescence data for Cry1Ac/T7 N-terminal fusion proteins in the Split T7 RNAP complementation assay.



FIGS. 16A-16B show analysis of expression of other MBP variants suggests that the split T7 RNAP system is selecting for soluble protein expression. FIG. 16A shows an analytical gel indicating MBP variant expression in the soluble fraction of cell lysates. FIG. 16B shows data showing ΔΔG (kcal/mol) of MBP variants.



FIGS. 17A-17B show luminescence assay data for MBP PACE using T7 RNAP variants that have reduced transcriptional activity. FIG. 17A shows luminescence data for PACE of MBP and MalE31 using T7 RNAP variants that have reduced transcriptional activity. FIG. 17B shows the ratio of MBP to MalE31 resulting from PACE using T7 RNAP variants that have reduced transcriptional activity.



FIG. 18 is a schematic overview of translational re-initiation of T7RNAP downstream of MalE31 during PACE.



FIG. 19 shows data indicating that translational re-initiation may be compensated for by strong induction. aTc=anhydrotetracycline.



FIG. 20 shows a schematic overview of a split Npu intein selection strategy. Phage protein pIII is localized to the membrane by recognition of an N-terminal signal peptide. The signal peptide of pIII was split in two non-functional halves and fused the N- and C-terminal portions of the Npu split intein to create an “and gate” that requires both intein/g3p fusions to be produced in order to produce infectious phage during PACE.



FIG. 21 shows one embodiment of a split Npu intein selection system for PACE. The top panel is a schematic overview of the accessory plasmid (AP) used in this experiment. The bottom panel shows agar plates for each selection phage (SP) used for PACE selection of HA4 monobody variants. Data indicate that expression of HA4 monobody variants requires reconstitution of the pIII mature protein by interaction of the N- and C-terminal portions of the split Npu intein.



FIG. 22 shows representative Western blots from PACE experiments in which protease (e.g., FtsH, MMP3, Lon, hs1VU) and Cry1Ac (wild-type (wt) and C03 variant) are co-expressed in cells.



FIG. 23 is a schematic overview of translational re-initiation of T7RNAP downstream of MalE31 during PACE.



FIGS. 24A-24C show one embodiment of dual PACE selection strategy. FIG. 24A is a schematic overview of a split Npu intein selection system for PACE of HA4 monobody. FIG. 24B shows the number of plaque-forming units (pfu) in a PACE lagoon (L1) using a 20 ng/mL aTc drift. FIG. 24C shows the number of plaque-forming units (pfu) in a PACE lagoon (L2) using a 100 ng/mL aTc drift.



FIGS. 25A-25C show application of a dual selection PACE strategy to protein solubility of GCN4-binding scFvs. FIG. 25A shows fold propagation of scFv variants L34Ser, Ωgraft, and m3 during PACE with a 2-hybrid (e.g., split Npu intein) AP. FIG. 25B shows fold propagation of scFv variants L34Ser, Ωgraft, and m3 during PACE with a T7 mutant AP. FIG. 25C shows fold propagation of scFv variants L34Ser, Ωgraft, and m3 during PACE with both a 2-hybrid (e.g., split Npu intein)/mutant T7 combination AP.



FIGS. 26A-26B show non-fusion-based solubility selection during PACE. FIG. 26A shows luminescence assay data for PACE of MBP and MalE31 using an AP encoding T7 C-terminus driven by PBAD, a plasmid encoding ibpA fused to T7 RNAP N-terminus driven by PTET, and a plasmid encoding MBP or MalE31 driven by PBAD. FIG. 26B shows luminescence assay data for PACE of MBP and MalE31 using an AP encoding T7 C-terminus driven by PBAD, a plasmid encoding ibpB fused to T7 RNAP N-terminus driven by PTET, and a plasmid encoding MBP or MalE31 driven by PBAD.



FIGS. 27A-27C show application of a dual selection PACE strategy to protein solubility of GCN4-binding scFvs. FIG. 27A shows fold propagation of scFv variants L34Ser, Ωgraft, and m3 during PACE with a 2-hybrid (e.g., split Npu intein) AP. FIG. 27B shows fold propagation of scFv variants L34Ser, Ωgraft, and m3 during PACE with a T7 mutant AP. FIG. 27C shows fold propagation of scFv variants L34Ser, Ωgraft, and m3 during PACE with both a 2-hybrid (e.g., split Npu intein)/mutant T7 combination AP.



FIG. 28 shows a schematic overview of a split Npu intein selection strategy for PACE of Ωgraft scFv variants having increased solubility.



FIGS. 29A-29C show representative data for plaque-forming units (pfus) of Ωgraft scFv variants from three PACE lagoons, L1 (FIG. 29A), L2 (FIG. 29B), and L3 (FIG. 29C).



FIG. 30 shows a Western blot indicating Ωgraft scFv variants evolved by split Npu intein PACE have increased solubility compared to wt Ωgraft scFv.



FIGS. 31A-31B show representative data for plaque-forming units (pfus) of MalE31 variants during PACE using split Npu intein. FIG. 31A shows PACE of MalE31 starting clone P33T/T275I. FIG. 31B shows PACE of MalE321 starting clone P33S/A386E. Both starting clones also have a G32D double mutation.



FIG. 32 shows a Western blot indicating MalE31 variants evolved by split Npu intein PACE have increased solubility compared to the starting clones (P33S/A386E and P33T/T275I, respectively). s=soluble fraction; i=insoluble fraction; L=ladder; 1=P33S/A386E (starting clone 1); 2=P33T/T275I (starting clone 2); 3=D32G/P33T/S233L (evolved from clone 2); 4=D32G/P33S/F67L (evolved from clone 1); 5=D32G/P33S/S233L (evolved from clone 1); 6=D32G/P33T/P159L (evolved from clone 2).



FIGS. 33A-33B show data from two lagoons, L1 (FIG. 33A) and L2 (FIG. 33B) from PACE of the Cry1Ac tryptic core.



FIG. 34 shows a Western blot of Cry1Ac C03, a PACE-evolved Cry1Ac C03 variant (consensus mutations I36R/G305E/S416R/S417G) and wt Cry1Ac from soluble (s) and insoluble (i) cell lysate fractions.



FIGS. 35A-35B show representative data for plaque-forming units (pfus) of Ωgraft scFv variants from three PACE lagoons, L1 (FIG. 35A) and L2 (FIG. 35B).



FIG. 36 shows a schematic overview of Ωgraft scFv variants cheating to evolve a secondary translational start site (M) in the L2 lagoon. SEQ ID NOs: 12-16 are shown, top to bottom.



FIG. 37 shows a Western blot indicating Ωgraft scFv variants show improved soluble expression but not improved thermal stability.



FIGS. 38A-38C show PACE of an anti-huntingtin (Htt) scFv C4. FIG. 38A shows representative data for plaque-forming units (pfus) in Lagoon 1 (L1). FIG. 38B shows representative data for plaque-forming units (pfus) in Lagoon 2 (L2). FIG. 38C shows representative data for plaque-forming units (pfus) in Lagoon 3 (L3).



FIG. 39 shows a Western blot indicating evolved Htt scFv clones have improved solubility relative to starting clone C4.



FIG. 40 shows a schematic overview of a selection plasmid comprising a “GCN4 tag” (e.g., the yeast transcription factor GCN4 leucine zipper sequence), a protein of interest (POI), T7n (T7 RNAP N-terminal domain), and RNA polymerase Z (rpoZ).



FIG. 41 shows representative data for plaque-forming units (pfus) of MalE31 variants using a SP comprising a “GCN4 tag” from a PACE lagoon, L2.


DEFINITIONS

The term “phage-assisted continuous evolution (PACE),” as used herein, refers to continuous evolution that employs phage as viral vectors. The general concept of PACE technology has been described, for example, in International PCT Application, PCT/US2009/056194, filed Sep. 8, 2009, published as WO 2010/028347 on Mar. 11, 2010; International PCT Application, PCT/US2011/066747, filed Dec. 22, 2011, published as WO 2012/088381 on Jun. 28, 2012; U.S. application, U.S. Ser. No. 13/922,812, filed Jun. 20, 2013; U.S. application, U.S. Ser. No. 62/067,194, filed Oct. 22, 2014, and U.S. Pat. No. 9,023,594, issued May 5, 2015, the entire contents of each of which are incorporated herein by reference.


The term “continuous evolution,” as used herein, refers to an evolution process, in which a population of nucleic acids encoding a gene to be evolved is subjected to multiple rounds of (a) replication, (b) mutation, and (c) selection to produce a desired evolved version of the gene to be evolved that is different from the original version of the gene, for example, in that a gene product, such as, e.g., an RNA or protein encoded by the gene, exhibits a new activity not present in the original version of the gene product, or in that an activity of a gene product encoded by the original gene to be evolved is modulated (increased or decreased). The multiple rounds can be performed without investigator intervention, and the steps (a)-(c) can be carried out simultaneously. Typically, the evolution procedure is carried out in vitro, for example, using cells in culture as host cells. In general, a continuous evolution process provided herein relies on a system in which a gene encoding a gene product of interest is provided in a nucleic acid vector that undergoes a life-cycle including replication in a host cell and transfer to another host cell, wherein a critical component of the life-cycle is deactivated and reactivation of the component is dependent upon an activity of the gene to be evolved that is a result of a mutation in the nucleic acid vector.


The term “vector,” as used herein, refers to a nucleic acid that can be modified to encode a gene of interest and that is able to enter into a host cell, mutate and replicate within the host cell, and then transfer a replicated form of the vector into another host cell. Exemplary suitable vectors include viral vectors, such as retroviral vectors or bacteriophages, and conjugative plasmids. Additional suitable vectors will be apparent to those of skill in the art based on the instant disclosure.


The term “viral vector,” as used herein, refers to a nucleic acid comprising a viral genome that, when introduced into a suitable host cell, can be replicated and packaged into viral particles able to transfer the viral genome into another host cell. The term viral vector extends to vectors comprising truncated or partial viral genomes. For example, in some embodiments, a viral vector is provided that lacks a gene encoding a protein essential for the generation of infectious viral particles. In suitable host cells, for example, host cells comprising the lacking gene under the control of a conditional promoter, however, such truncated viral vectors can replicate and generate viral particles able to transfer the truncated viral genome into another host cell. In some embodiments, the viral vector is a phage, for example, a filamentous phage (e.g., an M13 phage). In some embodiments, a viral vector, for example, a phage vector, is provided that comprises a gene of interest to be evolved.


The term “phage,” as used herein interchangeably with the term “bacteriophage,” refers to a virus that infects bacterial cells. Typically, phages consist of an outer protein capsid enclosing genetic material. The genetic material can be ssRNA, dsRNA, ssDNA, or dsDNA, in either linear or circular form. Phages and phage vectors are well known to those of skill in the art and non-limiting examples of phages that are useful for carrying out the methods provided herein are λ (Lysogen), T2, T4, T7, T12, R17, M13, MS2, G4, Pl, P2, P4, Phi X174, N4, Φ6, and Φ29. In certain embodiments, the phage utilized in the present invention is M13. Additional suitable phages and host cells will be apparent to those of skill in the art and the invention is not limited in this aspect. For an exemplary description of additional suitable phages and host cells, see Elizabeth Kutter and Alexander Sulakvelidze: Bacteriophages: Biology and Applications. CRC Press; 1st edition (December 2004), ISBN: 0849313368; Martha R. J. Clokie and Andrew M. Kropinski: Bacteriophages: Methods and Protocols, Volume 1: Isolation, Characterization, and Interactions (Methods in Molecular Biology) Humana Press; 1st edition (December, 2008), ISBN: 1588296822; Martha R. J. Clokie and Andrew M. Kropinski: Bacteriophages: Methods and Protocols, Volume 2: Molecular and Applied Aspects (Methods in Molecular Biology) Humana Press; 1st edition (December 2008), ISBN: 1603275649; all of which are incorporated herein in their entirety by reference for disclosure of suitable phages and host cells as well as methods and protocols for isolation, culture, and manipulation of such phages).


The term “accessory plasmid,” as used herein, refers to a plasmid comprising a gene required for the generation of infectious viral particles under the control of a conditional promoter. In the context of continuous evolution of genes, transcription from the conditional promoter of the accessory plasmid is typically activated, directly or indirectly, by a function of the gene to be evolved. Accordingly, the accessory plasmid serves the function of conveying a competitive advantage to those viral vectors in a given population of viral vectors that carry a version of the gene to be evolved able to activate the conditional promoter or able to activate the conditional promoter more strongly than other versions of the gene to be evolved. In some embodiments, only viral vectors carrying an “activating” version of the gene to be evolved will be able to induce expression of the gene required to generate infectious viral particles in the host cell, and, thus, allow for packaging and propagation of the viral genome in the flow of host cells. Vectors carrying non-activating versions of the gene to be evolved, on the other hand, will not induce expression of the gene required to generate infectious viral vectors, and, thus, will not be packaged into viral particles that can infect fresh host cells.


