Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists

Information

  • Patent Grant
  • 9775904
  • Patent Number
    9,775,904
  • Date Filed
    Monday, April 6, 2015
    9 years ago
  • Date Issued
    Tuesday, October 3, 2017
    6 years ago
Abstract
The present invention relates to dual GLP-1/glucagon receptor agonists and their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake.
Description
RELATED APPLICATIONS

This application is a 35 U.S.C. §111(a) filing claiming priority under 35 U.S.C. §119(a)-(d) to European Patent Application No. EP2014/05501.01, filed Apr. 7, 2014, the content of which is incorporated herein by reference in its entirety.


FIELD OF THE INVENTION

The present invention relates to dual GLP-1/glucagon receptor agonists and their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia and are structurally derived from exendin-4, a pure GLP-1 receptor agonist.


BACKGROUND OF THE INVENTION

Pocai et al (Obesity 2012; 20:1566-1571; Diabetes 2009, 58, 2258) and Day et al. (Nat Chem Biol 2009; 5:749) describe dual agonists of the glucagon-like peptide-1 (GLP-1) and glucagon receptors, e.g. by combining the actions of GLP-1 and glucagon in one molecule, which lead to a therapeutic principle with anti-diabetic action and a pronounced weight lowering effect superior to pure GLP-1 agonists, among others due to glucagon-receptor mediated increased satiety and energy expenditure.


Holst (Physiol. Rev. 2007, 87, 1409) and Meier (Nat. Rev. Endocrinol. 2012, 8, 728) describe that GLP-1 receptor agonists, such as GLP-1, liraglutide and exendin-4, have 3 major pharmacological activities to improve glycemic control in patients with T2DM by reducing fasting and postprandial glucose (FPG and PPG): (i) increased glucose-dependent insulin secretion (improved first- and second-phase), (ii) glucagon suppressing activity under hyperglycemic conditions, (iii) delay of gastric emptying rate resulting in retarded absorption of meal-derived glucose.


The amino acid sequence of GLP-1(7-36)-amide is shown as SEQ ID NO: 2.











HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2






Liraglutide is a marketed chemically modified GLP-1 analog in which, among other modifications, a fatty acid is linked to a lysine in position 20 leading to a prolonged duration of action (Drucker D J et al, Nature Drug Disc. Rev. 9, 267-268, 2010; Buse, J. B. et al., Lancet, 374:39-47, 2009).


The amino acid sequence of Liraglutide is shown as SEQ ID NO: 4.











HAEGTFTSDVSSYLEGQAAK((S)-4-Carboxy-4-







hexadecanoylamino-butyryl-)EFIAWLVRGRG-OH






Glucagon is a 29-amino acid peptide which is released into the bloodstream when circulating glucose is low. Glucagon's amino acid sequence is shown as SEQ ID NO: 3.











HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-OH






During hypoglycemia, when blood glucose levels drop below normal, glucagon signals the liver to break down glycogen and release glucose, causing an increase of blood glucose levels to reach a normal level. Recent publications suggest that glucagon has in addition beneficial effects on reduction of body fat mass, reduction of food intake, and increase of energy expenditure (K M Heppner, Physiology & Behavior 2010, 100, 545-548).


GIP (glucose-dependent insulinotropic polypeptide) is a 42 amino acid peptide that is released from intestinal K-cells following food intake. GIP and GLP-1 are the two gut enteroendocrine cell-derived hormones accounting for the incretin effect, which accounts for over 70% of the insulin response to an oral glucose challenge (Baggio L L, Drucker D J. Biology of incretins: GLP-1 and GIP. Gastroenterology 2007; 132: 2131-2157).


GIP's amino acid sequence is shown as SEQ ID NO: 5.











YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH






Peptides which are based on the structures of GLP-1 or glucagon, and bind and activate both the glucagon and the GLP-1 receptor (Hjort et al. Journal of Biological Chemistry, 269, 30121-30124, 1994; Day J W et al, Nature Chem Biol, 5: 749-757, 2009) and suppress body weight gain and reduce food intake are described in patent applications WO 2008/071972, WO 2008/101017, WO 2009/155258, WO 2010/096052, WO 2010/096142, WO 2011/075393, WO 2008/152403, WO 2010/070251, WO 2010/070252, WO 2010/070253, WO 2010/070255, WO 2011/160630, WO 2011/006497, WO 2011/087671, WO 2011/087672, WO 2011/117415, WO 2011/117416, WO 2012/177443 WO 2012/177444, WO 2012/150503, WO 2013/004983, WO 2013/092703, WO 2014/041195 and WO 2014/041375, the contents of which are herein incorporated by reference. The body weight reduction was shown to be superior to pure GLP-1 agonists.


In addition, triple co-agonist peptides which not only activate the GLP-1 and the glucagon receptor, but also the GIP receptor are described in WO 2012/088116 and by V A Gault et al (Biochem Pharmacol, 85, 16655-16662, 2013; Diabetologia, 56, 1417-1424, 2013).


Exendin-4 is a 39 amino acid peptide which is produced by the salivary glands of the Gila monster (Heloderma suspectum) (Eng, J. et al., J. Biol. Chem., 267:7402-05, 1992). Exendin-4 is an activator of the GLP-1 receptor, whereas it shows low activation of the GIP receptor and does not activate the glucagon receptor (see Table 1).









TABLE 1







Potencies of exendin-4 at human GLP-1, GIP and


Glucagon receptors (indicated in pM) at increasing concentrations


and measuring the formed cAMP as described in Methods.











SEQ ID

EC50 hGLP-1 R
EC50 hGIP R
EC50 hGlucagon


NO:
peptide
[PM]
[PM]
R [pM]





1
exendin-4
0.4
12500.0
>10000000









The amino acid sequence of exendin-4 is shown as SEQ ID NO: 1.











HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2






Exendin-4 shares many of the glucoregulatory actions observed with GLP-1. Clinical and nonclinical studies have shown that exendin-4 has several beneficial antidiabetic properties including a glucose dependent enhancement in insulin synthesis and secretion, glucose dependent suppression of glucagon secretion, slowing down gastric emptying, reduction of food intake and body weight, and an increase in beta-cell mass and markers of beta cell function (Gentilella R et al., Diabetes Obes Metab., 11:544-56, 2009; Norris S L et al, Diabet Med., 26:837-46, 2009; Bunck M C et al, Diabetes Care., 34:2041-7, 2011).


These effects are beneficial not only for diabetics but also for patients suffering from obesity. Patients with obesity have a higher risk of getting diabetes, hypertension, hyperlipidemia, cardiovascular and musculoskeletal diseases.


Relative to GLP-1, exendin-4 is resistant to cleavage by dipeptidyl peptidase-4 (DPP4) resulting in a longer half-life and duration of action in vivo (Eng J., Diabetes, 45 (Suppl 2):152A (abstract 554), 1996).


Exendin-4 was also shown to be much more stable towards degradation by neutral endopeptidase (NEP), when compared to GLP-1, glucagon or oxyntomodulin (Druce M R et al., Endocrinology, 150(4), 1712-1721, 2009). Nevertheless, exendin-4 is chemically labile due to methionine oxidation in position 14 (Hargrove D M et al., Regul. Pept., 141: 113-9, 2007) as well as deamidation and isomerization of asparagine in position 28 (WO 2004/035623).


Compounds of this invention are exendin-4 derivatives, which in addition to the agonistic activity at the GLP-1 receptor of native exendin-4 show agonistic activity at the glucagon receptor and which have—among others—the following modification: at position 14 an amino acid carrying an —NH2 group in the side-chain, which is further substituted with a lipophilic residue (e.g. a fatty acid combined with a linker) and at position 27 an Aib.


Bloom et al. (WO 2006/134340) disclose that peptides which bind and activate both the glucagon and the GLP-1 receptor can be constructed as hybrid molecules from glucagon and exendin-4, where the N-terminal part (e.g. residues 1-14 or 1-24) originates from glucagon and the C-terminal part (e.g. residues 15-39 or 25-39) originates from exendin-4. Such peptides comprise glucagon's amino acid motif YSKY in position 10-13. Krstenansky et al (Biochemistry, 25, 3833-3839, 1986) show the importance of these residues 10-13 of glucagon for its receptor interactions and activation of adenylate cyclase.


In the exendin-4 derivatives described in this invention, several of the underlying residues are different from glucagon and the peptides described in WO 2006/134340. In particular residues Tyr10 and Tyr13, which are known to contribute to the fibrillation of glucagon (D E Otzen, Biochemistry, 45, 14503-14512, 2006) are replaced by Leu in position 10 and Gln, a non-aromatic polar amino acid, in position 13. This replacement, especially in combination with isoleucine in position 23 and glutamate in position 24, leads to exendin-4 derivatives with potentially improved biophysical properties as solubility or aggregation behaviour in solution. The non-conservative replacement of an aromatic amino acid with a polar amino acid in position 13 of an exendin-4 analogue surprisingly leads to peptides with high activity on the glucagon receptor, keeping their activity on the GLP-1 receptor (see also WO2013/186240.


Furthermore, we surprisingly found that compounds carrying an Aib amino acid in position 27 show reduced activity on the GIP receptor compared to the corresponding derivatives with Lys at position 27 as in native exendin-4, as shown in Example 5, Table 8. A reduced activation of the GIP receptor is potentially beneficial as there are reports in the literature that high levels of GIP in diabetics might in some cases lead to more frequent episodes of hypoglycemia (T McLaughlin et al., J Clin Endocrinol Metab, 95, 1851-1855, 2010; A Hadji-Georgopoulos, J Clin Endocrinol Metab, 56, 648-652, 1983).


Furthermore, compounds of this invention are exendin-4 derivatives with fatty acid acylated residues in position 14. This fatty acid functionalization in position 14 resulted in exendin-4 derivatives with high activity not only at the GLP-1 receptor, but also at the glucagon receptor, when compared to the corresponding non-acylated exendin-4 derivatives, for example those shown in Example 5, Table 7. In addition, this modification results in an improved pharmacokinetic profile.


It is described in the literature (Murage E N et al., Bioorg. Med. Chem. 16 (2008), 10106-10112), that a GLP-1 analogue with an acetylated lysine at position 14 showed significantly reduced potency on the GLP-1 receptor compared to natural GLP-1.


Compounds of this invention are more resistant to cleavage by neutral endopeptidase (NEP) and dipeptidyl peptidase-4 (DPP4), resulting in a longer half-life and duration of action in vivo, when compared with native GLP-1 and glucagon.


Compounds of this invention preferably are soluble not only at neutral pH, but also at pH 4.5. This property potentially allows co-formulation for a combination therapy with an insulin or insulin derivative and preferably with a basal insulin like insulin glargine/Lantus®.


BRIEF SUMMARY OF THE INVENTION

Native exendin-4 is a pure GLP-1 receptor agonist without activity on the glucagon receptor and low activity on the GIP receptor. Provided herein are exendin-4 derivatives based on the structure of native exendin-4 but differing at ten or more positions as compared to SEQ ID NO: 1 wherein the differences contribute to the enhancement of the agonistic activity at the glucagon receptor. Among other substitutions—methionine at position 14 is replaced by an amino acid carrying an —NH2 group in the side-chain, which is further substituted by a lipophilic residue (e.g. a fatty acid combined with a linker). Furthermore, we surprisingly found that a replacement of the lysine at position 27 by Aib leads to reduced GIP receptor activity compared to the GLP-1 receptor activity. A reduced activation of the GIP receptor is potentially beneficial as there are reports in the literature that high levels of GIP in diabetics might in some cases lead to more frequent episodes of hypoglycemia (T McLaughlin et al., J Clin Endocrinol Metab, 95, 1851-1855, 2010; A Hadji-Georgopoulos, J Clin Endocrinol Metab, 56, 648-652, 1983).


The invention provides a peptidic compound having the formula (I):

H2N-His-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-X14-Asp-Glu-Gln-Arg-Ala-Lys-Leu-Phe-Ile-Glu-Trp-Leu-Aib-X28-X29-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-R1  (I)

    • X14 represents an amino acid residue with a functionalized —NH2 side chain group, selected from the group consisting of Lys, Orn, Dab, or Dap, wherein the —NH2 side chain group is functionalized by —Z—C(O)—R5, wherein
      • Z represents a linker in all stereoisomeric forms and
      • R5 is a moiety comprising up to 50 carbon atoms and heteroatoms selected from N and O,
    • X28 represents an amino acid residue selected from Ala, Lys and Ser,
    • X29 represents an amino acid residue selected from D-Ala and Gly,
    • R1 is NH2 or OH,
      • or a salt or solvate thereof.


The compounds of the invention are GLP-1 and glucagon receptor agonists as determined by the observation that they are capable of stimulating intracellular cAMP formation in the assay system described in Methods.


According to another embodiment the compounds of the invention, particularly with a lysine at position 14 which is further substituted with a lipophilic residue, exhibit at least a relative activity of 0.1% (i.e. EC50<700 pM), more preferably of 1% (i.e. EC50<70 pM), more preferably of 5% (i.e. EC50<14 pM) and even more preferably of 10% (i.e. EC50<7 pM) compared to that of GLP-1(7-36)amide at the GLP-1 receptor. Furthermore, the compounds exhibit at least a relative activity of 0.09% (i.e. EC50<1111 pM), more preferably of 0.45% (i.e. EC50<222 pM) and even more preferably of 0.9% (i.e. EC50<111 pM) compared to that of natural glucagon at the glucagon receptor.


The term “activity” as used herein preferably refers to the capability of a compound to activate the human GLP-1 receptor and the human glucagon receptor. More preferably the term “activity” as used herein refers to the capability of a compound to stimulate intracellular cAMP formation. The term “relative activity” as used herein is understood to refer to the capability of a compound to activate a receptor in a certain ratio as compared to another receptor agonist or as compared to another receptor. The activation of the receptors by the agonists (e.g. by measuring the cAMP level) is determined as described herein, e.g. as described in the Example 4.


The compounds of the invention preferably have an EC50 for hGLP-1 receptor of 450 pmol or less, preferably of 200 pmol or less, more preferably of 100 pmol or less, more preferably of 50 pmol or less, more preferably of 25 pmol or less, more preferably of 10 pmol or less, more preferably of 8 pmol or less, and more preferably of 5 pmol or less and/or an EC50 for hGlucagon receptor of 500 pmol or less, preferably of 300 pmol or less, more preferably of 200 pmol or less, more preferably of 150 pmol or less and/or an EC50 for hGIP receptor of 750 pmol or more, preferably of 1500 pmol or more; more preferably of 2000 pmol or more. It is particularly preferred that the EC50 for both hGLP-1 and hGlucagon receptors is 250 pm or less, more preferably of 200 pmol or less, more preferably of 150 pmol or less. The EC50 for the hGLP-1 receptor, the hGlucagon receptor and the hGIP receptor may be determined as described in the Methods herein and as used to generate the results described in Example 4, Table 6.


The compounds of the invention have the ability to reduce the intestinal passage, increase the gastric content and/or to reduce the food intake of a patient. These activities of the compounds of the invention can be assessed in animal models known to the skilled person and also described herein in the Methods.


The compounds of the invention have the ability to reduce blood glucose level, and/or to reduce HbA1c levels of a patient. These activities of the compounds of the invention can be assessed in animal models known to the skilled person and also described herein in the Methods.


The compounds of the invention have the ability to reduce body weight of a patient. These activities of the compounds of the invention can be assessed in animal models known to the skilled person and also described herein in the Methods and in Example 7.


It was found that peptidic compounds of the formula (I) particularly those with a lysine at position 14 which is further substituted with a lipophilic residue, showed increased glucagon receptor activation compared to derivatives having the original methionine (from exendin-4) or leucine at position 14 (see Table 7). Furthermore, oxidation (in vitro or in vivo) of methionine is not possible anymore.


It was also found that compounds carrying an Aib amino acid in position 27 show reduced activity on the GIP receptor compared to the corresponding derivatives with Lys at position 27 as in native exendin-4, as shown in Example 5, Table 8. A reduced activation of the GIP receptor is potentially beneficial as there are reports in the literature that high levels of GIP in diabetics might in some cases lead to more frequent episodes of hypoglycemia (T McLaughlin et al., J Clin Endocrinol Metab, 95, 1851-1855, 2010; A Hadji-Georgopoulos, J Clin Endocrinol Metab, 56, 648-652, 1983).


In one embodiment the compounds of the invention have a high solubility at acidic and/or physiological pH values, e.g., at pH 4.5 and/or at pH 7.4 at 25° C., in another embodiment at least 1 mg/ml and in a particular embodiment at least 5 mg/ml.


Furthermore, the compounds of the invention preferably have a high stability when stored in solution. Preferred assay conditions for determining the stability is storage for 7 days at 40° C. in solution at pH 4.5 or pH 7.4. The remaining amount of peptide is determined by chromatographic analyses as described in the Examples. Preferably, after 7 days at 40° C. in solution at pH 4.5 or pH 7.4 the remaining peptide is at least 75%, more preferably at least 80%, even more preferably at least 85% and even more preferably at least 90%.


Preferably, the compounds of the present invention comprise a peptide moiety which is a linear sequence of 39 amino carboxylic acids, particularly α-amino carboxylic acids linked by peptide, i.e. carboxamide bonds.


In one embodiment, R1 is NH2 and in a further embodiment R1 is OH.


Specific preferred examples for —Z—C(O)—R5 groups are listed in the following Table 2, which are selected from


(S)-4-Carboxy-4-hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-hexadecanoylamino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-octadecanoylamino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl, [2-(2-{2-[2-(2-{2-[2-(2-Octadecanoylamino-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetyl-, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-(17-carboxy-heptadecanoyl)amino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl.


Further preferred are stereoisomers, particularly enantiomers of these groups, either S- or R-enantiomers. The term “R” in Table 2 is intended to mean the attachment site of —Z—C(O)—R5 at the peptide back bone, i.e. particularly the ε-amino group of Lys.










TABLE 2





Structure/IUPAC
name









embedded image


E-x70







embedded image


E-x53







embedded image


E-E-x53







embedded image


AEEAc- AEEAc- E-x53







embedded image


AEEAc- AEEAc- E-x70







embedded image


AEEAc- AEEAc- AEEAc- x70







embedded image


AEEAc- AEEAc- E-x99









A further embodiment relates to a group of compounds, wherein


X14 represents Lys wherein the —NH2 side chain group is functionalized with a group —Z—C(O)R5, wherein


Z represents a group selected from γE, γE-γE, AEEAc-AEEAc-γE and AEEAc-AEEAc-AEEAc and


R5 represents a group selected from pentadecanyl, heptadecanyl or 16-carboxy-hexadecanyl.


A further embodiment relates to a group of compounds, wherein


X14 represents Lys wherein the —NH2 side chain group is functionalized with a group —Z—C(O)R5, wherein


Z represents a group selected from γE, γE-γE, AEEAc-AEEAc-γE and AEEAc-AEEAc-AEEAc and


R5 represents a group selected from pentadecanyl or heptadecanyl.


A further embodiment relates to a group of compounds, wherein

    • X14 represents Lys wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-octadecanoylamino-butyryl-,
    • X28 represents Ala,
    • X29 represents an amino acid residue selected from Gly and D-Ala,
    • R1 represents NH2,
    • or a salt or solvate thereof.


A further embodiment relates to a group of compounds, wherein

    • X14 represents Lys wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-hexadecanoylamino-butyryl-,
    • X28 represents Ala,
    • X29 represents an amino acid residue selected from Gly and D-Ala,
    • R1 represents NH2,
    • or a salt or solvate thereof.


A further embodiment relates to a group of compounds, wherein

    • X14 represents Lys wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-,
    • X28 represents an amino acid residue selected from Ala, Ser and Lys,
    • X29 represents an amino acid residue selected from Gly and D-Ala,
    • R1 represents NH2,
    • or a salt or solvate thereof.


A further embodiment relates to a group of compounds, wherein

    • X14 represents Lys wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-hexadecanoylamino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-octadecanoylamino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl, [2-(2-{2-[2-(2-{2-[2-(2-Octadecanoylamino-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetyl-, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-(17-carboxy-heptadecanoyl)amino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl,
    • X28 represents Ala,
    • X29 represents an amino acid residue selected from D-Ala and Gly,
    • R1 represents NH2,
    • or a salt or solvate thereof.


A further embodiment relates to a group of compounds, wherein

    • X14 represents Lys wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-hexadecanoylamino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-octadecanoylamino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl, [2-(2-{2-[2-(2-{2-[2-(2-Octadecanoylamino-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetyl-,
    • X28 represents Ala,
    • X29 represents an amino acid residue selected from D-Ala and Gly,
    • R1 represents NH2,
    • or a salt or solvate thereof.