The term “helper phage,” as used herein interchangeable with the terms “helper phagemid” and “helper plasmid,” refers to a nucleic acid construct comprising a phage gene required for the phage life cycle, or a plurality of such genes, but lacking a structural element required for genome packaging into a phage particle. For example, a helper phage may provide a wild-type phage genome lacking a phage origin of replication. In some embodiments, a helper phage is provided that comprises a gene required for the generation of phage particles, but lacks a gene required for the generation of infectious particles, for example, a full-length pIII gene. In some embodiments, the helper phage provides only some, but not all, genes for the generation of infectious phage particles. Helper phages are useful to allow modified phages that lack a gene for the generation of infectious phage particles to complete the phage life cycle in a host cell. Typically, a helper phage will comprise the genes for the generation of infectious phage particles that are lacking in the phage genome, thus complementing the phage genome. In the continuous evolution context, the helper phage typically complements the selection phage, but both lack a phage gene required for the production of infectious phage particles.


The term “selection phage,” as used herein interchangeably with the term “selection plasmid,” refers to a modified phage that comprises a gene of interest to be evolved and lacks a full-length gene encoding a protein required for the generation of infectious phage particles. For example, some M13 selection phages provided herein comprise a nucleic acid sequence encoding a gene to be evolved, e.g., under the control of an M13 promoter, and lack all or part of a phage gene encoding a protein required for the generation of infectious phage particles, e.g., gI, gII, gIII, gIV, gV, gVI, gVII, gVIII, gIX, or gX, or any combination thereof. For example, some M13 selection phages provided herein comprise a nucleic acid sequence encoding a gene to be evolved, e.g., under the control of an M13 promoter, and lack all or part of a gene encoding a protein required for the generation of infective phage particles, e.g., the gIII gene encoding the pIII protein.


The term “mutagenesis plasmid,” as used herein, refers to a plasmid comprising a gene encoding a gene product that acts as a mutagen. In some embodiments, the gene encodes a DNA polymerase lacking a proofreading capability. In some embodiments, the gene is a gene involved in the bacterial SOS stress response, for example, a UmuC, UmuD′, or RecA gene. In some embodiments, the gene is a GATC methylase gene, for example, a deoxyadenosine methylase (dam methylase) gene. In some embodiments, the gene is involved in binding of hemimethylated GATC sequences, for example, a seqA gene. In some embodiments, the gene is involved with repression of mutagenic nucleobase export, for example emrR. In some embodiments, the gene is involved with inhibition of uracil DNA-glycosylase, for example a Uracil Glycosylase Inhibitor (ugi) gene. In some embodiments, the gene is involved with deamination of cytidine (e.g., a cytidine deaminase from Petromyzon marinus), for example, cytidine deaminase 1 (CDA1). Mutagenesis plasmids (also referred to as mutagenesis constructs) are described, for example by International Patent Application, PCT/US2016/027795, filed Apr. 16, 2016, published as WO2016/168631 on Oct. 20, 2016, the entire contents of which are incorporated herein by reference.


The term “nucleic acid,” as used herein, refers to a polymer of nucleotides. The polymer may include natural nucleosides (i.e., adenosine, thymidine, guano sine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine), nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 7-deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, 0(6)-methylguanine, 4-acetylcytidine, 5-(carboxyhydroxymethyl)uridine, dihydrouridine, methylpseudouridine, 1-methyl adenosine, 1-methyl guanosine, N6-methyl adenosine, and 2-thiocytidine), chemically modified bases, biologically modified bases (e.g., methylated bases), intercalated bases, modified sugars (e.g., 2′-fluororibose, ribose, 2′-deoxyribose, 2′-O-methylcytidine, arabinose, and hexose), or modified phosphate groups (e.g., phosphorothioates and 5′-N-phosphoramidite linkages).


The term “protein,” as used herein refers to a polymer of amino acid residues linked together by peptide bonds. The term, as used herein, refers to proteins, polypeptides, and peptide of any size, structure, or function. Typically, a protein will be at least three amino acids long. A protein may refer to an individual protein or a collection of proteins. Inventive proteins preferably contain only natural amino acids, although non-natural amino acids (i.e., compounds that do not occur in nature but that can be incorporated into a polypeptide chain; see, for example, cco.caltech.edu/˜dadgrp/Unnatstruct.gif, which displays structures of non-natural amino acids that have been successfully incorporated into functional ion channels) and/or amino acid analogs as are known in the art may alternatively be employed. Also, one or more of the amino acids in an inventive protein may be modified, for example, by the addition of a chemical entity such as a carbohydrate group, a hydroxyl group, a phosphate group, a farnesyl group, an isofarnesyl group, a fatty acid group, a linker for conjugation, functionalization, or other modification, etc. A protein may also be a single molecule or may be a multi-molecular complex. A protein may be just a fragment of a naturally occurring protein or peptide. A protein may be naturally occurring, recombinant, or synthetic, or any combination of these.


The term “gene of interest” or “gene to be evolved,” as used herein, refers to a nucleic acid construct comprising a nucleotide sequence encoding a gene product, e.g., an RNA or a protein, to be evolved in a continuous evolution process as provided herein. The term includes any variations of a gene of interest that are the result of a continuous evolution process according to methods provided herein. For example, in some embodiments, a gene of interest is a nucleic acid construct comprising a nucleotide sequence encoding an RNA or protein to be evolved, cloned into a viral vector, for example, a phage genome, so that the expression of the encoding sequence is under the control of one or more promoters in the viral genome. In other embodiments, a gene of interest is a nucleic acid construct comprising a nucleotide sequence encoding an RNA or protein to be evolved and a promoter operably linked to the encoding sequence. When cloned into a viral vector, for example, a phage genome, the expression of the encoding sequence of such genes of interest is under the control of the heterologous promoter and, in some embodiments, may also be influenced by one or more promoters comprised in the viral genome. In some embodiments, the term “gene of interest” or “gene to be evolved refers to a nucleic acid sequence encoding a gene product to be evolved, without any additional sequences. In some embodiments, the term also embraces additional sequences associated with the encoding sequence, such as, for example, intron, promoter, enhancer, or polyadenylation signal sequences.


The term “evolved protein,” as used herein, refers to a protein variant that is expressed by a gene of interest that has been subjected to continuous evolution, such as PACE.


The term “host cell,” as used herein, refers to a cell that can host, replicate, and transfer a phage vector useful for a continuous evolution process as provided herein. In embodiments where the vector is a viral vector, a suitable host cell is a cell that can be infected by the viral vector, can replicate it, and can package it into viral particles that can infect fresh host cells. A cell can host a viral vector if it supports expression of genes of viral vector, replication of the viral genome, and/or the generation of viral particles. One criterion to determine whether a cell is a suitable host cell for a given viral vector is to determine whether the cell can support the viral life cycle of a wild-type viral genome that the viral vector is derived from. For example, if the viral vector is a modified M13 phage genome, as provided in some embodiments described herein, then a suitable host cell would be any cell that can support the wild-type M13 phage life cycle. Suitable host cells for viral vectors useful in continuous evolution processes are well known to those of skill in the art, and the disclosure is not limited in this respect.





DETAILED DESCRIPTION

Aspects of the disclosure relate to compositions (e.g., isolated nucleic acids and vectors) and methods for improving the stability and/or solubility of proteins evolved using PACE. The disclosure is based, in part, on positive and negative selection systems that bias continuous evolution of a gene of interest towards production of evolved protein variants having desirable physiochemical characteristics, for example, increased solubility and/or stability (e.g., thermostability) relative to a gene product of the gene of interest, such as a gene product that has not been evolved (e.g., subjected to PACE). Without wishing to be bound by any particular theory, selection constructs and systems described herein generally function by linking a desired physiochemical characteristic or function of an evolved protein to expression of a gene required for the generation of infectious viral particles.


Selection System Constructs

Some aspects of this disclosure provide expression constructs encoding gene products that select for a desired physiochemical characteristic or desired function of an evolved protein in a host cell, e.g., in a bacterial host cell. In some embodiments, a selection system comprises one or more gene products encoded by a nucleic acid (e.g., an isolated nucleic acid). In some embodiments, one or more nucleic acids that are operably linked comprise an expression construct. Expression constructs are sometimes also referred to as vectors. In some embodiments, the expression constructs are plasmids.


In some embodiments, the plasmid comprises a bacterial origin of replication. In some embodiments, the origin of replication is a cloDF13 origin of replication. In some embodiments, the plasmid comprises a nucleic acid sequence encoding a gene product conferring resistance to an antibiotic to a bacterial host cell. In some embodiments, the antibiotic is chloramphenicol, kanamycin, tetracycline, or ampicillin.


A selection system can be a positive selection system, a negative selection system or a combination of one or more positive selection systems (e.g., 1, 2, 3, 4, 5, or more positive selection systems) and one or more negative selection systems (e.g., 1, 2, 3, 4, 5, or more negative selection systems). In some embodiments, a positive selection system links production (e.g., translation and/or function) of an evolved protein having a desired physiochemical characteristic (e.g., solubility, stability, etc.) and/or a desired function to expression of a gene required for production of infectious phage particles. In some embodiments, a negative selection system links production (e.g., translation and/or function) of an evolved protein having an undesired physiochemical characteristic (e.g., reduced solubility, reduced stability, etc.) and/or an undesired function to expression of a gene that prevents production of infectious phage particles (e.g., dominant negative pIII protein, such as pIII-neg). In the context of PACE, suitable negative selection strategies and reagents are described herein and in International PCT Application, PCT/US2009/056194, filed Sep. 8, 2009, published as WO 2010/028347 on Mar. 11, 2010; International PCT Application, PCT/US2011/066747, filed Dec. 22, 2011, published as WO 2012/088381 on Jun. 28, 2012; U.S. application, U.S. Ser. No. 13/922,812, filed Jun. 20, 2013; and U.S. application, U.S. Ser. No. 62/067,194, filed Oct. 22, 2014, the entire contents of each of which are incorporated herein by reference.


In some aspects, the disclosure relates to expression vectors (e.g., plasmids) comprising bacterial heat shock response regulatory element operably linked to a PACE negative selection system. In some embodiments, the expression vector is an accessory plasmid. Without wishing to be bound by any particular theory, expression of misfolded proteins in a PACE system comprising such a construct results in induction of the bacterial heat shock response, which in turn activates expression of the negative selection system. Examples of proteins involved in the bacterial heat shock response include but are not limited to sigma 32 (σ32), Heat Shock Protein 90 (HSP90), Heat Shock Protein 70 (HSP 70), DnaK, GroEL, etc. Examples of bacterial heat shock response regulatory elements include but are not limited to promoters, transcription factors, miRNA binding sites, etc. In some embodiments, the bacterial heat shock response regulatory element is a bacterial heat shock protein promoter. In some embodiments, the bacterial heat shock protein promoter is an E. coli sigma 32 (σ32) promoter. In some aspects, the σ32 promoter comprises a sequence set forth in SEQ ID NO: 1. However, the skilled artisan will appreciate that bacterial species from which the heat shock response regulatory elements are derived will depend upon the bacterial species into which PACE will be carried out.


In some embodiments, the bacterial heat shock protein regulatory element (e.g., promoter) is operably linked to a nucleic acid sequence that encodes a negative selection system. In some embodiments, the negative selection system is a nucleic acid (e.g. expression construct) that encodes a dominant negative gene III (pIII-neg), for example a pIII variant that comprises the two N-terminal domains of pIII and a truncated, termination-incompetent C-terminal domain is not only inactive but is a dominant-negative variant of pIII. A pIII variant comprising the two N-terminal domains of pIII and a truncated, termination-incompetent C-terminal domain was described in Bennett, N. J.; Rakonjac, J., Unlocking of the filamentous bacteriophage virion during infection is mediated by the C domain of pIII. Journal of Molecular Biology 2006, 356 (2), 266-73; the entire contents of which are incorporated herein by reference. In some embodiments, a pIII-neg variant as provided herein is efficiently incorporated into phage particles, but it does not catalyze the unlocking of the particle for entry during infection, rendering the respective phage noninfectious even if wild type pIII is present in the same phage particle. Accordingly, such pIII-neg variants are useful for devising a negative selection strategy in the context of PACE, for example, by providing an expression construct comprising a nucleic acid sequence encoding a pIII-neg variant under the control of a promoter comprising a recognition motif, the recognition of which is undesired (e.g., an E. coli σ32 promoter).


In some aspects, the disclosure relates to expression vectors (e.g., plasmids) comprising a gene of interest to be evolved fused to a sequence encoding a T7 RNA polymerase (RNAP) N-terminal domain. In some embodiments, the plasmid is a selection plasmid (e.g., selection phagemid). In some embodiments, the expression construct comprises a nucleic acid encoding the gene of interest is contiguous (e.g., operably linked) to the nucleic acid sequence encoding the T7 RNAP N-terminal domain. In some embodiments, the 3′-end of the nucleic acid encoding the gene of interest is contiguous (e.g., operably linked) to the 5′-end of the nucleic acid encoding the T7 RNAP N-terminal domain. In some embodiments, the expression construct further comprises a promoter, such as a PBADpromoter.


An N-terminal domain of a T7 RNAP may comprise between about 1% and about 99% (e.g., any percentage between 1% and 99%), about 10% and about 80%, or about 30% and about 60% of the amino acid residues of a full-length T7 RNAP (e.g., about 1% to about 99% of the amino acid residues of NCBI Accession No. NC_041960.1). In some embodiments, a T7 RNAP N-terminal domain comprises between 1 and 800 amino acid (e.g., any integer between 1 and 800, inclusive) truncations relative to the C-terminus of wild-type T7 RNAP (e.g., NCBI Accession No. NC_041960.1). For example, in some embodiments, an N-terminal domain of T7 RNAP comprises amino acid residues 1-50, 1-100, 1-150, 1-300, 1-400, 1-500, or 1-800 of NCBI Accession No. NC_041960.1.


In some aspects, the disclosure relates to expression vectors (e.g., plasmids) comprising an isolated nucleic acid having a sequence encoding a T7 RNA polymerase (RNAP) C-terminal domain. In some embodiments, the expression vector (e.g., plasmid) is an accessory plasmid. Without wishing to be bound by any particular theory, expression of a C-terminal domain of T7 RNAP in a cell (e.g., a host cell) in which a properly-folded fusion protein (e.g., comprising a gene of interest fused to a T7 RNAP N-terminal domain) is expressed, results in reconstitution of a functional T7 RNAP. A C-terminal domain of a T7 RNAP may comprise between about 1% and about 99% (e.g., any percentage between 1% and 99%), about 10% and about 80%, or about 30% and about 60% of the amino acid residues of a full-length T7 RNAP (e.g., about 1% to about 99% of the amino acid residues of NCBI Accession No. NC_041960.1). In some embodiments, a T7 RNAP C-terminal domain comprises between 1 and 800 amino acid (e.g., any integer between 1 and 800, inclusive) truncations relative to the N-terminus of wild-type T7 RNAP (e.g., NCBI Accession No. NC_041960.1). For example, in some embodiments, an N-terminal domain of T7 RNAP comprises amino acid residues 50-883, 100-883, 200-883, 400-884, or 500-883 of NCBI Accession No. NC_041960.1.


In some aspects, the disclosure relates to expression vectors (e.g., plasmids) comprising a gene of interest to be evolved fused to a sequence encoding a T7 RNA polymerase (RNAP) N-terminal domain further comprises a nucleic acid encoding a split intein portion (e.g., fragment). An “intein” refers to a protein that is able to self-catalytically excise itself and join the remaining protein fragments (e.g., exteins) by the process of protein splicing. Generally, the self-splicing function of inteins makes them useful tools for engineering trans-spliced recombinant proteins, as described in U.S. Publication No. 2003-0167533, the entire contents of which are incorporated herein by reference. For example, expressing (i) a nucleic acid sequence encoding a N-terminal intein fragment (or portion) operably linked to a nucleic acid encoding a first protein fragment (A) and (ii) a nucleic acid encoding a C-terminal intein fragment (or portion) operably linked to a nucleic acid encoding a second protein fragment (B), in a cell would result, in some embodiments, in trans-splicing of the inteins within the cell to produce a fusion molecule comprising (in the following order) “A-B”.


Inteins are present in both prokaryotic and eukaryotic organisms. In some embodiments, an intein is a bacterial intein, such as a cyanobacterial intein (e.g., intein from Synechocystis or Nostoc). In some embodiments, the intein is a Nostoc punctiforme (Npu) intein, for example as described in Oeemig et al. (2009) FEBS Lett. 583(9):1451-6.


In some embodiments, an expression construct described herein comprises a nucleic acid encoding a split intein portion (e.g., a split intein N-terminal portion or split intein C-terminal portion) operably linked to a nucleic acid encoding a gene required for the production of infectious phage particles, such as gIII protein (pIII protein), or a portion (e.g., fragment) thereof. In some embodiments, the split intein portion is a split intein C-terminal portion (e.g., a Npu split intein C-terminal portion). In some embodiments, the split intein C-terminal portion is positioned upstream of (e.g., 5′ relative to) the nucleic acid encoding the gene required for the production of infectious phage particles, or portion thereof. In some embodiments, the split intein portion is a split intein N-terminal portion (e.g., a Npu split intein N-terminal portion). In some embodiments, the split intein N-terminal portion is positioned downstream of (e.g., 3′ relative to) the nucleic acid encoding the gene required for the production of infectious phage particles, or portion thereof.


In some embodiments, the nucleic acid encoding a gene required for the production of infectious phage particles, such as gIII protein (pIII protein), is truncated (e.g., missing one or more nucleic acid bases relative to a full-length gene encoding pIII protein). In some embodiments, the nucleic acid is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more nucleic acid bases shorter than a full-length gene encoding pIII protein. It should be appreciated that the nucleic acid encoding truncated pIII protein may be truncated at either the 5′-end or the 3′-end. However, in preferred embodiments, the nucleic acid is truncated at the 5′-end. In some embodiments, the gene product encoded by the truncated nucleic acid lacks a full-length N-terminal signal peptide. In some embodiments, the gene product lacks amino acid residues 1-10 of a gIII protein signal peptide. In some embodiments, the gene product lacks amino acid residues 1-11, 1-12, 1-13, 1-14, 1-15, 1-16, 1-17, or 1-18 (e.g., the entire signal peptide) of pIII. In some embodiments, a portion of a pIII protein comprises the sequence set forth in SEQ ID NO: 8 (MKKLLPAIP). In some embodiments, a portion of a pIII protein comprises the sequence set forth in SEQ ID NO: 9.


In some embodiments, expression constructs (e.g., plasmids), or combinations of expression constructs (e.g. combinations of plasmids) described herein may be used as a bacterial 2-hybrid system to positively select for evolved proteins having desirable physiochemical characteristics (e.g., solubility, stability, etc.) or desirable function. In the context of PACE, bacterial 2-hybrid selections have been described, for example in International PCT Application, PCT/US2016/043559, filed Jul. 22, 2016, published as WO 2017/015559 on Jan. 26, 2017, and Badran et al. (2016) Nature 533:58-63, the entire contents of each of which are incorporated herein by reference.


In some embodiments, a bacterial 2-hybrid system comprises a first expression construct comprising a nucleic acid encoding a split intein C-terminal portion fused (e.g., operably linked) to a gene encoding a truncated gIII as described herein, and a second expression construct comprising a nucleic acid encoding a split intein N-terminal portion fused (e.g., operably linked) to a gene encoding a truncated gIII, where expression of the first expression construct and the second expression construct in a cell results in reconstitution (e.g., protein splicing) of a full-length functional pIII protein. In some embodiments, the first expression construct is operably linked to a promoter, such as a T7 RNAP promoter. In some embodiments, the first expression construct or the second expression construct further comprises a nucleic acid encoding a phage repressor protein, for example 434 cI repressor protein. In some embodiments, the first expression construct or the second expression construct is encodes a fusion protein comprising 434 cI repressor protein and the SH2 domain of an ABL1 kinase.


The first expression construct and the second expression construct can be located on the same vector (e.g., plasmid) or on separate vectors (e.g., different plasmids). In some embodiments, the vector is an accessory plasmid (AP). In some embodiments, a bacterial 2-hybrid system comprises a third expression construct comprising a nucleic acid encoding a gene of interest to be evolved (e.g., a HA4 monobody), T7 RNAP N-terminal domain, and an RNA polymerase subunit. In some embodiments, the RNA polymerase is RNA polymerase subunit omega (RpoZ). In some embodiments, the first expression construct, second expression construct, or third expression construct comprises a nucleic acid encoding a T7 RNAP C-terminal domain.


In some aspects, the disclosure relates to selection systems (e.g. comprising one or more vectors, such as plasmids) comprising an isolated nucleic acid encoding a heat shock chaperone protein (e.g., a bacterial heat shock protein), or a portion thereof, fused to a T7 RNAP N-terminal domain. In some embodiments, a heat shock chaperone protein is ibpA or ibpB, which are known in the art to associate with inclusion bodies, for example as described by Laskowska et al. (1996) Biochimie 78(2):117-22. Without wishing to be bound by any particular theory, expression of misfolded proteins in during PACE will result in the induction of heat shock response in the host cell, thereby sequestering ibpA or ibpB proteins fused to T7 N-terminal domain and preventing expression in pIII. The net result of such sequestration will be selection for properly folded evolved proteins. In some embodiments, a vector (e.g., plasmid) comprising a bacterial heat shock protein (e.g., ibpA, ibpB, etc.) is an accessory plasmid.


In some aspects, the disclosure provides expression constructs (e.g., plasmids) comprising an isolated nucleic acid encoding a leucine zipper domain of the yeast GCN4 transcription factor (“GCN4 tag”) fused upstream of the protein of interest to be evolved. In some embodiments the expression construct is a selection plasmid (SP). For example, using a split intein system described elsewhere in the disclosure, two simultaneous PACE selections are run: the first is a split T7 RNAP-based solubility selection, and the second is a protein binding selection with an accessory plasmid (AP) encoding the anti-GCN4 scFv m3, which recognizes the GCN4 tag. The T7 RNAP based solubility selection evolves for increased protein solubility, while the GCN4 tag protein binding selection prevents potential cheating in the same way as an activity-dependent selection. This greatly expands the scope of proteins compatible with the selection.


Some aspects of this invention provide a system for continuous evolution procedures, comprising of a viral vector, for example, a selection phage, comprising a multiple cloning site for insertion of a gene to be evolved, one or more additional accessory plasmids (e.g., comprising a selection system) as described herein, and, optionally, a mutagenesis expression construct. In some embodiments, a vector system for phage-based continuous directed evolution is provided that comprises (a) a selection phage comprising a multiple cloning site for insertion of a gene of interest to be evolved, wherein the phage genome is deficient in at least one gene required to generate infectious phage; (b) and at least one accessory plasmid comprising the at least one gene required to generate infectious phage particle under the control of a conditional promoter that is activated in response to a desired physiochemical characteristic (e.g., solubility, stability, etc.) and/or a desired activity of the gene to be evolved; and, optionally, (c) a mutagenesis expression construct as provided herein.


Some aspects of this disclosure provide a cell comprising an expression construct or a plasmid as provided herein. In some embodiments, the cell is a bacterial cell. In some embodiments, the cell further comprises a selection plasmid or an accessory plasmid. In some embodiments, the cell is a host cell for a bacteriophage. In some embodiments, the cell is an E. coli cell. In some embodiments, the cell is comprised in a lagoon.


Methods

In some aspects, the disclosure provides methods for directed evolution using one or more of the expression constructs described herein. In some embodiments, the method comprises (a) contacting a population of host cells comprising an expression construct or plasmid as provided herein with a population of phage vectors comprising a gene to be evolved and deficient in at least one gene for the generation of infectious phage particles, wherein (1) the host cells are amenable to transfer of the vector; (2) the vector allows for expression of the gene to be evolved in the host cell, can be replicated by the host cell, and the replicated vector can transfer into a second host cell; (3) the host cell expresses a gene product encoded by the at least one gene for the generation of infectious phage particles of (a) in response to a particular physiochemical characteristic (e.g., solubility, stability, etc.) and/or activity of the gene to be evolved, and the level of gene product expression depends on the physiochemical characteristic and/or activity of the gene to be evolved; (b) incubating the population of host cells under conditions allowing for selection of the gene to be evolved based upon the physiochemical characteristic and/or activity of the gene to be evolved and the transfer of the vector comprising the gene to be evolved from host cell to host cell, wherein host cells are removed from the host cell population, and the population of host cells is replenished with fresh host cells that comprise the expression construct but do not harbor the vector; and (c) isolating a replicated vector from the host cell population in (b), wherein the replicated vector comprises a mutated version of the gene to be evolved (e.g., an evolved protein).


In some embodiments, the expression construct comprises an inducible promoter, wherein the incubating of (b) comprises culturing the population of host cells under conditions suitable to induce expression from the inducible promoter. In some embodiments, the inducible promoter is an arabinose-inducible promoter, wherein the incubating of (b) comprises contacting the host cell with an amount of arabinose sufficient to increase expression of the arabinose-inducible promoter by at least 10-fold, at least 50-fold, at least 100-fold, at least 500-fold, at least 1000-fold, at least 5000-fold, at least 10000-fold, at least 50000-fold, at least 100000-fold, at least 500000-fold, or at least 1000000-fold as compared to basal expression in the absence of arabinose.