A further embodiment relates to a group of compounds, wherein

    • X14 represents Lys wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-,
    • X28 represents Ser,
    • X29 represents an amino acid residue selected from D-Ala and Gly,
    • R1 represents NH2,
    • or a salt or solvate thereof.


A further embodiment relates to a group of compounds, wherein

    • X14 represents Lys wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-,
    • X28 represents Lys,
    • X29 represents an amino acid residue selected from D-Ala and Gly,
    • R1 represents NH2,
    • or a salt or solvate thereof.


A further embodiment relates to a group of compounds, wherein

    • X14 represents Lys wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-,
    • X28 represents an amino acid residue selected from Ala, Lys and Ser,
    • X29 represents D-Ala,
    • R1 represents NH2,
    • or a salt or solvate thereof.


A further embodiment relates to a group of compounds, wherein

    • X14 represents Lys wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-hexadecanoylamino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-octadecanoylamino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl, [2-(2-{2-[2-(2-{2-[2-(2-Octadecanoylamino-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetyl-, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-(17-carboxy-heptadecanoyl)amino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl,
    • X28 represents an amino acid residue selected from Ala, Lys and Ser,
    • X29 represents Gly,
    • R1 represents NH2.
    • or a salt or solvate thereof.


A further embodiment relates to a group of compounds, wherein

    • X14 represents Lys wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-hexadecanoylamino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-octadecanoylamino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl, [2-(2-{2-[2-(2-{2-[2-(2-Octadecanoylamino-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetyl-,
    • X28 represents an amino acid residue selected from Ala, Lys and Ser,
    • X29 represents Gly,
    • R1 represents NH2.
    • or a salt or solvate thereof.


A further embodiment relates to a group of compounds, wherein

    • X14 represents Lys wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-,
    • X28 represents Ala,
    • X29 represents an amino acid residue selected from Gly and D-Ala,
    • R1 represents NH2.
    • or a salt or solvate thereof.


A further embodiment relates to a group of compounds, wherein

    • X14 represents Lys, wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-
    • or a salt or solvate thereof.


A still further embodiment relates to a group of compounds, wherein

    • X14 represents Lys, wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-.
    • or a salt or solvate thereof.


Specific examples of peptidic compounds of formula (I) are the compounds of SEQ ID NO: 6-19, as well as salts or solvates thereof.


Specific examples of peptidic compounds of formula (I) are the compounds of SEQ ID NO: 6-18, as well as salts or solvates thereof.


Specific examples of peptidic compounds of formula (I) are the compounds of SEQ ID NO: 7 and 8 as well as salts or solvates thereof.


In certain embodiments, i.e. when the compound of formula (I) comprises genetically encoded amino acid residues, the invention further provides a nucleic acid (which may be DNA or RNA) encoding said compound, an expression vector comprising such a nucleic acid, and a host cell containing such a nucleic acid or expression vector.


In a further aspect, the present invention provides a composition comprising a compound of the invention in admixture with a carrier. In preferred embodiments, the composition is a pharmaceutically acceptable composition and the carrier is a pharmaceutically acceptable carrier. The compound of the invention may be in the form of a salt, e.g. a pharmaceutically acceptable salt or a solvate, e.g. a hydrate. In still a further aspect, the present invention provides a composition for use in a method of medical treatment, particularly in human medicine.


In certain embodiments, the nucleic acid or the expression vector may be used as therapeutic agents, e.g. in gene therapy.


The compounds of formula (I) are suitable for therapeutic application without an additional therapeutically effective agent. In other embodiments, however, the compounds are used together with at least one additional therapeutically active agent, as described in “combination therapy”.


The compounds of formula (I) are particularly suitable for the treatment or prevention of diseases or disorders caused by, associated with and/or accompanied by disturbances in carbohydrate and/or lipid metabolism, e.g. for the treatment or prevention of hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes, obesity and metabolic syndrome. Further, the compounds of the invention are particularly suitable for the treatment or prevention of degenerative diseases, particularly neurodegenerative diseases.


The compounds described find use, inter alia, in preventing weight gain or promoting weight loss. By “preventing” is meant inhibiting or reducing when compared to the absence of treatment, and is not necessarily meant to imply complete cessation of a disorder.


The compounds of the invention may cause a decrease in food intake and/or increase in energy expenditure, resulting in the observed effect on body weight.


Independently of their effect on body weight, the compounds of the invention may have a beneficial effect on circulating cholesterol levels, being capable of improving lipid levels, particularly LDL, as well as HDL levels (e.g. increasing HDL/LDL ratio).


Thus, the compounds of the invention can be used for direct or indirect therapy of any condition caused or characterised by excess body weight, such as the treatment and/or prevention of obesity, morbid obesity, obesity linked inflammation, obesity linked gallbladder disease, obesity induced sleep apnea. They may also be used for treatment and prevention of the metabolic syndrome, diabetes, hypertension, atherogenic dyslipidemia, atherosclerosis, arteriosclerosis, coronary heart disease, or stroke. Their effects in these conditions may be as a result of or associated with their effect on body weight, or may be independent thereof.


Preferred medical uses include delaying or preventing disease progression in type 2 diabetes, treating metabolic syndrome, treating obesity or preventing overweight, for decreasing food intake, increase energy expenditure, reducing body weight, delaying the progression from impaired glucose tolerance (IGT) to type 2 diabetes; delaying the progression from type 2 diabetes to insulin-requiring diabetes; regulating appetite; inducing satiety; preventing weight regain after successful weight loss; treating a disease or state related to overweight or obesity; treating bulimia; treating binge eating; treating atherosclerosis, hypertension, type 2 diabetes, IGT, dyslipidemia, coronary heart disease, hepatic steatosis, treatment of beta-blocker poisoning, use for inhibition of the motility of the gastrointestinal tract, useful in connection with investigations of the gastrointestinal tract using techniques such as X-ray, CT- and NMR-scanning.


Further preferred medical uses include treatment or prevention of degenerative disorders, particularly neurodegenerative disorders such as Alzheimer's disease, Parkinson's disease, Huntington's disease, ataxia, e.g spinocerebellar ataxia, Kennedy disease, myotonic dystrophy, Lewy body dementia, multi-systemic atrophy, amyotrophic lateral sclerosis, primary lateral sclerosis, spinal muscular atrophy, prion-associated diseases, e.g. Creutzfeldt-Jacob disease, multiple sclerosis, telangiectasia, Batten disease, corticobasal degeneration, subacute combined degeneration of spinal cord, Tabes dorsalis, Tay-Sachs disease, toxic encephalopathy, infantile Refsum disease, Refsum disease, neuroacanthocytosis, Niemann-Pick disease, Lyme disease, Machado-Joseph disease, Sandhoff disease, Shy-Drager syndrome, wobbly hedgehog syndrome, proteopathy, cerebral β-amyloid angiopathy, retinal ganglion cell degeneration in glaucoma, synucleinopathies, tauopathies, frontotemporal lobar degeneration (FTLD), dementia, cadasil syndrome, hereditary cerebral hemorrhage with amyloidosis, Alexander disease, seipinopathies, familial amyloidotic neuropathy, senile systemic amyloidosis, serpinopathies, AL (light chain) amyloidosis (primary systemic amyloidosis), AH (heavy chain) amyloidosis, AA (secondary) amyloidosis, aortic medial amyloidosis, ApoAI amyloidosis, ApoAII amyloidosis, ApoAIV amyloidosis, familial amyloidosis of the Finnish type (FAF), Lysozyme amyloidosis, Fibrinogen amyloidosis, Dialysis amyloidosis, Inclusion body myositis/myopathy, Cataracts, Retinitis pigmentosa with rhodopsin mutations, medullary thyroid carcinoma, cardiac atrial amyloidosis, pituitary prolactinoma, Hereditary lattice corneal dystrophy, Cutaneous lichen amyloidosis, Mallory bodies, corneal lactoferrin amyloidosis, pulmonary alveolar proteinosis, odontogenic (Pindborg) tumor amyloid, cystic fibrosis, sickle cell disease or critical illness myopathy (CIM).


DETAILED DESCRIPTION OF THE INVENTION
Definitions

The amino acid sequences of the present invention contain the conventional one letter and three letter codes for naturally occuring amino acids, as well as generally accepted three letter codes for other amino acids, such as Aib (α-aminoisobutyric acid).


The term “native exendin-4” refers to native exendin-4 having the sequence











(SEQ ID NO: 1)



HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2. 






The invention provides peptidic compounds as defined above.


The peptidic compounds of the present invention comprise a linear backbone of amino carboxylic acids linked by peptide, i.e. carboxamide bonds. Preferably, the amino carboxylic acids are α-amino carboxylic acids and more preferably L-α-amino carboxylic acids, unless indicated otherwise. The peptidic compounds preferably comprise a backbone sequence of 39 amino carboxylic acids.


The peptidic compounds of the present invention may have unmodified side-chains, but carry at least one modification at one of the side chains.


For the avoidance of doubt, in the definitions provided herein, it is generally intended that the sequence of the peptidic moiety (I) differs from native exendin-4 at least at one of those positions which are stated to allow variation. Amino acids within the peptide moiety (I) can be considered to be numbered consecutively from 1 to 39 in the conventional N-terminal to C-terminal direction. Reference to a “position” within peptidic moiety (I) should be constructed accordingly, as should reference to positions within native exendin-4 and other molecules, e.g., in exendin-4, His is at position 1, Gly at position 2, . . . , Met at position 14, . . . and Ser at position 39.


An amino acid residue with an —NH2 side chain group, e.g. Lys, Orn, Dab or Dap, is functionalized in that at least one H atom of the —NH2 side chain group is replaced by —Z—C(O)—R5, wherein R5 comprises a lipophilic moiety, e.g. an acyclic linear or branched (C8-C30) saturated or unsaturated hydrocarbon group, which is unsubstituted or substituted e.g. by halogen, —OH and/or CO2H and Z comprises a linker in all stereoisomeric forms, e.g. a linker comprising one or more, e.g. 1 to 5, preferably 1, 2 or 3 amino acid linker groups selected from the group γ-Glutamate (γE) and AEEAc. Preferred groups R5 comprise a lipophilic moiety, e.g. an acyclic linear or branched (C12-C20) saturated or unsaturated hydrocarbon group, e.g. pentadecanyl, hexadecanyl or heptadecanyl, which is unsubstituted or substituted by CO2H, more preferably pentadecanyl, heptadecanyl or 16-carboxy-hexadecanyl. In one embodiment amino acid linker groups are selected from γE, γE-γE, AEEAc-AEEAc-γE and AEEAc-AEEAc-AEEAc. In another embodiment the amino acid linker group is γE. In another embodiment the amino acid linker group is γE-γE. In another embodiment the amino acid linker group is AEEAc-AEEAc-γE. In another embodiment the amino acid linker group is AEEAc-AEEAc-AEEAc.