In some embodiments, the vector is a viral vector. In some embodiments, the viral vector is a phage. In some embodiments, the phage is a filamentous phage. In some embodiments, the phage is an M13 phage.


In some embodiments, the host cells comprise an accessory plasmid. In some embodiments, the accessory plasmid comprises an expression construct encoding the pIII protein under the control of a promoter that is activated by a gene product encoded by the gene to be evolved. In some embodiments, the host cells comprise the accessory plasmid and together, the helper phage and the accessory plasmid comprise all genes required for the generation of an infectious phage. In some embodiments, the method further comprises a negative selection for undesired activity of the gene to be evolved. In some embodiments, the host cells comprise an expression construct encoding a dominant-negative pIII protein (pIII-neg). In some embodiments, expression of the pIII-neg protein is driven by a promoter the activity of which depends on an undesired function of the gene to be evolved.


In some embodiments, step (b) comprises incubating the population of host cells for a time sufficient for at least 10, at least 20, at least 30, at least 40, at least 50, at least 100, at least 200, at least 300, at least 400, at least, 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1250, at least 1500, at least 1750, at least 2000, at least 2500, at least 3000, at least 4000, at least 5000, at least 7500, at least 10000, or more consecutive life cycles of the viral vector or phage. In some embodiments, the host cells are E. coli cells.


In some embodiments, the host cells are incubated in suspension culture. In some embodiments, the population of host cells is continuously replenished with fresh host cells that do not comprise the vector. In some embodiments, fresh cells are being replenished and cells are being removed from the cell population at a rate resulting in a substantially constant number of cells in the cell population. In some embodiments, fresh cells are being replenished and cells are being removed from the cell population at a rate resulting in a substantially constant vector population. In some embodiments, fresh cells are being replenished and cells are being removed from the cell population at a rate resulting in a substantially constant vector, viral, or phage load. In some embodiments, the rate of fresh cell replenishment and/or the rate of cell removal is adjusted based on quantifying the cells in the cell population. In some embodiments, the rate of fresh cell replenishment and/or the rate of cell removal is adjusted based on quantifying the frequency of host cells harboring the vector and/or of host cells not harboring the vector in the cell population. In some embodiments, the quantifying is by measuring the turbidity of the host cell culture, measuring the host cell density, measuring the wet weight of host cells per culture volume, or by measuring light extinction of the host cell culture.


In some embodiments, the host cells are exposed to a mutagen. In some embodiments, the mutagen is ionizing radiation, ultraviolet radiation, base analogs, deaminating agents (e.g., nitrous acid), intercalating agents (e.g., ethidium bromide), alkylating agents (e.g., ethylnitrosourea), transposons, bromine, azide salts, psoralen, benzene,3-Chloro-4-(dichloromethyl)-5-hydroxy-2(5H)-furanone (MX) (CAS no. 77439-76-0), O,O-dimethyl-S-(phthalimidomethyl)phosphorodithioate (phos-met) (CAS no. 732-11-6), formaldehyde (CAS no. 50-00-0), 2-(2-furyl)-3-(5-nitro-2-furyl)acrylamide (AF-2) (CAS no. 3688-53-7), glyoxal (CAS no. 107-22-2), 6-mercaptopurine (CAS no. 50-44-2), N-(trichloromethylthio)-4-cyclohexane-1,2-dicarboximide (captan) (CAS no. 133-06-2), 2-aminopurine (CAS no. 452-06-2), methyl methane sulfonate (MMS) (CAS No. 66-27-3), 4-nitroquinoline 1-oxide (4-NQO) (CAS No. 56-57-5), N4-Aminocytidine (CAS no. 57294-74-3), sodium azide (CAS no. 26628-22-8), N-ethyl-N-nitrosourea (ENU) (CAS no. 759-73-9), N-methyl-N-nitrosourea (MNU) (CAS no. 820-60-0), 5-azacytidine (CAS no. 320-67-2), cumene hydroperoxide (CHP) (CAS no. 80-15-9), ethyl methanesulfonate (EMS) (CAS no. 62-50-0), N-ethyl-N -nitro-N-nitrosoguanidine (ENNG) (CAS no. 4245-77-6), N-methyl-N -nitro-N-nitrosoguanidine (MNNG) (CAS no. 70-25-7), 5-diazouracil (CAS no. 2435-76-9), or t-butyl hydroperoxide (BHP) (CAS no. 75-91-2).


In some embodiments, the vector or phage encoding the gene to be evolved is a filamentous phage, for example, an M13 phage, such as an M13 selection phage as described in more detail elsewhere herein. In some embodiments, the host cells are cells amenable to infection by the filamentous phage, e.g., by M13 phage, such as, for example, E. coli cells. In some such embodiments, the gene required for the production of infectious viral particles is the M13 gene III (gIII) encoding the M13 protein III (pIII).


Typically, the vector/host cell combination is chosen in which the life cycle of the vector is significantly shorter than the average time between cell divisions of the host cell. Average cell division times and vector life cycle times are well known in the art for many cell types and vectors, allowing those of skill in the art to ascertain such host cell/vector combinations. In certain embodiments, host cells are being removed from the population of host cells in which the vector replicates at a rate that results in the average time of a host cell remaining in the host cell population before being removed to be shorter than the average time between cell divisions of the host cells, but to be longer than the average life cycle of the viral vector employed. The result of this is that the host cells, on average, do not have sufficient time to proliferate during their time in the host cell population while the viral vectors do have sufficient time to infect a host cell, replicate in the host cell, and generate new viral particles during the time a host cell remains in the cell population. This assures that the only replicating nucleic acid in the host cell population is the vector encoding the gene to be evolved, and that the host cell genome, the accessory plasmid, or any other nucleic acid constructs cannot acquire mutations allowing for escape from the selective pressure imposed.


For example, in some embodiments, the average time a host cell remains in the host cell population is about 10, about 1l, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 2l, about 22, about 23, about 24, about 25, about 30, about 35, about 40, about 45, about 50, about 55, about 60, about 70, about 80, about 90, about 100, about 120, about 150, or about 180 minutes.


In some embodiments, the average time a host cell remains in the host cell population depends on how fast the host cells divide and how long infection (or conjugation) requires. In general, the flow rate should be faster than the average time required for cell division, but slow enough to allow viral (or conjugative) propagation. The former will vary, for example, with the media type, and can be delayed by adding cell division inhibitor antibiotics (FtsZ inhibitors in E. coli, etc.). Since the limiting step in continuous evolution is production of the protein required for gene transfer from cell to cell, the flow rate at which the vector washes out will depend on the current activity of the gene(s) of interest. In some embodiments, titrable production of the protein required for the generation of infectious particles, as described herein, can mitigate this problem. In some embodiments, an indicator of phage infection allows computer-controlled optimization of the flow rate for the current activity level in real-time.


In some embodiments, a PACE experiment according to methods provided herein is run for a time sufficient for at least 10, at least 20, at least 30, at least 40, at least 50, at least 100, at least 200, at least 300, at least 400, at least, 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1250, at least 1500, at least 1750, at least 2000, at least 2500, at least 3000, at least 4000, at least 5000, at least 7500, at least 10000, or more consecutive viral life cycles. In certain embodiments, the viral vector is an M13 phage, and the length of a single viral life cycle is about 10-20 minutes.


In some embodiments, the host cells are contacted with the vector and/or incubated in suspension culture. For example, in some embodiments, bacterial cells are incubated in suspension culture in liquid culture media. Suitable culture media for bacterial suspension culture will be apparent to those of skill in the art, and the invention is not limited in this regard. See, for example, Molecular Cloning: A Laboratory Manual, 2nd Ed., ed. by Sambrook, Fritsch, and Maniatis (Cold Spring Harbor Laboratory Press: 1989); Elizabeth Kutter and Alexander Sulakvelidze: Bacteriophages: Biology and Applications. CRC Press; 1st edition (December 2004), ISBN: 0849313368; Martha R. J. Clokie and Andrew M. Kropinski: Bacteriophages: Methods and Protocols, Volume 1: Isolation, Characterization, and Interactions (Methods in Molecular Biology) Humana Press; 1st edition (December, 2008), ISBN: 1588296822; Martha R. J. Clokie and Andrew M. Kropinski: Bacteriophages: Methods and Protocols, Volume 2: Molecular and Applied Aspects (Methods in Molecular Biology) Humana Press; 1st edition (December 2008), ISBN: 1603275649; all of which are incorporated herein in their entirety by reference for disclosure of suitable culture media for bacterial host cell culture).


Suspension culture typically requires the culture media to be agitated, either continuously or intermittently. This is achieved, in some embodiments, by agitating or stirring the vessel comprising the host cell population. In some embodiments, the outflow of host cells and the inflow of fresh host cells is sufficient to maintain the host cells in suspension. This in particular, if the flow rate of cells into and/or out of the lagoon is high.


In some embodiments, the flow of cells through the lagoon is regulated to result in an essentially constant number of host cells within the lagoon. In some embodiments, the flow of cells through the lagoon is regulated to result in an essentially constant number of fresh host cells within the lagoon. Typically, the lagoon will hold host cells in liquid media, for example, cells in suspension in a culture media. However, lagoons in which adherent host cells are cultured on a solid support, such as on beads, membranes, or appropriate cell culture surfaces are also envisioned. The lagoon may comprise additional features, such as a stirrer or agitator for stirring or agitating the culture media, a cell densitometer for measuring cell density in the lagoon, one or more pumps for pumping fresh host cells into the culture vessel and/or for removing host cells from the culture vessel, a thermometer and/or thermocontroller for adjusting the culture temperature, as well as sensors for measuring pH, osmolarity, oxygenation, and other parameters of the culture media. The lagoon may also comprise an inflow connected to a holding vessel comprising a mutagen or a transcriptional inducer of a conditional gene expression system, such as the arabinose-inducible expression system of the mutagenesis plasmid described in more detail elsewhere herein.


In some embodiments, the host cell population is continuously replenished with fresh, uninfected host cells. In some embodiments, this is accomplished by a steady stream of fresh host cells into the population of host cells. In other embodiments, however, the inflow of fresh host cells into the lagoon is semi-continuous or intermittent (e.g., batch-fed). In some embodiments, the rate of fresh host cell inflow into the cell population is such that the rate of removal of cells from the host cell population is compensated. In some embodiments, the result of this cell flow compensation is that the number of cells in the cell population is substantially constant over the time of the continuous evolution procedure. In some embodiments, the portion of fresh, uninfected cells in the cell population is substantially constant over the time of the continuous evolution procedure. For example, in some embodiments, about 10%, about 15%, about 20%, about 25%, about 30%, about 40%, about 50%, about 60%, about 70%, about 75%, about 80%, or about 90% of the cells in the host cell population are not infected by virus. In general, the faster the flow rate of host cells is, the smaller the portion of cells in the host cell population that are infected will be. However, faster flow rates allow for more transfer cycles, e.g., viral life cycles, and, thus, for more generations of evolved vectors in a given period of time, while slower flow rates result in a larger portion of infected host cells in the host cell population and therefore a larger library size at the cost of slower evolution. In some embodiments, the range of effective flow rates is invariably bounded by the cell division time on the slow end and vector washout on the high end In some embodiments, the viral load, for example, as measured in infectious viral particles per volume of cell culture media is substantially constant over the time of the continuous evolution procedure.


The PACE methods provided herein are typically carried out in a lagoon. Suitable lagoons and other laboratory equipment for carrying out PACE methods as provided herein have been described in detail elsewhere. See, for example, International PCT Application, PCT/US2011/066747, published as WO2012/088381 on Jun. 28, 2012, the entire contents of which are incorporated herein by reference. In some embodiments, the lagoon comprises a cell culture vessel comprising an actively replicating population of vectors, for example, phage vectors comprising a gene of interest, and a population of host cells, for example, bacterial host cells. In some embodiments, the lagoon comprises an inflow for the introduction of fresh host cells into the lagoon and an outflow for the removal of host cells from the lagoon. In some embodiments, the inflow is connected to a turbidostat comprising a culture of fresh host cells. In some embodiments, the outflow is connected to a waste vessel, or a sink. In some embodiments, the lagoon further comprises an inflow for the introduction of a mutagen into the lagoon. In some embodiments that inflow is connected to a vessel holding a solution of the mutagen. In some embodiments, the lagoon comprises an inflow for the introduction of an inducer of gene expression into the lagoon, for example, of an inducer activating an inducible promoter within the host cells that drives expression of a gene promoting mutagenesis (e.g., as part of a mutagenesis plasmid), as described in more detail elsewhere herein. In some embodiments, that inflow is connected to a vessel comprising a solution of the inducer, for example, a solution of arabinose.


In some embodiments, the lagoon comprises a controller for regulation of the inflow and outflow rates of the host cells, the inflow of the mutagen, and/or the inflow of the inducer. In some embodiments, a visual indicator of phage presence, for example, a fluorescent marker, is tracked and used to govern the flow rate, keeping the total infected population constant. In some embodiments, the visual marker is a fluorescent protein encoded by the phage genome, or an enzyme encoded by the phage genome that, once expressed in the host cells, results in a visually detectable change in the host cells. In some embodiments, the visual tracking of infected cells is used to adjust a flow rate to keep the system flowing as fast as possible without risk of vector washout.


In some embodiments, the controller regulates the rate of inflow of fresh host cells into the lagoon to be substantially the same (volume/volume) as the rate of outflow from the lagoon. In some embodiments, the rate of inflow of fresh host cells into and/or the rate of outflow of host cells from the lagoon is regulated to be substantially constant over the time of a continuous evolution experiment. In some embodiments, the rate of inflow and/or the rate of outflow is from about 0.1 lagoon volumes per hour to about 25 lagoon volumes per hour. In some embodiments, the rate of inflow and/or the rate of outflow is approximately 0.1 lagoon volumes per hour (lv/h), approximately 0.2 lv/h, approximately 0.25 lv/h, approximately 0.3 lv/h, approximately 0.4 lv/h, approximately 0.5 lv/h, approximately 0.6 lv/h, approximately 0.7 lv/h, approximately 0.75 lv/h, approximately 0.8 lv/h, approximately 0.9 lv/h, approximately 1 lv/h, approximately 2 lv/h, approximately 2.5 lv/h, approximately 3 lv/h, approximately 4 lv/h, approximately 5 lv/h, approximately 7.5 lv/h, approximately 10 lv/h, or more than 10 lv/h.


In some embodiments, the inflow and outflow rates are controlled based on a quantitative assessment of the population of host cells in the lagoon, for example, by measuring the cell number, cell density, wet biomass weight per volume, turbidity, or cell growth rate. In some embodiments, the lagoon inflow and/or outflow rate is controlled to maintain a host cell density of from about 102 cells/ml to about 1012 cells/ml in the lagoon. In some embodiments, the inflow and/or outflow rate is controlled to maintain a host cell density of about 102 cells/ml, about 103 cells/ml, about 104 cells/ml, about 105 cells/ml, about 5×105 cells/ml, about 106 cells/ml, about 5×106 cells/ml, about 107 cells/ml, about 5×107 cells/ml, about 108 cells/ml, about 5×108 cells/ml, about 109 cells/ml, about 5×109 cells/ml, about 1010 cells/ml, about 5×1010 cells/ml, or more than 5×1010 cells/ml, in the lagoon. In some embodiments, the density of fresh host cells in the turbidostat and the density of host cells in the lagoon are substantially identical.


In some embodiments, the lagoon inflow and outflow rates are controlled to maintain a substantially constant number of host cells in the lagoon. In some embodiments, the inflow and outflow rates are controlled to maintain a substantially constant frequency of fresh host cells in the lagoon. In some embodiments, the population of host cells is continuously replenished with fresh host cells that are not infected by the phage. In some embodiments, the replenishment is semi-continuous or by batch-feeding fresh cells into the cell population.


In some embodiments, the lagoon volume is from approximately 1 ml to approximately 100 l, for example, the lagoon volume is approximately 1 ml, approximately 10 ml, approximately 50 ml, approximately 100 ml, approximately 200 ml, approximately 250 ml, approximately 500 ml, approximately 750 ml, approximately 1 l, approximately 2 l, approximately 2.5 l, approximately 3 l, approximately 4 l, approximately 5 l, approximately 10 l, approximately 20 l, approximately 50 l, approximately 75 l, approximately 100 l, approximately 1 ml-10 ml, approximately 10 ml-50 ml, approximately 50 ml-100 ml, approximately 100 ml-250 ml, approximately 250 ml-500 ml, approximately 500 ml-1 l, approximately 1 l-2 l, approximately 2l-5 l, approximately 5l-10 l, approximately 10l-50 l, approximately 50 l-100 l, or more than 100 l.


In some embodiments, the lagoon and/or the turbidostat further comprises a heater and a thermostat controlling the temperature. In some embodiments, the temperature in the lagoon and/or the turbidostat is controlled to be from about 4° C. to about 55° C., preferably from about 25° C. to about 39° C., for example, about 37° C.


In some embodiments, the inflow rate and/or the outflow rate is controlled to allow for the incubation and replenishment of the population of host cells for a time sufficient for at least 10, at least 20, at least 30, at least 40, at least 50, at least 100, at least 200, at least 300, at least 400, at least, 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1250, at least 1500, at least 1750, at least 2000, at least 2500, at least 3000, at least 4000, at least 5000, at least 7500, at least 10000, or more consecutive vector or phage life cycles. In some embodiments, the time sufficient for one phage life cycle is about 10, 15, 20, 25, or 30 minutes.


Therefore, in some embodiments, the time of the entire evolution procedure is about 12 hours, about 18 hours, about 24 hours, about 36 hours, about 48 hours, about 50 hours, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 10 days, about two weeks, about 3 weeks, about 4 weeks, or about 5 weeks.


In some embodiments, a PACE method as provided herein is performed in a suitable apparatus as described herein. For example, in some embodiments, the apparatus comprises a lagoon that is connected to a turbidostat comprising a host cell as described herein. In some embodiments, the host cell is an E. coli host cell. In some embodiments, the host cell comprises a mutagenesis expression construct as provided herein, an accessory plasmid as described herein, and, optionally, a helper plasmid as described herein, or any combination thereof. In some embodiments, the lagoon further comprises a selection phage as described herein, for example, a selection phage encoding a gene of interest. In some embodiments, the lagoon is connected to a vessel comprising an inducer for a mutagenesis plasmid, for example, arabinose. In some embodiments, the host cells are E. coli cells comprising the F′ plasmid, for example, cells of the genotype F′proA+B+ Δ(lacIZY) zzf::Tn10(TetR)/endA1 recA1 galE15 galK16 nupG rpsL ΔlacIZYA araD139 Δ(ara,leu)7697 mcrA Δ(mrr-hsdRMS-mcrBC) proBA::pir116λ−.


For example, in some embodiments, a PACE method as provided herein is carried out in an apparatus comprising a lagoon of about 100 ml, or about 1 l volume, wherein the lagoon is connected to a turbidostat of about 0.5 l, 1 l, or 3 l volume, and to a vessel comprising an inducer for a mutagenesis plasmid, for example, arabinose, wherein the lagoon and the turbidostat comprise a suspension culture of E. coli cells at a concentration of about 5×108 cells/ml. In some embodiments, the flow of cells through the lagoon is regulated to about 3 lagoon volumes per hour. In some embodiments, cells are removed from the lagoon by continuous pumping, for example, by using a waste needle set at a height of the lagoon vessel that corresponds to a desired volume of fluid (e.g., about 100 ml, in the lagoon. In some embodiments, the host cells are E. coli cells comprising the F′ plasmid, for example, cells of the genotype F′proA+B+Δ(lacIZY) zzf::Tn10(TetR)/endA1 recA1 galE15 galK16 nupG rpsL ΔlacIZYA araD139 Δ(ara,leu)7697 mcrA Δ(mrr-hsdRMS-mcrBC) proBA::pir116 λ−.


Host Cells

Some aspects of this invention relate to host cells for continuous evolution processes as described herein. In some embodiments, a host cell is provided that comprises a mutagenesis expression construct as provided herein. In some embodiments, the host cell further comprises additional plasmids or constructs for carrying out a PACE process, e.g., a selection system comprising at least one viral gene encoding a protein required for the generation of infectious viral particles under the control of a conditional promoter the activity of which depends on a desired function of a gene to be evolved. For example, some embodiments provide host cells for phage-assisted continuous evolution processes, wherein the host cell comprises an accessory plasmid comprising a gene required for the generation of infectious phage particles, for example, M13 gIII, under the control of a conditional promoter, as described herein. In some embodiments, the host cell further provides any phage functions that are not contained in the selection phage, e.g., in the form of a helper phage. In some embodiments, the host cell provided further comprises one or more expression constructs (e.g., 1, 2, 3, 4, 5, or more accessory plasmids) comprising a selection system as described herein.


In some embodiments, the host cell is a prokaryotic cell, for example, a bacterial cell. In some embodiments, the host cell is an E. coli cell. In some embodiments, the host cell is a eukaryotic cell, for example, a yeast cell, an insect cell, or a mammalian cell. The type of host cell, will, of course, depend on the viral vector employed, and suitable host cell/viral vector combinations will be readily apparent to those of skill in the art.


In some embodiments, the viral vector is a phage and the host cell is a bacterial cell. In some embodiments, the host cell is an E. coli cell. Suitable E. coli host strains will be apparent to those of skill in the art, and include, but are not limited to, New England Biolabs (NEB) Turbo, Top10F′, DH12S, ER2738, ER2267, and XL1-Blue MRF′. These strain names are art recognized and the genotype of these strains has been well characterized. It should be understood that the above strains are exemplary only and that the invention is not limited in this respect.


In some PACE embodiments, for example, in embodiments employing an M13 selection phage, the host cells are E. coli cells expressing the Fertility factor, also commonly referred to as the F factor, sex factor, or F-plasmid. The F-factor is a bacterial DNA sequence that allows a bacterium to produce a sex pilus necessary for conjugation and is essential for the infection of E. coli cells with certain phage, for example, with M13 phage. For example, in some embodiments, the host cells for M13-PACE are of the genotype F′proA+B+Δ(lacIZY) zzf::Tn10(TetR)/endA1 recA1 galE15 galK16 nupG rpsL ΔlacIZYA araD139 Δ(ara,leu)7697 mcrA Δ(mrr-hsdRMS-mcrBC) proBA::pir116 λ.


In some embodiments, a PACE apparatus is provided, comprising a lagoon that is connected to a turbidostat comprising a host cell as described herein. In some embodiments, the host cell is an E. coli host cell. In some embodiments, the host cell comprises one or more accessory plasmids as described herein (e.g., 1, 2, 3, 4, 5, or more accessory plasmids), and optionally, a helper plasmid as described herein or a mutagenesis plasmid as described herein, or any combination thereof. In some embodiments, the lagoon further comprises a selection phage as described herein, for example, a selection phage encoding a gene of interest. In some embodiments, the lagoon is connected to a vessel comprising an inducer for a mutagenesis plasmid, for example, arabinose. In some embodiments, the host cells are E. coli cells comprising the F′ plasmid, for example, cells of the genotype F′proA+B+Δ(lacIZY) zzf::Tn10(TetR)/endA1 recA1 galE15 galK16 nupG rpsL ΔlacIZYA araD139 Δ(ara,leu)7697 mcrA Δ(mrr-hsdRMS-mcrBC) proBA::pir116 λ−.


EXAMPLES
Example 1
Strategies for Evolving Protein Stability
σ32 Reporter Strategy

σ32 is a E. coli alternate sigma factor that controls the heat shock response. Under normal growth conditions, σ32 is inactivated by binding to cellular chaperones such as DnaK and GroEL. Upon accumulation of misfolded proteins, however, the chaperones are titrated away and σ32 is released to transcribe heat shock genes. This example describes a constructs (e.g., accessory plasmids, “APs”) linking a σ32-specific promoter to gene III-neg in PACE to allow for selection against unstable proteins, as shown in FIG. 1A.


Initial tests used either wt maltose-binding protein (MBP) or a mutant with impaired folding, MalE31, which are mainly expressed in the soluble or insoluble fraction of cell lysates, respectively, as shown in FIG. 1B. Unfortunately, σ32 promoter-based reporters did not differentiate between expression of MBP vs. MalE31 (FIGS. 3A-3C).


Using a dnaK KO strain w/dnaKJ under pBAD, a response of σ32 promoters to dnaKJ induction was observed (FIGS. 2A-2C); minimal differentiation was still observed after induction of MBP/MalE31 synthesis (FIG. 4).


Split T7 RNAP Complementation

The overall folding of a fusion protein can be strongly affected by the stability of the N-terminal component. This example describes fusing a protein to be evolved to the N-terminal fragment of a split T7 RNA polymerase, which results in poorly stable proteins inducing misfolding of the fusion construct, thus preventing the T7 RNAP N-terminal fragment to recombine with the C-terminal fragment of T7 and providing a way to select for protein stability (FIG. 5).


A split T7 RNAP fragment (e.g., Voigt T7 RNA polymerase (RNAP) or Split T7 RNAP) or was fused to either MBP (wt) or folding impaired mutant MalE31. The fusions were then evaluated for transcriptional activity through assembling with the other T7 RNAP fragment (FIG. 6A and FIG. 6B). MBP point mutants show the relationship between T7 RNAP complementation and protein stability (ΔΔG), as shown in FIGS. 7A and 7B.