In a further aspect, the present invention provides a composition comprising a compound of the invention as described herein, or a salt or solvate thereof, in admixture with a carrier.


The invention also provides the use of a compound of the present invention for use as a medicament, particularly for the treatment of a condition as described below.


The invention also provides a composition wherein the composition is a pharmaceutically acceptable composition, and the carrier is a pharmaceutically acceptable carrier.


Peptide Synthesis


The skilled person is aware of a variety of different methods to prepare peptides that are described in this invention. These methods include but are not limited to synthetic approaches and recombinant gene expression. Thus, one way of preparing these peptides is the synthesis in solution or on a solid support and subsequent isolation and purification. A different way of preparing the peptides is gene expression in a host cell in which a DNA sequence encoding the peptide has been introduced. Alternatively, the gene expression can be achieved without utilizing a cell system. The methods described above may also be combined in any way.


A preferred way to prepare the peptides of the present invention is solid phase synthesis on a suitable resin. Solid phase peptide synthesis is a well-established methodology (see for example: Stewart and Young, Solid Phase Peptide Synthesis, Pierce Chemical Co., Rockford, Ill., 1984; E. Atherton and R. C. Sheppard, Solid Phase Peptide Synthesis. A Practical Approach, Oxford-IRL Press, New York, 1989). Solid phase synthesis is initiated by attaching an N-terminally protected amino acid with its carboxy terminus to an inert solid support carrying a cleavable linker. This solid support can be any polymer that allows coupling of the initial amino acid, e.g. a trityl resin, a chlorotrityl resin, a Wang resin or a Rink resin in which the linkage of the carboxy group (or carboxamide for Rink resin) to the resin is sensitive to acid (when Fmoc strategy is used). The polymer support must be stable under the conditions used to deprotect the α-amino group during the peptide synthesis.


After the first amino acid has been coupled to the solid support, the α-amino protecting group of this amino acid is removed. The remaining protected amino acids are then coupled one after the other in the order represented by the peptide sequence using appropriate amide coupling reagents, for example BOP, HBTU, HATU or DIC (N,N′-diisopropylcarbodiimide)/HOBt (1-hydroxybenzotriazole), wherein BOP, HBTU and HATU are used with tertiary amine bases. Alternatively, the liberated N-terminus can be functionalized with groups other than amino acids, for example carboxylic acids, etc.


Usually, reactive side-chain groups of the amino acids are protected with suitable blocking groups. These protecting groups are removed after the desired peptides have been assembled. They are removed concomitantly with the cleavage of the desired product from the resin under the same conditions. Protecting groups and the procedures to introduce protecting groups can be found in Protective Groups in Organic Synthesis, 3d ed., Greene, T. W. and Wuts, P. G. M., Wiley & Sons (New York: 1999).


In some cases it might be desirable to have side-chain protecting groups that can selectively be removed while other side-chain protecting groups remain intact. In this case the liberated functionality can be selectively functionalized. For example, a lysine may be protected with an ivDde ([1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)-3-methylbutyl) protecting group (S. R. Chhabra et al., Tetrahedron Lett. 39, (1998), 1603) which is labile to a very nucleophilic base, for example 4% hydrazine in DMF (dimethyl formamide). Thus, if the N-terminal amino group and all side-chain functionalities are protected with acid labile protecting groups, the ivDde group can be selectively removed using 4% hydrazine in DMF and the corresponding free amino group can then be further modified, e.g. by acylation. The lysine can alternatively be coupled to a protected amino acid and the amino group of this amino acid can then be deprotected resulting in another free amino group which can be acylated or attached to further amino acids.


Finally the peptide is cleaved from the resin. This can be achieved by using King's cocktail (D. S. King, C. G. Fields, G. B. Fields, Int. J. Peptide Protein Res. 36, 1990, 255-266). The raw material can then be purified by chromatography, e.g. preparative RP-HPLC, if necessary.


Potency


As used herein, the term “potency” or “in vitro potency” is a measure for the ability of a compound to activate the receptors for GLP-1, glucagon or GIP in a cell-based assay. Numerically, it is expressed as the “EC50 value”, which is the effective concentration of a compound that induces a half maximal increase of response (e.g. formation of intracellular cAMP) in a dose-response experiment.


Therapeutic Uses


Metabolic syndrome is a combination of medical disorders that, when occurring together, increase the risk of developing type 2 diabetes, as well as atherosclerotic vascular disease, e.g. heart disease and stroke. Defining medical parameters for the metabolic syndrome include diabetes mellitus, impaired glucose tolerance, raised fasting glucose, insulin resistance, urinary albumin secretion, central obesity, hypertension, elevated triglycerides, elevated LDL cholesterol and reduced HDL cholesterol.


Obesity is a medical condition in which excess body fat has accumulated to the extent that it may have an adverse effect on health and life expectancy and due to its increasing prevalence in adults and children it has become one of the leading preventable causes of death in modern world. It increases the likelihood of various other diseases, including heart disease, type 2 diabetes, obstructive sleep apnoe, certain types of cancer, as well as osteoarthritis, and it is most commonly caused by a combination of excess food intake, reduced energy expenditure, as well as genetic susceptibility.


Diabetes mellitus, often simply called diabetes, is a group of metabolic diseases in which a person has high blood sugar levels, either because the body does not produce enough insulin, or because cells do not respond to the insulin that is produced. The most common types of diabetes are: (1) type 1 diabetes, where the body fails to produce insulin; (2) type 2 diabetes (T2DM), where the body fails to use insulin properly, combined with an increase in insulin deficiency over time, and (3) gestational diabetes, where women develop diabetes due to their pregnancy. All forms of diabetes increase the risk of long-term complications, which typically develop after many years. Most of these long-term complications are based on damage to blood vessels and can be divided into the two categories “macrovascular” disease, arising from atherosclerosis of larger blood vessels and “microvascular” disease, arising from damage of small blood vessels. Examples for macrovascular disease conditions are ischemic heart disease, myocardial infarction, stroke and peripheral vascular disease. Examples for microvascular diseases are diabetic retinopathy, diabetic nephropathy, as well as diabetic neuropathy.


The receptors for GLP-1 and GIP as well as glucagon are members of the family of 7-transmembrane-spanning, heterotrimeric G-protein coupled receptors. They are structurally related to each other and share not only a significant level of sequence identity, but have also similar mechanisms of ligand recognition and intracellular signaling pathways.


Similarly, the peptides GLP-1, GIP and glucagon share regions of high sequence identity/similarity. GLP-1 and glucagon are produced from a common precursor, preproglucagon, which is differentially processed in a tissue-specific manner to yield e.g. GLP-1 in intestinal endocrine cells and glucagon in alpha cells of pancreatic islets. GIP is derived from a larger proGIP prohormone precursor and is synthesized and released from K-cells located in the small intestine.


The peptidic incretin hormones GLP-1 and GIP are secreted by intestinal endocrine cells in response to food and account for up to 70% of meal-stimulated insulin secretion. Evidence suggests that GLP-1 secretion is reduced in subjects with impaired glucose tolerance or type 2 diabetes, whereas responsiveness to GLP-1 is still preserved in these patients. Thus, targeting of the GLP-1 receptor with suitable agonists offers an attractive approach for treatment of metabolic disorders, including diabetes. The receptor for GLP-1 is distributed widely, being found mainly in pancreatic islets, brain, heart, kidney and the gastrointestinal tract. In the pancreas, GLP-1 acts in a strictly glucose-dependent manner by increasing secretion of insulin from beta cells. This glucose-dependency shows that activation of GLP-1 receptors is unlikely to cause hypoglycemia. Also the receptor for GIP is broadly expressed in peripheral tissues including pancreatic islets, adipose tissue, stomach, small intestine, heart, bone, lung, kidney, testis, adrenal cortex, pituitary, endothelial cells, trachea, spleen, thymus, thyroid and brain. Consistent with its biological function as incretin hormone, the pancreatic β-cell express the highest levels of the receptor for GIP in humans. There is some clinical evidence that the GIP-receptor mediated signaling could be impaired in patients with T2DM but GIP-action is shown to be reversible and can be restored with improvement of the diabetic status. While there are many reports that also GIP action on insulin secretion is glucose-dependent, there are also reports in the literature that high plasma levels of GIP might lead to more frequent episodes of hypoglycemia (T McLaughlin et al., J Clin Endocrinol Metab, 95, 1851-1855, 2010; A Hadji-Georgopoulos, J Clin Endocrinol Metab, 56, 648-652, 1983). In addition, plasma GIP levels in obese subjects were reported to be higher than normal, suggesting that GIP might induce obesity and insulin resistance (W Creutzfeldt et al. Diabetologia. 1978, 14, 15-24). This is supported by reports that the ablation of the GIP receptor might prevent those conditions: GIP receptor knock-out mice fed on high-fat diet actually showed a suppression of body weight compared to wild-type mice (K Miyawaki et al. Nat Med. 2002, 8, 738-42), and long-term administration of the GIP receptor antagonist (Pro3)GIP also prevented obesity and insulin resistance in mice (V A Gault et al. Diabetologia. 2007, 50, 1752-62). Therefore, goal of this invention was to provide dual GLP-1/glucagon receptor agonists with reduced activity on the GIP receptor.


Glucagon is a 29 amino acid peptide hormone that is produced by pancreatic alpha cells and released into the bloodstream when circulating glucose is low. An important physiological role of glucagon is to stimulate glucose output in the liver, which is a process providing the major counterregulatory mechanism for insulin in maintaining glucose homeostasis in vivo.


Glucagon receptors are however also expressed in extra-hepatic tissues such as kidney, heart, adipocytes, lymphoblasts, brain, retina, adrenal gland and gastrointestinal tract, suggesting a broader physiological role beyond glucose homeostasis. Accordingly, recent studies have reported that glucagon has therapeutically positive effects on energy management, including stimulation of energy expenditure and thermogenesis, accompanied by reduction of food intake and body weight loss. Altogether, stimulation of glucagon receptors might be useful in the treatment of obesity and the metabolic syndrome.


Oxyntomodulin is a peptide hormone consisting of glucagon with an eight amino acids encompassing C-terminal extension. Like GLP-1 and glucagon, it is pre-formed in preproglucagon and cleaved and secreted in a tissue-specific manner by endocrinal cells of the small bowel. Oxyntomodulin is known to stimulate both, the receptors for GLP-1 and glucagon and is therefore the prototype of a dual agonist.