In summary, two strategies for evolving protein stability through PACE are described in this example. The first, is based on the E coli heat shock sigma factor. The second strategy, based on complementation of a split T7 RNA polymerase, has yielded some promising early results, and has displayed the ability to discriminate between proteins of differing stability.


The split T7 polymerase selection system was tested with a different set of proteins with known stabilities (Colicin immunity protein Im7), and attenuated sensitivity was observed, probably due to fusion protein size (Im7˜10 kDa vs. MBP ˜40 kDa). Supporting this, the fusion using the smaller T7 RNAP fragment (“Voigt T7 RNAP”) was more sensitive to Im7 stability (FIG. 8A and FIG. 8B).


MBP/MalE31 split T7 complementation constructs were moved into phage/accessory plasmids (AP). Mock PACE competition experiments with a 1000:1 starting ratio of MalE31 to MBP encoding-selection phagemids (SP) shows enrichment of MBP containing the SPs; however, wild-type contamination was also observed (FIG. 9).


Development of a PACE selection for protein stability based on complementation of a split T7 RNA polymerase has continued. Fusions involving MBP variants showed that the system was able to discriminate between unstable and stable variants. An alternate set of proteins (Im7 variants) with previously measured stabilities were tested in the system. Although the general trend of the more stable protein fusion giving higher T7 RNAP transcriptional activity was observed, the sensitivity of the system was greatly attenuated, likely due to the much smaller size of Im7 vs. MBP. Preliminary mock PACE competition experiments confirm the ability of SP encoding well-folded MBP to enrich over SP encoding poorly folded MalE31.


A PACE experiment with SP encoding the MalE31 folding mutant (G32D/I33P) was run to investigate if stabilizing mutations could be observed. Two identical PACE lagoons were set up (L1 and L2); L2 washed out (FIG. 10B), but L1 began recovering after ˜60 h (FIG. 10A); some mutations were observed starting at 87 h, as shown in Table 1. The PACE experiment appears to have a low overall mutation rate, indicating that selection pressure is not high. Running the 87 h aliquot in an additional 96 hours of PACE resulted in no new consensus mutations.











TABLE 1






MalE31
T7 N-term






















87-1
P33T
V76I
A167V

V373I

L39F


87-2
P33T


T275I





87-3
P33S




A386E



87-4
P33T









PACE evolved MalE31 variants were characterized using a Luciferase reporter system. As shown in FIG. 11, increased luminescence was observed for several MalE31 variants, indicating the presence of beneficial mutations. Expression of MalE31 variants in soluble and insoluble cell lysate fractions was also investigated. Increased expression of MalE31 variants was observed in the soluble cell lysate fraction, as shown in FIG. 12. Melting temperature of MalE31 variants was also investigated. Representative data are shown in FIG. 13 and Table 2.















TABLE 2







87-3
87-2
87-1
MalE31
MBP





















Tm a
51° C.
55° C.
60° C.
58° C.
61° C.


ΔΔG b
+1.2
+0.3
+4.7
+6.9
0.0






a Melt temperature




b Calculated by fitting to the 2-state model, assuming specific heat capacity of 6.9 kcal/K g (Novokhatny and Ingham, Protein Sci 1997, p. 141) for all variants.







Equilibrium urea denaturing by tryptophan fluorescence of MalE31 variants was also measured, as shown in FIG. 14 and Table 3.















TABLE 3







87-3
87-2
87-1
MalE31
MBP























Cm a
1.6M
2.0M
2.8M
2.25M
2.9M



ΔΔG b
+3.4
+2.2
+0.08
+1.6
0.0








a Urea concentration at midpoint of unfolding





b Calculated as a product of Cm and the average slope of ΔG (calculated by 2-state model) vs. [urea].







Initial studies using Cry1 Ac/T7 N-terminal fusions in the split T7 complementation assay were performed. The initial assay uses the exact same format as the MBP/MalE31 system (e.g., the same linkers, T7 C-term induction level, etc.). No differentiation between the mutant and wild-type Cry1Ac were observed in initial experiments. However, the Cry1Ac mutant is not nearly as destabilized vs. wild-type as MalE31 is relative to MBP. It was observed that both Cry1Ac fusions exhibit markedly lower luminescence signal, likely due to larger size relative to MBP (FIG. 15).


In summary, the split T7 RNAP complementation based selection for protein stability has been applied to evolving the MBP G32D/I33P folding mutant (MalE31) in PACE. Mutations occurred primarily at P33, which has previously been identified as the major factor responsible for MalE31 aggregation. The resulting variants exhibited improvements in the luciferase reporter assay and in solubility when expressed. Two variants (87-1 and 87-2) exhibited lower Tm and Cm compared to MalE31, while the third (87-3) was improved over MalE31 (FIGS. 16A-16B).


Example 2
Analysis of Other MBP Variants

Analysis of expression of other MBP variants suggests that the split T7 complementation system is selecting for soluble protein expression. This example describes development of new APs to increase selection stringency.


Mutations in T7 RNAP that have been previously shown to decrease transcriptional activity were observed, as shown in FIG. 17A and 17B. This indicates occurrence of premature stop codon enrichment resulting in translational of the downstream T7 RNAP N-term unburdened by fusion protein, as shown in FIG. 18. For example, PACE on APs containing T7 R632S mutation resulted in enrichment of frameshift mutations resulting in premature stop codons.


Translational re-initiation is inefficient, but may be compensated for through strong induction, as shown in FIG. 19.


Example 3
Development of a Dual Selection System to Prevent Premature Stop Enrichment by Requiring Presence of Functional Fusion Protein

One way to prevent enrichment of premature stop codons is to simultaneously select for protein of interest (POI) activity and proper protein folding. In this embodiment, the PACE selection system is arranged such that both POI activity and protein solubility are required before PIII is made.


PIII is localized to the membrane by recognition of an N-terminal signal peptide. The signal peptide was split in two non-functional halves and fused the N- and C-terminal portions of the Npu split intein to create an “and gate” that requires both intein/g3p fusions to be produced in order to produce infectious phage (FIG. 20). For example, in the context of H4A monobody PACE using this selection system, both HA4 monobody binding to SH2/434-cI and active T7 RNAP N-term are required for plaque formation (FIG. 21). Note that a premature stop would result in the RNA polymerase subunit omega (rpoZ) and the HA4 monobody no longer being operatively connected, thus failing the 2-hybrid circuit.


In summary, the N-terminal fragment of a split T7 RNAP was fused to maltose binding protein (MBP) mutants with various known stabilities. The fusions were then evaluated for transcriptional activity through assembling with the other T7 RNAP fragment, and demonstrated a correlation between T7 RNAP transcriptional activity and fusion protein stability. The poorly folding MalE31 folding mutant (G32D/I33P) was evolved in PACE and a consensus mutations at P33 were observed. However, the evolved MBP variants were not significantly thermodynamically stabilized vs. MalE31, but appeared to have greater solubility. Further PACE experiments produced no new consensus mutations, but increasing stringency only resulted in frameshift mutations allowing for translational re-initiation at T7 RNAP N-term (FIG. 23). To address this, a system for dual PACE selection was developed based off pIII split intein.


Example 4
Protease Co-Expression with Cry1Ac wt/C03 Mutant

Co-expression of a protease that is expressible in host cells and preferentially degrades the Cry1Ac C03 mutant was investigated. Proteases were chosen for precedence for expression in E coli and for broad substrate scope. Proteases expression was co-induced with Cry1Ac expression in cells, which were then lysed and probed for Cry1Ac by western blot (to N-terminal 6×His tag), as shown in FIG. 22.


Plasmids expressing trypsin that are tolerated by the host strain have been cloned. SP expressing rpoZ fused to either Cry1Ac C03 or C03 reversion (D384Y/S404C) were also cloned and propagated on 2-hybrid (2-H) AP in the presence of increasing protease expression from Prha (which express the proteases hs1VU or bovine trypsin from a rhamnose promoter (Prha)). It was observed that hs1VU expression did not differentiate between C03 and C03 reversion. Trypsin expression results are shown in Table 4 and indicate a difference in affinity of the C03 mutant and reversion for the bait. The tryptic core (tc) fragments of Cry1Ac have also been cloned and tested with the T7 selection system.











TABLE 4





[rhamnose],




mM
C03; # plaques @ dilution
reversion

















0
7 @ 108
11 @ 108 


1
6 @ 108
1 @ 108


10
2 @ 106
7 @ 104









Example 5
Optimized Dual PACE Selection

Validation of dual PACE selection with HA4 Y84A monobody was investigated. A SP comprising the Y84A mutation, which ablates HA4 monobody binding to SH2 domain of Abl1 kinase, was produced. This SP is active on the T7 AP, but not on the 2-hybrid AP (FIG. 24A). Overall the ON propagation on this AP combo is ˜105 fold lower than the wt HA4 monobody. Results from two PACE lagoons are shown in FIGS. 24B and 24C, which show the titers of phage in this PACE experiment. While L2 phage washed out (shown in FIG. 24C), L1 phage (shown in FIG. 24B) found the mutations shown in Table 5. L1 mutations at 122 h are extremely convergent, as shown in Table 5.












TABLE 5






HA4 Y84A
T7n
rpoZ
























1
V14
A82E
A84M
K70N
Q103K
S127R
L29
L57



2
V14
A82E
A84M
K70N
Q103K
S127R
L29
L57



3
V14
A82E
A84M
K70N
Q103K
S127R
L29
L57



4
V14
A82E
A84M
K70N
Q103K
S127R
L29
L57



5
V14
A82E
A84M
K70N
Q103K
S127R
L29
L57



6
V14
A82E
A84M
K70N
Q103K
S127R
L29
L57
L67fs


7
V14
A82E
A84M
K70N
Q103K
S127R
L29
L57



8
V14
A82E
A84M
K70N
Q103K
S127R
L29
L57









Dual PACE selection was also applied to protein solubility. Several related scFvs bind the yeast tf GCN4 leucine zipper. Reported clones L34Ser, Ωgraft, and m3 exhibit increasing degrees of solubility, with m3 reported to exist mostly in soluble form in E coli cytosol. Propagation assays using dual selection APs show selectivity only on the T7 end, as shown in FIGS. 25A-25C.


Example 6
Development of Alternative, Non-Fusion Based Solubility Selection

A split T7 complementation system generally works in the case where a sandwich fusion can be made where T7 N-terminus is in the middle. This example describes identification of a more general selection system.


The small chaperones ibpA and ibpB are known to associate with inclusion bodies. For example, ibpA-fluorescent protein fusions have been used to image inclusion bodies in E coli. Here, ibpA or ibpB was fused with T7 N-terminus for split T7 RNAP complementation. In this PACE selection system, upon formation of inclusions bodies, ibpA/B is sequestered, preventing transcription of PT7-gIII. This reporter was tested in 3 different cell types (clpB works with dnaK to solubilize inclusion bodies) under the following conditions:

    • AP: T7 C-term driven by PBAD
    • Plasmid 1 (ColE1): ibpA/ibpB T7 N-term fusion driven by Ptet
    • Plasmid 2 (CloDF13): MBP or MalE31 driven by PBAD


Representative data are shown in FIG. 26A and FIG. 26B. It was observed that this selection system is heavily dependent on the amount of protein of interest (POI) induced, and also the kinetics of POI vs. ibpA/B synthesis.


Example 7
Validation of PACE Selection for Protein Solubility

Several related scFvs bind the yeast transcription factor (tf) GCN4 leucine zipper. It has been observed that clones L34Ser, Ωgraft, and m3 exhibit increasing degrees of solubility, with m3 reported to exist mostly in soluble form in E. coli cytosol. Propagation assays using dual selection APs show selectivity only on the T7 end, as shown in FIGS. 27A-27C.


PACE of Ωgraft was performed. The SP and APs used for Ωgraft dual-selection PACE are shown in FIG. 28. Results from three PACE lagoons are shown in FIGS. 29A-29C, which show titers of phage in all three lagoons persisted upon increased flow rates, indicating solutions were found in all three lagoons. Mutations present in both Ωgraft variants (left) and T7n are shown in Table 6. Soluble vs. insoluble expression of Ωgraft variants subcloned from SPs are shown in FIG. 30.










TABLE 6






anti-GCN4 Ωg




























L1-120-1



I71V


Y96D








L1-120-2




F91Y
A93V



A172S


A194


L1-120-3






Y96C








L1-120-4




F91Y



G141D






L1-120-5






Y96D








L1-120-6






Y96D








L2-120-1


S38L







V182A




L2-120-2

S13L
S38L







V182A




L2-120-3
I3V
S36L













L2-120-4


S368L







V182A




L2-120-5


S38L












L2-120-6


S38L







V182A




L3-120-1





A93V
Y96D




I183



L3-120-2






Y96D








L3-120-3





A93V
Y96D








L3-120-4






Y96D








L3-120-5






Y96D








L3-120-6






Y96D
S132I














T7n



















L1-120-1










S127R



L1-120-2










S127R



L1-120-3










S127R



L1-120-4





R49S








L1-120-5










S127R



L1-120-6


R30C







S127R



L2-120-1
N4
D12

G46D



A67T
K92
Q106K

N130K


L2-120-2
N4
D12

G46D



A67T

Q106K

N130K


L2-120-3
N4
D12

G46D



A67T

Q106K

N130K


L2-120-4
N4
D12

G46D



A67T

Q106K

N130K


L2-120-5



G46D





Q106K

N130K


L2-120-6
N4
D12

G46D



A67T

Q106K

N130K


L3-120-1










S127R



L3-120-2





R49




S127R



L3-120-3




A48E





S127R



L3-120-4










S127R



L3-120-5










S127R



L3-120-6






E62D



S127R









It was observed that mutations in T7n account for a lot of the overall activity increase. To address this, these PACE experiments were repeated with increasingly stringent T7 APs to try and “max out” T7n evolution. Stringency of the T7 APs was increased by using T7 promoter variants or T7 RNAP C-terminal domain mutants that impaired transcriptional activity. Representative data are shown in Tables 7 and 8.










TABLE 7






anti-GCN4 Ωg






























L1 PACE 1






Y96D










L1 PACE 2
A37V







T106M

G129S


D190N
F232L


L1 PACE 3
A37V


S81N
F87S

Y96H

T106M
R112L
G129S


D190N
F232L


L2 PACE 1

S38L










V182A




L2 PACE 2

S38L




Y96H


R112H

L136P
V182A




L2 PACE 3

S38L




Y96H
N98D

R112H

L136P
V182A




L3 PACE 1





A93V
Y96D










L3 PACE 2


E42K


A93V
Y96D










L3 PACE 3


E42K


A93V
Y96D

















TABLE 8








T7n





















L1 PACE 1










S127R





L1 PACE 2


G46D

K70E





S127R





L1 PACE 3


G46D

K70E


K97R

Q106K
S127R





L2 PACE 1


G46D
A67T





Q106K


N130K



L2 PACE 2


G46D
A67T


N85K


Q106K


N130K



L2 PACE 3
D96G

G46D
A67T
K70N

N85K

Q103H
Q106K

D129N
N130K



L3 PACE 1










S127R





L3 PACE 2

M45I








S127R


V133I


L3 PACE 3

M45I



L78P


Q103R

S127R
D129G

V133I









rpoZ













L1 PACE 1








L1 PACE 2








L1 PACE 3

D7G

V21A




L2 PACE 1








L2 PACE 2
Y177H







L2 PACE 3
Y177H







L3 PACE 1








L3 PACE 2








L3 PACE 3


V19L

F62V
R66L









Example 8
Revisiting MalE31 with Dual Selection

As described above, PACE experiments were run with the split T7 solubility selection for the MalE31 folding mutant (MBP G32D/I33P). Mutations in the MalE31 mutant and T7n are shown in Table 9.










TABLE 9





MalE31
T7n






















87-1
P33T
V76I
A167V

V373I

L39F


87-2
P33T


T275I





87-3
P33S




A386E



87-4
P33T









This PACE experiment was performed using an anti-MBP monobody for the 2-H selection component. Two clones from the first PACE experiment with MalE31 were evolved to investigate whether their solubility could be further improved. Representative data from the PACE experiment is shown in FIGS. 31A and 31B. Sequencing revealed that the G32D of MalE31 (G32D/I33P) had been reverted by the end of this PACE in both lagoons, as shown in Table 10. The effects of PACE mutation on soluble expression of MalE31 reverted variants was investigated. Data indicate that soluble expression was improved in PACE variants relative to the original clones, as shown in FIG. 32.










TABLE 10








MalE31

























L3-
N12S



P33T




G68D

Y99H








96-1




















L3-



D32G
P33T
A52V








K202N





96-2




















L3-




P33T


A63T


L89
Y99H
N100H







96-4




















L3-



D32G
P33T


A63E












96-5




















L3-



D32G
P33T










S233L




96-6




















L3-




P33T


A63T



Y99H





S255P


96-7




















L3-



D32G
P33T






Y99H




N234D



96-8




















L4-



D32G
P33S



F67L











96-1




















L4-




P33S

F61I













96-2




















L4-



D32G
P33S



F67L











96-3




















L4-



D32G
P33S









E214G





96-4




















L4-



D32G
P33S



F67L











96-5




















L4-

L20

D32G
P33S







M148I


S233L




96-6




















L4-


K26R
D32G
P33S










S233L




96-7




















L4-



D32G
P33S










S233L




96-8




























T7n
rpoZ






















L3-
G46S




T132I







D35V



96-1

















L3-




K97




A1S




F62


96-2

















L3-

















96-4

















L3-


E55














96-5

















L3-






G141










96-6

















L3-

















96-7

















L3-



A64E













96-8

















L4-

















96-1

















L4-

A48T



T132I











96-2

















L4-

















96-3

















L4-







E145
A158S








96-4

















L4-










V3A
K11E





96-5

















L4-

















96-6

















L4-

















96-7

















L4-












E40G




96-8









Example 9
PACE of Cry1Ac C03 Tryptic Core

It was previously observed that Cry1Ac tryptic core (tc) fragments show zero propagation on the T7 APs. In this example, PACE of Cry1Ac tc was run with a highly permissive T7 AP. Representative data from the PACE experiments is shown in FIG. 33A and FIG. 33B. Mutations arising from the PACE experiments are shown in Tables 11 and 12.










TABLE 12








Cry1Ac
























L1-
I2R


D10N

Q17
F23S








L209
N247


114-1
















T


L1-







I36R











114-2



















L1-



D10G



I36R


I118V
V128I







114-3



















L1-



D10G



I36R











114-4



















L2-


Y6

I11T


I36R


I118V


R154M





114-1



















L2-

G5S





I36R
I37V
E89K


V148G

N185




114-2



















L2-

G5S


I11T


I36R
I37V







S234


114-3
















F


L2-




I11S


I36R











114-4


























Cry1Ac




















L1-






S416R
S417G







114-1















L1-

G305E




S416R
S417G







114-2















L1-

G305E
T30I
A318S


S416R
S417G







114-3















L1-

G305E
T307





V418G






114-4


I












L2-

G305E


R375

S416R
S417G


I512
I523V



114-1















L2-
F301
G305E




S416R
S417G

T461T





114-2
Y














L2-

G305E




S416R
S417G







114-3















L2-

G305E



G398
S416R
S417G




G561


114-4

















TABLE 12








T7n

















L1-114-1



K70N
I73L

F88V





L1-114-2












L1-114-3
M34V








A158V


L1-114-4


R49L


R83H


I144



L2-114-1




I73L
R83H






L2-114-2



K70








L2-114-3



K70N



R127K




L2-114-4

S42A

















rpoZ













L1-114-1

V19L






L1-114-2








L1-114-3








L1-114-4








L2-114-1


V21A





L2-114-2
I12V



E55G



L2-114-3
I12V




A84S


L2-114-4



T45A









Consensus mutations in Cry1Ac C03 tc fragment were observed, including I36R/G305E/S416R/S417G. The consensus mutant, Cry1Ac C03 tc and wild-type Cry1Ac (wt) tc fragment were subcloned for expression as follows. Briefly a pET vector expressing 6×His-SSGLVPRGSH-Cry1Ac tc (or other variant) was produced. Using BL21 DE3, cells were grown up to OD 0.4, induced with 1 mM IPTG, and shaken 3 h at 37° C. before protein was extracted using B-per reagent and protease inhibitors. A representative Western blot is shown in FIG. 34. No 65-66 kDa band (e.g., the expected molecular weight of Cry1Ac) was observed; the predominant band observed was at ˜47 kDa.


In summary, dual selection for protein binding and protein solubility has been described. Modest increases in solubility were obtained with evolving scFvs, but improvements in T7n are a significant contribution to passing the selection. Cry1Ac C03 tc fragment was also evolved using this system and resulted in the presence of consensus mutations.


Example 10
Application of Evolved T7n to Anti-GCN4 scFv ΩGraft

As described above, improvements in Ωgraft solubility were achieved using PACE selection systems described by the disclosure. However, it was observed that mutations accumulating in T7n dominated the selection. This example describes evolution of T7n through 3 increasingly stringent PACEs to obtain the following consensus mutations, shown in Table 13.


















TABLE 13







L2 PACE 1

G46D
A67T



Q106K

N130K


L2 PACE 2

G46D
A67T

N85K

Q106K

N130K


L2 PACE 3
D9G
G46D
A67T
K70N
N85K
Q103H
Q106K
D129N
N130K









Another PACE experiment was run with wt Ωgraft and T7n from L2 PACE 3 described above. Representative data from the PACE experiments are shown in FIG. 35A and FIG. 35B. No consensus mutations in T7n were observed for L1, as shown in Table 14.











TABLE 14






Linker
T7n evolved
























L1-72-1
S38L


F91Y







L1-72-2
S38L
V40I
F87S


D190N

T131I
K159N


L1-72-3











L1-72-4
S38L
V40I
F87S


D190N





L1-72-5


F87S

G103S

L224V




L1-72-6


F87S

G103S

L224V




L1-72-7


F87S

G103S

L224V




L1-72-8
S38L
V40I



D190N









It was observed that L2 cheated by evolving a secondary translational start site (FIG. 36). Taken together, these results indicate that passing the selection by improving T7n is now more difficult, and biases selection towards improvements in the POI to dominate the mutations obtained from the selection.


The evolved variants from L1 show improved soluble expression, but not improved thermal stability. The yields from protein expression/purification are also increased (0.9 and 1.6 mg/250 mL culture for 29.2 and 29.5, respectively, compared to 0.3 mg for Ωgraft and 0.6 mg for m3), as shown in FIG. 37.


Example 11
Evolution of Anti-htt scFv C4

This example describes PACE of a scFv targeting the first 17 amino acids of huntingtin exon 1 (clone C4) to improve its soluble expression in E. coli cytosol. A previous computationally-driven attempt at engineering C4 proved unsuccessful and resulted in a more aggregation-prone scFv. Representative data from three PACE experiments are shown in FIGS. 38A-38C. Mutations arising from the PACE experiments are shown in Table 15. Evolved clones show improved soluble expression, as shown in FIG. 39.










TABLE 15








anti-htt C4




















L1-120-2
A1V



V38F










L1-120-3





A98T
G107
G122







L1-120-4
A1T

Q6K






S144L





L1-120-5















L2-120-1



F30L
V38F





S157




L2-120-2





A98V






S223A


L2-120-3





A98V


S126P






L2-120-4




V38F










L4-120-3















L4-120-4

Q2K



A98V









L4-120-5

Q2K



A98V









L4-120-6
A1T



V38F






Y163C










T7n evolved













L1-120-2
I3M







L1-120-3








L1-120-4








L1-120-5








L2-120-1


K97R





L2-120-2


K97R





L2-120-3


K97R





L2-120-4


K97R





L4-120-3








L4-120-4




A135T
K159E


L4-120-5

E55D

T131I




L4-120-6









Example 12
Expansion of POI Scope via “GCN4 Tagging”

This example describes a “GCN4 tag” selection strategy to satisfy protein-protein binding requirement of the 2-H selection system. This strategy was developed to overcome cheaters which evolved a premature stop codon adjacent to an in-frame start codon which circumvents translation of the entire protein of interest—T7 N-terminal domain fusion, and allows the phage to make T7 N-terminal domain only. Coupling the solubility selection to an activity selection (e.g., protein binding) prevents this cheating, but also precludes activity-independent protein solubility evolution, which may be desirable when activity-based selections are not available for the protein of interest. Activity-independent solubilization was achieved through use of a GCN4 tagging strategy. Fusion of the leucine zipper domain of the yeast GCN4 transcription factor (“GCN4 tag”) upstream of the protein of interest and running dual PACE selections with an protein binding AP encoding the anti-GCN4 scFv m3, which recognizes the GCN4 tag, circumvents the cheating in the same way as an activity-dependent selection. This greatly expands the scope of proteins compatible with the selection. A schematic overview of a GCN4 tagging SP is shown in FIG. 40. A PACE experiment with semi-soluble MBP G32D/I33S was performed and reversion of G32G was observed (FIG. 41 and Table 16), indicating that this strategy allows evolution of proteins independent of activity.













TABLE 16







malE31

T7n evolved






















L2-93-1
G24V
D32G
D33S
R172C



L2-93-2

D32G
D33S



L2-93-3
G24V
D32G
D33S
R172C



L2-93-4
G24V
D32G
D33S










In summary, PACE selection for soluble protein expression has been shown for a number of examples. This selection improves protein expression in the E. coli cytosol as well as yields after protein expression/purification.