As GLP-1 is known for its anti-diabetic effects, GLP-1 and glucagon are both known for their food intake-suppressing effects and glucagon is also a mediator of additional energy expenditure, it is conceivable that a combination of the activities of the two hormones in one molecule can yield a powerful medication for treatment of the metabolic syndrome and in particular its components diabetes and obesity.


Accordingly, the compounds of the invention may be used for treatment of glucose intolerance, insulin resistance, pre-diabetes, increased fasting glucose (hyperglycemia), type 2 diabetes, hypertension, dyslipidemia, arteriosclerosis, coronary heart disease, peripheral artery disease, stroke or any combination of these individual disease components.


In addition, they may be used for control of appetite, feeding and calory intake, increase of energy expenditure, prevention of weight gain, promotion of weight loss, reduction of excess body weight and altogether treatment of obesity, including morbid obesity.


The compounds of the invention are agonists for the receptors for GLP-1 and for glucagon (e.g. “dual agonists”) with reduced activity on the GIP receptor and may provide therapeutic benefit to address a clinical need for targeting the metabolic syndrome by allowing simultaneous treatment of diabetes and obesity.


Further disease states and health conditions which could be treated with the compounds of the invention are obesity-linked inflammation, obesity-linked gallbladder disease and obesity-induced sleep apnea.


Although all these conditions could be associated directly or indirectly with obesity, the effects of the compounds of the invention may be mediated in whole or in part via an effect on body weight, or independent thereof.


Further, diseases to be treated are neurodegenerative diseases such as Alzheimer's disease or Parkinson's disease, or other degenerative diseases as described above.


In one embodiment the compounds are useful in the treatment or prevention of hyperglycemia, type 2 diabetes, obesity.


Compared to GLP-1, glucagon and oxyntomodulin, exendin-4 has beneficial physicochemical properties, such as solubility and stability in solution and under physiological conditions (including enzymatic stability towards degradation by enzymes, such as DPP4 or NEP), which results in a longer duration of action in vivo. Therefore, the pure GLP-1 receptor agonist exendin-4 might serve as good starting scaffold to obtain exendin-4 analogues with dual GLP-1/glucagon receptor agonism.


Nevertheless, also exendin-4 has been shown to be chemically labile due to methionine oxdiation in position 14 as well as deamidation and isomerization of asparagine in position 28. Therefore, stability might be further improved by substitution of methionine at position 14 and the avoidance of sequences that are known to be prone to degradation via aspartimide formation, especially Asp-Gly or Asn-Gly at positions 28 and 29.


Pharmaceutical Compositions


The term “pharmaceutical composition” indicates a mixture containing ingredients that are compatible when mixed and which may be administered. A pharmaceutical composition may include one or more medicinal drugs. Additionally, the pharmaceutical composition may include carriers, buffers, acidifying agents, alkalizing agents, solvents, adjuvants, tonicity adjusters, emollients, expanders, preservatives, physical and chemical stabilizers e.g. surfactants, antioxidants and other components, whether these are considered active or inactive ingredients. Guidance for the skilled in preparing pharmaceutical compositions may be found, for example, in Remington: The Science and Practice of Pharmacy, (20th ed.) ed. A. R. Gennaro A. R., 2000, Lippencott Williams & Wilkins and in R. C. Rowe et al (Ed), Handbook of Pharmaceutical Excipients, PhP, May 2013 update.


The exendin-4 peptide derivatives of the present invention, or salts thereof, are administered in conjunction with an acceptable pharmaceutical carrier, diluent, or excipient as part of a pharmaceutical composition. A “pharmaceutically acceptable carrier” is a carrier which is physiologically acceptable (e.g. physiologically acceptable pH) while retaining the therapeutic properties of the substance with which it is administered. Standard acceptable pharmaceutical carriers and their formulations are known to one skilled in the art and described, for example, in Remington: The Science and Practice of Pharmacy, (20th ed.) ed. A. R. Gennaro A. R., 2000, Lippencott Williams & Wilkins and in R. C. Rowe et al (Ed), Handbook of Pharmaceutical excipients, PhP, May 2013 update. One exemplary pharmaceutically acceptable carrier is physiological saline solution.


In one embodiment carriers are selected from the group of buffers (e.g. citrate/citric acid), acidifying agents (e.g. hydrochloric acid), alkalizing agents (e.g. sodium hydroxide), preservatives (e.g. phenol), co-solvents (e.g. polyethylene glycol 400), tonicity adjusters (e.g. mannitol), stabilizers (e.g. surfactant, antioxidants, amino acids).


Concentrations used are in a range that is physiologically acceptable.


Acceptable pharmaceutical carriers or diluents include those used in formulations suitable for oral, rectal, nasal or parenteral (including subcutaneous, intramuscular, intravenous, intradermal, and transdermal) administration. The compounds of the present invention will typically be administered parenterally.


The term “pharmaceutically acceptable salt” means salts of the compounds of the invention which are safe and effective for use in mammals. Pharmaceutically acceptable salts may include, but are not limited to, acid addition salts and basic salts. Examples of acid addition salts include chloride, sulfate, hydrogen sulfate, (hydrogen) phosphate, acetate, citrate, tosylate or mesylate salts. Examples of basic salts include salts with inorganic cations, e.g. alkaline or alkaline earth metal salts such as sodium, potassium, magnesium or calcium salts and salts with organic cations such as amine salts. Further examples of pharmaceutically acceptable salts are described in Remington: The Science and Practice of Pharmacy, (20th ed.) ed. A. R. Gennaro A. R., 2000, Lippencott Williams & Wilkins or in Handbook of Pharmaceutical Salts, Properties, Selection and Use, e.d. P. H. Stahl, C. G. Wermuth, 2002, jointly published by Verlag Helvetica Chimica Acta, Zurich, Switzerland, and Wiley-VCH, Weinheim, Germany.


The term “solvate” means complexes of the compounds of the invention or salts thereof with solvent molecules, e.g. organic solvent molecules and/or water.


In the pharmaceutical composition, the exendin-4 derivative can be in monomeric or oligomeric form.


The term “therapeutically effective amount” of a compound refers to a nontoxic but sufficient amount of the compound to provide the desired effect. The amount of a compound of the formula (I) necessary to achieve the desired biological effect depends on a number of factors, for example the specific compound chosen, the intended use, the mode of administration and the clinical condition of the patient. An appropriate “effective” amount in any individual case may be determined by one of ordinary skill in the art using routine experimentation. For example the “therapeutically effective amount” of a compound of the formula (I) is about 0.01 to 50 mg/dose, preferably 0.1 to 10 mg/dose.


Pharmaceutical compositions of the invention are those suitable for parenteral (for example subcutaneous, intramuscular, intradermal or intravenous), oral, rectal, topical and peroral (for example sublingual) administration, although the most suitable mode of administration depends in each individual case on the nature and severity of the condition to be treated and on the nature of the compound of formula (I) used in each case.


Suitable pharmaceutical compositions may be in the form of separate units, for example capsules, tablets and powders in vials or ampoules, each of which contains a defined amount of the compound; as powders or granules; as solution or suspension in an aqueous or nonaqueous liquid; or as an oil-in-water or water-in-oil emulsion. It may be provided in single or multiple dose injectable form, for example in the form of a pen. The compositions may, as already mentioned, be prepared by any suitable pharmaceutical method which includes a step in which the active ingredient and the carrier (which may consist of one or more additional ingredients) are brought into contact.


In certain embodiments the pharmaceutical composition may be provided together with a device for application, for example together with a syringe, an injection pen or an autoinjector. Such devices may be provided separate from a pharmaceutical composition or prefilled with the pharmaceutical composition.


Combination Therapy


The compounds of the present invention, dual agonists for the GLP-1 and glucagon receptors, can be widely combined with other pharmacologically active compounds, such as all drugs mentioned in the Rote Liste 2014, e.g. with all weight-reducing agents or appetite suppressants mentioned in the Rote Liste 2014, chapter 1, all lipid-lowering agents mentioned in the Rote Liste 2014, chapter 58, all antihypertensives and nephroprotectives, mentioned in the Rote Liste 2014, or all diuretics mentioned in the Rote Liste 2014, chapter 36.


The active ingredient combinations can be used especially for a synergistic improvement in action. They can be applied either by separate administration of the active ingredients to the patient or in the form of combination products in which a plurality of active ingredients are present in one pharmaceutical preparation. When the active ingredients are administered by separate administration of the active ingredients, this can be done simultaneously or successively.


Most of the active ingredients mentioned hereinafter are disclosed in the USP Dictionary of USAN and International Drug Names, US Pharmacopeia, Rockville 2011.


Other active substances which are suitable for such combinations include in particular those which for example potentiate the therapeutic effect of one or more active substances with respect to one of the indications mentioned and/or which allow the dosage of one or more active substances to be reduced.


Therapeutic agents which are suitable for combinations include, for example, antidiabetic agents such as:


Insulin and Insulin derivatives, for example: Glargine/Lantus®, 270-330 U/mL of insulin glargine (EP 2387989 A), 300 U/mL of insulin glargine (EP 2387989 A), Glulisin/Apidra®, Detemir/Levemir®, Lispro/Humalog®/Liprolog®, Degludec/DegludecPlus, Aspart, basal insulin and analogues (e.g. LY-2605541, LY2963016, NN1436), PEGylated insulin Lispro, Humulin®, Linjeta, SuliXen®, NN1045, Insulin plus Symlin, PE0139, fast-acting and short-acting insulins (e.g. Linjeta, PH20, NN1218, HinsBet), (APC-002)hydrogel, oral, inhalable, transdermal and sublingual insulins (e.g. Exubera®, Nasulin®, Afrezza, Tregopil, TPM 02, Capsulin, Oral-Lyn®, Cobalamin® oral insulin, ORMD-0801, NN1953, NN1954, NN1956, VIAtab, Oshadi oral insulin). Additionally included are also those insulin derivatives which are bonded to albumin or another protein by a bifunctional linker.