SEQUENCES















>SEQ ID NO: 1; E. coli sigma 32 (σ32)


promoter


CGCTGATAAGGCTTGAAAAGTTCATTTCCAGACCCATTTTTACATCGTAG


CCGATGA





>SEQ ID NO: 2; T7 RNAP N-terminal domain


NTINIAKNDFSDIELAAIPFNTLADHYGERLAREQLALEHESYEMGEARF


RKMFERQLKAGEVADNAAAKPLITTLLPKMIARINDWFEEVKAKRGKRPT


AFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARF


GRIRDLEAKHFKKNVEEQLNKRVGHVYK





SEQ ID NO: 3; T7 RNAP C-terminal domain


MKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIESTGMVS


LHRQNAGVVGQDSETIELAPEYAEAIATRAGALAGISPMFQPCVVPPKPW


TGITGGGYWANGRRPLALVRTHSKKALMRYEDVYMPEVYKAINIAQNTAW


KINKKVLAVANVITKWKHCPVEDIPAIEREELPMKPEDIDMNPEALTAWK


RAAAAVYRKDKARKSRRISLEFMLEQANKFANHKAIWFPYNMDWRGRVYA


VSMFNPQGNDMTKGLLTLAKGKPIGKEGYYWLKIHGANCAGVDKVPFPER


IKFIEENHENIMACAKSPLENTWWAEQDSPFCFLAFCFEYAGVQHHGLSY


NCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSETVQDIYGIVAKKV


NEILQADAINGTDNEVVTVTDENTGEISEKVKLGTKALAGQWLAYGVTRS


VTKRSVMTLAYGSKEFGFRQQVLEDTIQPAIDSGKGLMFTQPNQAAGYMA


KLIWESVSVTVVAAVEAMNWLKSAAKLLAAEVKDKKTGEILRKRCAVHWV


TPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKDSEIDAHKQESGI


APNFVHSQDGSHLRKTVVWAHEKYGIESFALIHDSFGTIPADAANLFKAV


RETMVDTYESCDVLADFYDQFADQLHESQLDKMPALPAKGNLNLRDILES


DFAFA





>SEQ ID NO: 4; NpuC-SP11-18-g3p


MIKIATRKYLGKQNVYDIGVERDHNFALKNGFIASNCFNVVPFYSHSAET


VESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQC


YGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYI


NPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTG


TVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEY


QGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSGGGS


GSGDFDYEKMANANKGAMTENADENALQSDAKGKLDSVATDYGAAIDGFI


GDVSGLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVE


CRPFVFGAGKPYEFSIDCDKINLFRGVFAFLLYVATFMYVFSTFANILRN


KES





>SEQ ID NO: 5; SP1-10-NpuN


MKKLLFAIPLCLSYETEILTVEYGLLPIGKIVEKRIECTVYSVDNNGNIY


TQPVAQWHDRGEQEVFEYCLEDGSLIRATKDHKFMTVDGQMLPIDEIFER


ELDLMRVDNLPN





>SEQ ID NO: 6; ibpA-T7 RNAP N-term fusion


MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIA


IAVAGFAESELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQ


LAENIHVRGANLVNGLLYIDLERVIPEAKKPRRIEINGGSGGNTINIAKN


DFSDIELAAIPFNTLADHYGERLAREQLALEHESYEMGEARFRKMFERQL


KAGEVADNAAAKPLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEI


KPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARFGRIRDLEA


KHFKKNVEEQLNKRVGHVYK





>SEQ ID NO: 7; ibpB T7 RNAP N-term fusion


MRNFDLSPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHYRITLA


LAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLA


ENMEVSGATFVNGLLHIDLIRNEPEPIAAQRIAISERPALNSGGSGGNTI


NIAKNDFSDIELAAIPFNTLADHYGERLAREQLALEHESYEMGEARFRKM


FERQLKAGEVADNAAAKPLITTLLPKMIARINDWFEEVKAKRGKRPTAFQ


FLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARFGRI


RDLEAKHFKKNVEEQLNKRVGHVYK





>SEQ ID NO: 8; pIII signal peptide residues


1-10


MKKLLPAIP





>SEQ ID NO: 9; pIII protein lacking SP residues


1-10


VVPFYSHSAETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATG


VVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGGTKPPEY


GDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFR


NRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHS


GFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGG


GSEGGGSGGGSGSGDFDYEKMANANKGAMTENADENALQSDAKGKLDSVA


TDYGAAIDGFIGDVSGLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFR


QYLPSLPQSVECRPFVFGAGKPYEFSIDCDKINLFRGVFAFLLYVATFMY


VFSTFANILRNKES





>SEQ ID NO: 10; Voigt RNAP Sequence


NTINIAKNDFSDIELAAIPFNTLADHYGERLAREQLALEHESYEMGEARF


RKMFERQLKAGEVADN





>SEQ ID NO: 11 GCN4 tag sequence


MQRMKQLEPKVEELLPKNYHLENEVARLKKLVGER








Claims
  • 1. An isolated nucleic acid comprising an E. coli sigma 32 (σ32) promoter operably linked to a nucleic acid sequence that encodes a dominant negative gene III (pIII-neg).
  • 2. The isolated nucleic acid of claim 1, wherein the σ32 promoter comprises a sequence as set forth in SEQ ID NO: 1.
  • 3. A vector comprising the isolated nucleic acid of claim 1 or 2, wherein the vector is a plasmid.
  • 4. A method of phage-assisted continuous evolution (PACE) comprising: (a) contacting a population of bacterial host cells in a culture medium with a population of M13 phages comprising a gene of interest to be evolved and lacking a functional pIII gene required for the generation of infectious phage particles; wherein (1) the M13 phages allow for expression of the gene of interest in the host cells;(2) the host cells are suitable host cells for M13 phage infection, replication, and packaging, wherein the M13 phage comprises all phage genes required for the generation of phage particles, except a full length pIII gene; and(3) the host cells comprise an expression construct encoding the pIII protein, wherein expression of the pIII gene is dependent on a function of a gene product of the gene of interest;(b) incubating the population of host cells under conditions allowing for the mutation of the gene of interest, the production of infectious M13 phage, and the infection of host cells with M13 phage, wherein infected cells are removed from the population of host cells, and wherein the population of host cells is replenished with fresh host cells that are not infected by M13 phage, wherein the function of the gene of interest is a desired function, wherein desired functional library members induce production of pIII and release M13 progeny into the culture medium capable of infecting new host cells, wherein undesired non-functional library members do not produce pIII and release only non-infectious M13 progeny into the culture medium; and(c) isolating a mutated M13 phage replication product encoding an evolved protein from the population of host cells, wherein the host cells comprise an expression construct encoding a dominant-negative pIII protein (pIII-neg) operably linked to an E. coli sigma 32 (σ32) promoter.
  • 5. The method of claim 4, wherein the evolved protein encoded by the replication product isolated in step (c) has increased solubility and/or stability relative to the gene product of the gene to be evolved.
  • 6. An isolated nucleic acid comprising a sequence encoding a gene of interest to be evolved fused to a sequence encoding a T7 RNA polymerase (RNAP) N-terminal domain.
  • 7. The isolated nucleic acid of claim 6, wherein the sequence encoding the T7 RNAP N-terminal domain is contiguous with the 5′-end or the 3′-end of the sequence encoding the gene of interest to be evolved.
  • 8. The isolated nucleic acid of claim 6 or 7, wherein the T7 RNAP N-terminal domain encodes a protein represented by the sequence set forth in SEQ ID NO: 2 or 10.
  • 9. A vector comprising the isolated nucleic acid of any one of claims 6 to 8, optionally wherein the vector is a plasmid, further optionally wherein the plasmid is a selection plasmid (SP).
  • 10. A host cell comprising the isolated nucleic acid of any one of claims 6 to 8, or the vector of claim 9, wherein the host cell further comprises a nucleic acid encoding a T7 RNAP C-terminal domain, wherein the C-terminal domain comprises a nucleic acid sequence encoding a protein as set forth in SEQ ID NO: 3.
  • 11. A method of phage-assisted continuous evolution (PACE), comprising (a) contacting a population of bacterial host cells expressing a T7 RNAP C-terminal domain with a population of M13 phages comprising a gene of interest to be evolved fused to a T7 RNAP N-terminal domain,wherein the M13 phages are deficient in a full-length pIII gene,wherein (1) the phage allows for expression of the gene of interest in the host cells,(2) the host cells are suitable host cells for M13 phage infection, replication, and packaging; and(3) the host cells comprise an expression construct encoding the pIII protein operably linked to a T7 promoter, wherein expression of the pIII gene is dependent on recombination of the T7 RNAP N-terminus and T7 RNAP C-terminus;(b) incubating the population of host cells under conditions allowing for the mutation of the gene of interest, the production of infectious M13 phage, and the infection of host cells with M13 phage, wherein infected cells are removed from the population of host cells, and wherein the population of host cells is replenished with fresh host cells that are not infected by M13 phage; and(c) isolating a mutated M13 phage replication product encoding an evolved protein from the population of host cells.
  • 12. The method of claim 11, wherein the evolved protein encoded by the replication product isolated in step (c) has increased solubility and/or stability relative to the gene product of the gene to be evolved.
  • 13. An isolated nucleic acid comprising a sequence encoding a T7 promoter operably linked to an expression cassette comprising, in the following order: (i) a sequence encoding a Npu split intein C-terminal portion; and(ii) a sequence encoding a M13 phage gIII protein;
  • 14. The isolated nucleic acid of claim 13, wherein the sequence encoding the gIII protein lacks nucleic acid bases 1-10 of the signal peptide domain.
  • 15. The isolated nucleic acid of claim 13 or 14, wherein the isolated nucleic acid comprises a sequence encoding a protein as set forth in SEQ ID NO: 4.
  • 16. An isolated nucleic acid comprising a sequence encoding a RNA polymerase I promoter operably linked to an expression cassette comprising, in the following order, (i) a sequence encoding a M13 phage gIII protein signal peptide; and(ii) a sequence encoding a Npu split intein N-terminal portion,
  • 17. The isolated nucleic acid of claim 16, further comprising a sequence encoding a cI repressor protein binding site, optionally wherein the repressor protein is 434cI.
  • 18. The isolated nucleic acid of claim 17, wherein the repressor protein is 434cI.
  • 19. A vector comprising the isolated nucleic acid of any one of claims 13 to 18, optionally wherein the vector is a plasmid, further optionally wherein the plasmid is an accessory plasmid (AP).
  • 20. A method of phage-assisted continuous evolution (PACE), comprising (a) contacting a population of bacterial host cells with a population of M13 phages comprising a gene of interest to be evolved fused to a T7 RNAP, a RNAP omega subunit (rpoZ), and a HA4 monobody,wherein the M13 phages are deficient in a full-length pIII gene,wherein (1) the phage allows for expression of the gene of interest in the host cells,(2) the host cells are suitable host cells for M13 phage infection, replication, and packaging; and(3) the host cells comprise an expression construct encoding the isolated nucleic acid of any one of claims 13 to 17 or the vector of claim 18 or 19, wherein expression of the pIII gene is dependent on trans-splicing of the Npu split intein N- and C-terminal portions;(b) incubating the population of host cells under conditions allowing for the mutation of the gene of interest, the production of infectious M13 phage, and the infection of host cells with M13 phage, wherein infected cells are removed from the population of host cells, and wherein the population of host cells is replenished with fresh host cells that are not infected by M13 phage; and(c) isolating a mutated M13 phage replication product encoding an evolved protein from the population of host cells.
  • 21. The method of claim 20, wherein the evolved protein encoded by the replication product isolated in step (c) has increased solubility and/or stability relative to the gene product of the gene to be evolved.
  • 22. An isolated nucleic acid comprising a sequence encoding a fusion protein comprising a heat shock chaperone protein and a T7 RNAP N-terminal domain.
  • 23. The isolated nucleic acid of claim 22, wherein the heat shock chaperone protein is ibpA or ibpB.
  • 24. The isolated nucleic acid of claim 22 or 23, wherein the isolated nucleic acid encodes a protein comprising the sequence set forth in SEQ ID NO: 6 or 7.
  • 25. An isolated nucleic acid comprising a sequence encoding a GCN4 tag, a gene encoding a protein of interest to be evolved, a T7 RNAP and a RNAP omega subunit (rpoZ).
  • 26. The isolated nucleic acid of claim 25, wherein the sequence encoding the GCN4 tag comprises the sequence set forth in SEQ ID NO: 11.
RELATED APPLICATIONS

This application claims the benefit under 35 U.S.C. 119(e) of the filing date of U.S. Provisional Application Ser. No. 62/559,919, filed Sep. 18, 2017, entitled “CONTINUOUS EVOLUTION FOR STABILIZED PROTEINS”, the entire contents of which are incorporated herein by reference.

PCT Information
Filing Document Filing Date Country Kind
PCT/US2018/051557 9/18/2018 WO 00
Provisional Applications (1)
Number Date Country
62559919 Sep 2017 US