GLP-1, GLP-1 analogues and GLP-1 receptor agonists, for example: Lixisenatide/AVE0010/ZP10/Lyxumia, Exenatide/Exendin-4/Byetta/Bydureon/ITCA 650/AC-2993, Liraglutide/Victoza, Semaglutide, Taspoglutide, Syncria/Albiglutide, Dulaglutide, rExendin-4, CJC-1134-PC, PB-1023, TTP-054, Langlenatide/HM-11260C, CM-3, GLP-1 Eligen, ORMD-0901, NN-9924, NN-9926, NN-9927, Nodexen, Viador-GLP-1, CVX-096, ZYOG-1, ZYD-1, GSK-2374697, DA-3091, MAR-701, MAR709, ZP-2929, ZP-3022, TT-401, BHM-034. MOD-6030, CAM-2036, DA-15864, ARI-2651, ARI-2255, Exenatide-XTEN and Glucagon-Xten.


DPP4 inhibitors, for example: Alogliptin/Nesina, Trajenta/Linagliptin/BI-1356/Ondero/Trajenta/Tradjenta/Trayenta/Tradzenta, Saxagliptin/Onglyza, Sitagliptin/Januvia/Xelevia/Tesave/Janumet/Velmetia, Galvus/Vildagliptin, Anagliptin, Gemigliptin, Teneligliptin, Melogliptin, Trelagliptin, DA-1229, Omarigliptin/MK-3102, KM-223, Evogliptin, ARI-2243, PBL-1427, Pinoxacin.


SGLT2 inhibitors, for example: Invokana/Canaglifozin, Forxiga/Dapagliflozin, Remoglifozin, Sergliflozin, Empagliflozin, Ipragliflozin, Tofogliflozin, Luseogliflozin, LX-4211, Ertuglifozin/PF-04971729, RO-4998452, EGT-0001442, KGA-3235/DSP-3235, LIK066, SBM-TFC-039, Biguanides (e.g. Metformin, Buformin, Phenformin), Thiazolidinediones (e.g. Pioglitazone, Rivoglitazone, Rosiglitazone, Troglitazone), dual PPAR agonists (e.g. Aleglitazar, Muraglitazar, Tesaglitazar), Sulfonylureas (e.g. Tolbutamide, Glibenclamide, Glimepiride/Amaryl, Glipizide), Meglitinides (e.g. Nateglinide, Repaglinide, Mitiglinide), Alpha-glucosidase inhibitors (e.g. Acarbose, Miglitol, Voglibose), Amylin and Amylin analogues (e.g. Pramlintide, Symlin).


GPR119 agonists (e.g. GSK-263A, PSN-821, MBX-2982, APD-597, ZYG-19, DS-8500), GPR40 agonists (e.g. Fasiglifam/TAK-875, TUG-424, P-1736, JTT-851, GW9508).


Other suitable combination partners are: Cycloset, inhibitors of 11-beta-HSD (e.g. LY2523199, BMS770767, RG-4929, BMS816336, AZD-8329, HSD-016, BI-135585), activators of glucokinase (e.g. TTP-399, AMG-151, TAK-329, GKM-001), inhibitors of DGAT (e.g. LCQ-908), inhibitors of protein tyrosinephosphatase 1 (e.g. Trodusquemine), inhibitors of glucose-6-phosphatase, inhibitors of fructose-1,6-bisphosphatase, inhibitors of glycogen phosphorylase, inhibitors of phosphoenol pyruvate carboxykinase, inhibitors of glycogen synthase kinase, inhibitors of pyruvate dehydrokinase, alpha2-antagonists, CCR-2 antagonists, SGLT-1 inhibitors (e.g. LX-2761), dual SGLT2/SGLT1 inhibitors.


One or more lipid lowering agents are also suitable as combination partners, such as for example: HMG-CoA-reductase inhibitors (e.g. Simvastatin, Atorvastatin), fibrates (e.g. Bezafibrate, Fenofibrate), nicotinic acid and the derivatives thereof (e.g. Niacin), PPAR-(alpha, gamma or alpha/gamma) agonists or modulators (e.g. Aleglitazar), PPAR-delta agonists, ACAT inhibitors (e.g. Avasimibe), cholesterol absorption inhibitors (e.g. Ezetimibe), Bile acid-binding substances (e.g. Cholestyramine), ileal bile acid transport inhibitors, MTP inhibitors, or modulators of PCSK9.


HDL-raising compounds such as: CETP inhibitors (e.g. Torcetrapib, Anacetrapid, Dalcetrapid, Evacetrapid, JTT-302, DRL-17822, TA-8995) or ABC1 regulators.


Other suitable combination partners are one or more active substances for the treatment of obesity, such as for example: Sibutramine, Tesofensine, Orlistat, antagonists of the cannabinoid-1 receptor, MCH-1 receptor antagonists, MC4 receptor agonists, NPY5 or NPY2 antagonists (e.g. Velneperit), beta-3-agonists, leptin or leptin mimetics, agonists of the 5HT2c receptor (e.g. Lorcaserin), or the combinations of bupropione/naltrexone, bupropione/zonisamide, bupropione/phentermine or pramlintide/metreleptin.


Other suitable combination partners are:


Further gastrointestinal peptides such as Peptide YY 3-36 (PYY3-36) or analogues thereof, pancreatic polypeptide (PP) or analogues thereof.


Glucagon receptor agonists or antagonists, GIP receptor agonists or antagonists, ghrelin antagonists or inverse agonists, Xenin and analogues thereof.


Moreover, combinations with drugs for influencing high blood pressure, chronic heart failure or atherosclerosis, such as e.g. Angiotensin II receptor antagonists (e.g. telmisartan, candesartan, valsartan, losartan, eprosartan, irbesartan, olmesartan, tasosartan, azilsartan), ACE inhibitors, ECE inhibitors, diuretics, beta-blockers, calcium antagonists, centrally acting hypertensives, antagonists of the alpha-2-adrenergic receptor, inhibitors of neutral endopeptidase, thrombocyte aggregation inhibitors and others or combinations thereof are suitable.


In another aspect, this invention relates to the use of a compound according to the invention or a physiologically acceptable salt thereof combined with at least one of the active substances described above as a combination partner, for preparing a medicament which is suitable for the treatment or prevention of diseases or conditions which can be affected by binding to the receptors for GLP-1 and glucagon and by modulating their activity. This is preferably a disease in the context of the metabolic syndrome, particularly one of the diseases or conditions listed above, most particularly diabetes or obesity or complications thereof.


The use of the compounds according to the invention, or a physiologically acceptable salt thereof, in combination with one or more active substances may take place simultaneously, separately or sequentially.


The use of the compound according to the invention, or a physiologically acceptable salt thereof, in combination with another active substance may take place simultaneously or at staggered times, but particularly within a short space of time. If they are administered simultaneously, the two active substances are given to the patient together; if they are used at staggered times, the two active substances are given to the patient within a period of less than or equal to 12 hours, but particularly less than or equal to 6 hours.


Consequently, in another aspect, this invention relates to a medicament which comprises a compound according to the invention or a physiologically acceptable salt of such a compound and at least one of the active substances described above as combination partners, optionally together with one or more inert carriers and/or diluents.


The compound according to the invention, or physiologically acceptable salt or solvate thereof, and the additional active substance to be combined therewith may both be present together in one formulation, for example a in a vial or a cartridge, or separately in two identical or different formulations, for example as so-called kit-of-parts.





LEGENDS TO THE FIGURES


FIG. 1. Body weight development during 4 weeks of subcutaneous treatment with SEQ ID NO: 7 and SEQ ID NO: 8, 50 μg/kg bid in female high-fat fed C57BL/6 mice. Data are mean+SEM.



FIG. 2. Relative body weight change in % during 4 weeks of subcutaneous treatment with SEQ ID NO: 7 and SEQ ID NO: 8, 50 μg/kg bid in female high-fat fed C57BL/6 mice. Data are mean+SEM.



FIG. 3. Determination of total fat mass measured by nuclear magnetic resonance (NMR), two days before and after 4 weeks of treatment with SEQ ID NO: 7 and SEQ ID NO: 8, 50 μg/kg bid in female high-fat fed C57BL/6 mice. Data are mean+SEM.



FIG. 4. Acute effect of s.c. administration of compound SEQ ID NO: 7 and SEQ ID NO: 8 50 μg/kg on blood glucose in female high-fat fed C57BL/6 mice. Data are mean+SEM.



FIG. 5. Acute effect of s.c. administration of compound SEQ ID NO: 15, 50 μg/kg qd on blood glucose in female high-fat fed C57BL/6 mice. Data are mean+SEM.



FIG. 6. Relative body weight change in % during 4 weeks of subcutaneous treatment with SEQ ID NO: 15, 50 μg/kg qd in female high-fat fed C57BL/6 mice. Data are mean+SEM.



FIG. 7. Determination of total fat mass measured by nuclear magnetic resonance (NMR), two days before and after 4 weeks of treatment with SEQ ID NO: 15, 50 μg/kg qd in female high-fat fed C57BL/6 mice. Data are mean+SEM.





METHODS
Abbreviations Employed are as Follows



  • AA amino acid

  • AEEAc (2-(2-aminoethoxy)ethoxy)acetyl

  • cAMP cyclic adenosine monophosphate

  • Boc tert-butyloxycarbonyl

  • BOP (benzotriazol-1-yloxy)tris(dimethylamino)phosphonium hexafluorophosphate

  • BSA bovine serum albumin

  • tBu tertiary butyl

  • DCM dichloromethane

  • Dde 1-(4,4-dimethyl-2,6-dioxocyclohexylidene)-ethyl

  • ivDde 1-(4,4-dimethyl-2,6-dioxocyclohexylidene)-3-methyl-butyl

  • DIC N,N′-diisopropylcarbodiimide

  • DIPEA N,N-diisopropylethylamine

  • DMEM Dulbecco's modified Eagle's medium

  • DMF dimethyl formamide

  • DMS dimethylsulfide

  • EDT ethanedithiol

  • FA formic acid

  • FBS fetal bovine serum

  • Fmoc fluorenylmethyloxycarbonyl

  • HATU O-(7-azabenzotriazol-1-yl)-N,N,N′,N′-tetramethyluronium hexafluorophosphate

  • HBSS Hanks' Balanced Salt Solution

  • HBTU 2-(1H-benzotriazol-1-yl)-1,1,3,3-tetramethyl-uronium hexafluorophosphate

  • HEPES 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid

  • HOBt 1-hydroxybenzotriazole

  • HOSu N-hydroxysuccinimide

  • HPLC High Performance Liquid Chromatography

  • HTRF Homogenous Time Resolved Fluorescence

  • IBMX 3-isobutyl-1-methylxanthine

  • LC/MS Liquid Chromatography/Mass Spectrometry

  • Mint monomethoxy-trityl

  • Palm palmitoyl

  • PBS phosphate buffered saline

  • PEG polyethylene glycole

  • PK pharmacokinetic

  • RP-HPLC reversed-phase high performance liquid chromatography

  • Stea stearyl

  • TFA trifluoro acetic acid

  • Trt trityl

  • UV ultraviolet

  • γ-E γ-Glutamate



General Synthesis of Peptidic Compounds


Materials


Different Rink-Amide resins (4-(2′,4′-Dimethoxyphenyl-Fmoc-aminomethyl)-phenoxyacetamido-norleucylaminomethyl resin, Merck Biosciences; 4-[(2,4-Dimethoxyphenyl)(Fmoc-amino)methyl]phenoxy acetamido methyl resin, Agilent Technologies) were used for the synthesis of peptide amides with loadings in the range of 0.2-0.7 mmol/g.


Fmoc protected natural amino acids were purchased from Protein Technologies Inc., Senn Chemicals, Merck Biosciences, Novabiochem, Iris Biotech, Bachem, Chem-Impex International or MATRIX Innovation. The following standard amino acids were used throughout the syntheses: Fmoc-L-Ala-OH, Fmoc-Arg(Pbf)-OH, Fmoc-L-Asn(Trt)-OH, Fmoc-L-Asp(OtBu)-OH, Fmoc-L-Cys(Trt)-OH, Fmoc-L-Gln(Trt)-OH, Fmoc-L-Glu(OtBu)-OH, Fmoc-Gly-OH, Fmoc-L-His(Trt)-OH, Fmoc-L-Ile-OH, Fmoc-L-Leu-OH, Fmoc-L-Lys(Boc)-OH, Fmoc-L-Met-OH, Fmoc-L-Phe-OH, Fmoc-L-Pro-OH, Fmoc-L-Ser(tBu)-OH, Fmoc-L-Thr(tBu)-OH, Fmoc-L-Trp(Boc)-OH, Fmoc-L-Tyr(tBu)-OH, Fmoc-L-Val-OH.


In addition, the following special amino acids were purchased from the same suppliers as above: Fmoc-L-Lys(ivDde)-OH, Fmoc-L-Lys(Mmt)-OH, Fmoc-Aib-OH, Fmoc-D-Ser(tBu)-OH, Fmoc-D-Ala-OH, Boc-L-His(Boc)-OH (available as toluene solvate) and Boc-L-His(Trt)-OH.


The solid phase peptide syntheses were performed for example on a Prelude Peptide Synthesizer (Protein Technologies Inc) or similar automated synthesizer using standard Fmoc chemistry and HBTU/DIPEA activation. DMF was used as the solvent. Deprotection: 20% piperidine/DMF for 2×2.5 min. Washes: 7×DMF Coupling 2:5:10 200 mM AA/500 mM HBTU/2M DIPEA in DMF 2× for 20 min. Washes: 5×DMF.


In cases where a Lys-side-chain was modified, Fmoc-L-Lys(ivDde)-OH or Fmoc-L-Lys(Mmt)-OH was used in the corresponding position. After completion of the synthesis, the ivDde group was removed according to a modified literature procedure (S. R. Chhabra et al., Tetrahedron Lett. 39, (1998), 1603), using 4% hydrazine hydrate in DMF. The Mmt group was removed by repeated treatment with 1% TFA in dichloromethane. The following acylations were carried out by treating the resin with the N-hydroxy succinimide esters of the desired acid or using coupling reagents like HBTU/DIPEA or HOBt/DIC.


All the peptides that have been synthesized were cleaved from the resin with King's cleavage cocktail consisting of 82.5% TFA, 5% phenol, 5% water, 5% thioanisole, 2.5% EDT. The crude peptides were then precipitated in diethyl or diisopropyl ether, centrifuged, and lyophilized Peptides were analyzed by analytical HPLC and checked by ESI mass spectrometry. Crude peptides were purified by a conventional preparative RP-HPLC purification procedure.


Alternatively, peptides were synthesized by a manual synthesis procedure:


0.3 g Desiccated Rink amide MBHA Resin (0.66 mmol/g) was placed in a polyethylene vessel equipped with a polypropylene filter. Resin was swelled in DCM (15 ml) for 1 h and DMF (15 ml) for 1 h. The Fmoc group on the resin was de-protected by treating it twice with 20% (v/v) piperidine/DMF solution for 5 and 15 min. The resin was washed with DMF/DCM/DMF (6:6:6 time each). A Kaiser test (quantitative method) was used for the conformation of removal of Fmoc from solid support. The C-terminal Fmoc-amino acid (5 equiv. excess corresponding to resin loading) in dry DMF was added to the de-protected resin and coupling was initiated with 5 equivalent excess of DIC and HOBT in DMF. The concentration of each reactant in the reaction mixture was approximately 0.4 M. The mixture was rotated on a rotor at room temperature for 2 h. Resin was filtered and washed with DMF/DCM/DMF (6:6:6 time each). Kaiser test on peptide resin aliquot upon completion of coupling was negative (no colour on the resin). After the first amino acid attachment, the unreacted amino group, if any, in the resin was capped used acetic anhydride/pyridine/DCM (1:8:8) for 20 minutes to avoid any deletion of the sequence. After capping, resin was washed with DCM/DMF/DCM/DMF (6/6/6/6 time each). The Fmoc group on the C-terminal amino acid attached peptidyl resin was deprotected by treating it twice with 20% (v/v) piperidine/DMF solution for 5 and 15 min. The resin was washed with DMF/DCM/DMF (6:6:6 time each). The Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive.


The remaining amino acids in target sequence on Rink amide MBHA Resin were sequentially coupled using Fmoc AA/DIC/HOBt method using 5 equivalent excess corresponding to resin loading in DMF. The concentration of each reactant in the reaction mixture was approximately 0.4 M. The mixture was rotated on a rotor at room temperature for 2 h. Resin was filtered and washed with DMF/DCM/DMF (6:6:6 time each). After each coupling step and Fmoc deprotection step, a Kaiser test was carried out to confirm the completeness of the reaction.


After the completion of the linear sequence, the ε-amino group of lysine used as branching point or modification point was deprotected by using 2.5% hydrazine hydrate in DMF for 15 min×2 and washed with DMF/DCM/DMF (6:6:6 time each). The γ-carboxyl end of glutamic acid was attached to the ε-amino group of Lys using Fmoc-Glu(OH)-OtBu with DIC/HOBt method (5 equivalent excess with respect to resin loading) in DMF. The mixture was rotated on a rotor at room temperature for 2 h. The resin was filtered and washed with DMF/DCM/DMF (6×30 ml each). The Fmoc group on the glutamic acid was de-protected by treating it twice with 20% (v/v) piperidine/DMF solution for 5 and 15 min (25 ml each). The resin was washed with DMF/DCM/DMF (6:6:6 time each). A Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive.


If the side-chain branching also contains one more γ-glutamic acid, a second Fmoc-Glu(OH)-OtBu used for the attachment to the free amino group of γ-glutamic acid with DIC/HOBt method (5 equivalent excess with respect to resin loading) in DMF. The mixture was rotated on a rotor at room temperature for 2 h. Resin was filtered and washed with DMF/DCM/DMF (6×30 ml each). The Fmoc group on the γ-glutamic acid was de-protected by treating it twice with 20% (v/v) piperidine/DMF solution for 5 and 15 min (25 mL). The resin was washed with DMF/DCM/DMF (6:6:6 time each). A Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive.


Palmitic Acid & Stearic Acid Attachment to Side Chains of Glutamic Acid:


To the free amino group of γ-glutamic acid, palmitic acid or stearic acid (5 equiv.) dissolved in DMF was added and coupling was initiated by the addition of DIC (5 equiv.) and HOBt (5 equiv.) in DMF. The resin was washed with DMF/DCM/DMF (6:6:6 time each).


Final Cleavage of Peptide from the Resin:


The peptidyl resin synthesized by manual synthesis was washed with DCM (6×10 ml), MeOH (6×10 ml) and ether (6×10 ml) and dried in vacuum desiccators overnight. The cleavage of the peptide from the solid support was achieved by treating the peptide-resin with reagent cocktail (80.0% TFA/5% thioanisole/5% phenol/2.5% EDT, 2.5% DMS and 5% DCM) at room temperature for 3 h. Cleavage mixture was collected by filtration and the resin was washed with TFA (2 ml) and DCM (2×5 ml). The excess TFA and DCM was concentrated to small volume under nitrogen and a small amount of DCM (5-10 ml) was added to the residue and evaporated under nitrogen. The process was repeated 3-4 times to remove most of the volatile impurities. The residue was cooled to 0° C. and anhydrous ether was added to precipitate the peptide. The precipitated peptide was centrifuged and the supernatant ether was removed and fresh ether was added to the peptide and re-centrifuged. The crude sample was preparative HPLC purified and lyophilized. The identity of peptide was confirmed by LCMS.


Analytical HPLC/UPLC


Method A: Detection at 210-225 nm

  • column: Waters ACQUITY UPLC® CSH™ C18 1.7 μm (150×2.1 mm) at 50° C.
  • solvent: H2O+0.5% TFA:ACN+0.35% TFA (flow 0.5 ml/min)
  • gradient: 80:20 (0 min) to 80:20 (3 min) to 25:75 (23 min) to 2:98 (23.5 min) to 2:98 (30.5 min) to 80:20 (31 min) to 80:20 (37 min)
  • optionally with mass analyser: LCT Premier, electrospray positive ion mode


Method B: Detection at 210-225 nm

  • column: Aries prep XBC 18 (4.6×250 mm×3.6 μm), Temp: 25° C.
  • solvent: H2O+0.1% TFA:ACN+0.1% TFA (flow 1 ml/min)
  • gradient: Equilibration of the column with 2% buffer B and elution by a gradient of 2% to 70% buffer B during 15 min.


General Preparative HPLC Purification Procedure


The crude peptides were purified either on an Äkta Purifier System, a Jasco semiprep HPLC System or a Agilent 1100 HPLC system. Preparative RP-C18-HPLC columns of different sizes and with different flow rates were used depending on the amount of crude peptide to be purified. Acetonitrile+0.1% TFA (B) and water+0.1% TFA (A) were employed as eluents. Product-containing fractions were collected and lyophilized to obtain the purified product, typically as TFA salt.


Solubility and Stability-Testing of Exendin-4 Derivatives


Prior to the testing of solubility and stability of a peptide batch, its purity (HPLC-UV) was determined.


For solubility testing, the target concentration was 10 mg pure compound/ml. Therefore, solutions from solid samples were prepared in different buffer systems with a concentration of 10 mg/mL compound based on the previously determined % purity. HPLC-UV was performed after 2 h of gentle agitation from the supernatant, which was obtained by 20 min of centrifugation at 4500 rpm.


The solubility was then determined by comparison of a 0.2 μL-injection with the UV peak areas obtained with a stock solution of the peptide at a concentration of 1.2 mg/mL in DMSO (based on % purity), injecting various volumes ranging from 0.2-2 μl. This analysis also served as starting point (t0) for the stability testing.


For stability testing, an aliquot of the supernatant obtained for solubility was stored for 7 days at 40° C. After that time course, the sample was centrifuged for 20 min at 4500 rpm and 0.2 μL of the supernatant were analysed with HPLC-UV.


For determination of the amount of the remaining peptide, the peak areas of the target compound at t0 and t7 were compared, resulting in “% remaining peptide”, following the equation

% remaining peptide=[(peak area peptide t7)×100]/peak area peptide t0.


The stability is expressed as “% remaining peptide”.


As HPLC/UPLC method Method B has been used, detecting at 214 nM.


In Vitro Cellular Assays for GLP-1, Glucagon and GIP Receptor Efficacy


Agonism of compounds for the receptors was determined by functional assays measuring cAMP response of HEK-293 cell lines stably expressing human GLP-1, GIP or glucagon receptor.


cAMP content of cells was determined using a kit from Cisbio Corp. (cat. no. 62AM4PEC) based on HTRF (Homogenous Time Resolved Fluorescence). For preparation, cells were split into T175 culture flasks and grown overnight to near confluency in medium (DMEM/10% FBS). Medium was then removed and cells washed with PBS lacking calcium and magnesium, followed by proteinase treatment with accutase (Sigma-Aldrich cat. no. A6964). Detached cells were washed and resuspended in assay buffer (1×HBSS; 20 mM HEPES, 0.1% BSA, 2 mM IBMX) and cellular density determined. They were then diluted to 400000 cells/ml and 25 μl-aliquots dispensed into the wells of 96-well plates. For measurement, 25 μl of test compound in assay buffer was added to the wells, followed by incubation for 30 minutes at room temperature. After addition of HTRF reagents diluted in lysis buffer (kit components), the plates were incubated for 1 hr, followed by measurement of the fluorescence ratio at 665/620 nm. In vitro potency of agonists was quantified by determining the concentrations that caused 50% activation of maximal response (EC50).


Bioanalytical Screening Method for Quantification of Exendin-4 Derivatives in Mice and Pigs


Mice were dosed 1 mg/kg subcutaneously (s.c.). The mice were sacrified and blood samples were collected after 0.25, 0.5, 1, 2, 4, 8, 16 and 24 hours post application. Plasma samples were analyzed after protein precipitation via liquid chromatography mass spectrometry (LC/MS). PK parameters and half-life were calculated using WinonLin Version 5.2.1 (non-compartment model).


Female Göttinger minipigs were dosed 0.1 mg/kg subcutaneously (s.c.). Blood samples were collected after 0.25, 0.5, 1, 2, 4, 8, 24, 32, 48, 56 and 72 hours post application. Plasma samples were analyzed after protein precipitation via liquid chromatography mass spectrometry (LC/MS). PK parameters and half-life were calculated using WinonLin Version 5.2.1 (non-compartment model).


Gastric Emptying and Intestinal Passage in Mice


Female NMRI-mice of a body weight between 20 and 30 g are used. Mice are adapted to housing conditions for at least one week.


Mice are overnight fasted, while water remains available all the time. On the study day, mice are weighed, single-caged and allowed access to 500 mg of feed for 30 min, while water is removed. At the end of the 30 min feeding period, remaining feed is removed and weighed. 60 min later, a coloured, non-caloric bolus is instilled via gavage into the stomach. The test compound/reference compound or its vehicle in the control group is administered subcutaneously, to reach Cmax when coloured bolus is administered. After another 30 min, the animals are sacrificed and the stomach and the small intestine prepared. The filled stomach is weighed, emptied, carefully cleaned and dried and reweighed. The calculated stomach content indicates the degree of gastric emptying. The small intestine is straightened without force and measured in length. Then the distance from the gastric beginning of the gut to the tip of the farthest travelled intestinal content bolus is measured. The intestinal passage is given as relation in percent of the latter distance and the total length of the small intestine. Comparable data can be obtained for both female and male mice.


Statistical analyses are performed with Everstat 6.0 by 1-way-ANOVA, followed by Dunnetts or Newman-Keuls as post-hoc test, respectively. Differences are considered statistically significant at the p<0.05 level. As post hoc test Dunnet's Test is applied to compare versus vehicle control, only. Newman-Keul's Test is applied for all pairwise comparisons (i.e. versus vehicle and reference groups).


Automated Assessment of Feed Intake in Mice


Female NMRI-mice of a body weight between 20 and 30 g are used. Mice are adapted to housing conditions for at least one week and for at least one day single-caged in the assessment equipment, when basal data are recorded simultaneously. On the study day, test product is administered subcutaneously close to the lights-off phase (12 h lights off) and assessment of feed consumption is directly started afterwards. Assessment included continued monitoring (every 30 min) over 22 hours. Repetition of this procedure over several days is possible. Restriction of assessment to 22 hours is for practical reasons to allow for reweighing of animals, refilling of feed and water and drug administration between procedures. Results can be assessed as cumulated data over 22 hours or differentiated to 30 min intervals. Comparable data can be obtained for both female and male mice.


Statistical analyses are performed with Everstat 6.0 by two-way ANOVA on repeated measures and Dunnett's post-hoc analyses. Differences are considered statistically significant at the p<0.05 level.


Acute and Chronic Effects After Subcutaneous Treatment on Blood Glucose and Body Weight in Female Diet-Induced Obese (DIO) C57BL/6 Mice


C57BL/6 Harlan mice are housed in groups in a specific pathogen-free barrier facility on a 12 h light/dark cycle with free access to water and standard or high-fat diet. After prefeeding on high-fat diet, mice are stratified to treatment groups (n=8), so that each group has similar mean body weight. An age-matched group with ad-libitum access to standard chow is included as standard control group. Before the experiment, mice are subcutaneously (s.c.) injected with vehicle solution and weighed for 3 days to acclimate them to the procedures.


1) Acute effect on blood glucose in fed female DIO mice: initial blood samples are taken just before first administration (s.c.) of vehicle (phosphate buffer solution) or the exendin-4 derivatives (dissolved in phosphate buffer), respectively. The volume of administration is 5 mL/kg. The animals have access to water and their corresponding diet during the experiment. Blood glucose levels are measured at t=0 h, t=1 h, t=2 h, t=3 h, t=4 h, t=6 h and t=24 h (method: Accu-Check glucometer). Blood sampling is performed by tail incision without anaesthesia.


2) Chronic effect on body weight in female DIO mice: mice are treated once (s.c. in evening hours) or twice daily (s.c. in the morning and in the evening), respectively, at the beginning and the end of the light phase with either vehicle or exendin-4 derivatives for 4 weeks. Body weight is recorded daily. Two days before start of treatment and on day 26, total fat mass is measured by nuclear magnetic resonance (NMR).


Statistical analyses are performed with Everstat 6.0 by repeated measures two-way ANOVA and Dunnetts post-hoc analyses (glucose profile) and 1-way-ANOVA, followed by Dunnetts post-hoc test (body weight, body fat). Differences versus vehicle-treated DIO control mice are considered statistically significant at the p<0.05 level.


Effects of 4 Weeks of Treatment on Glucose, HbA1c and Oral Glucose Tolerance in Female Diabetic dbdb-Mice


8 week old, female diabetic dbdb-mice of mean non-fasted glucose value of 14.5 mmol/l and a body weight of 37-40 g are used. Mice are individually marked and are adapted to housing conditions for at least one week.


7 days prior to study start, baseline values for non-fasted glucose and HbA1c are determined, 5 days prior to study start, mice are assigned to groups and cages (5 mice per cage, 10 per group) according to their HbA1c values to ensure even distribution of lower and higher values between groups (stratification).


Mice are treated for 4 weeks, by twice daily subcutaneous administration in the morning and the afternoon. Blood samples from the tail tip are obtained for HbA1c on study day 21 and oral glucose tolerance is assessed in the 4th week.


An oral glucose tolerance test is done in the morning without prior extra compound administration to majorly assess the effect of chronic treatment and less of acute compound administration. Mice are fasted for 4 hours prior to oral glucose administration (2 g/kg, t=0 min). Blood samples are drawn prior to glucose administration and at 15, 30, 60, 90, 120, and 180 min. Feed is returned after the last blood sampling. Results are represented as change from baseline, glucose in mmol/l and HbA1c in %.


Statistical analyses are performed with Everstat Version 6.0 based on SAS by 1-way-ANOVA, followed by Dunnett's post-hoc test against vehicle-control. Differences are considered statistically significant at the p<0.05 level.


Glucose Lowering in Non-Fasted Female Diabetic dbdb-Mice


Female diabetic dbdb-mice of mean non-fasted glucose value of 20-22 mmol/l and a body weight of 42 g+/−0.6 g (SEM) are used. Mice are individually marked and are adapted to housing conditions for at least one week.


3-5 days prior to study start mice are assigned to groups and cages (4 mice per cage, 8 per group) according to their non-fasted glucose values to ensure even distribution of lower and higher values between groups (stratification). On the study day, mice are weighed and dosed (t=0) Immediately prior to compound administration feed is removed while water remains available, and a first blood sample at a tail incision is drawn (baseline). Further blood samples are drawn at the tail incision at 30, 60, 90, 120, 240, 360, and 480 min.


Statistical analyses are performed with Everstat Version 6.0 based on SAS by 2-way-ANOVA on repeated measures, followed by Dunnett's post-hoc test against vehicle-control.


Differences are considered statistically significant at the p<0.05 level.


EXAMPLES

The invention is further illustrated by the following examples.


Example 1
Synthesis of SEQ ID NO: 7

The manual synthesis procedure as described in Methods was carried out on a desiccated Rink amide MBHA Resin (0.66 mmol/g). The Fmoc-synthesis strategy was applied with DIC/HOBt-activation. In position 14 Fmoc-Lys(ivDde)-OH and in position 1 Boc-His(Boc)-OH were used. The ivDde-group was cleaved from the peptide on resin according to a modified literature procedure (S. R. Chhabra et al., Tetrahedron Lett. 39, (1998), 1603), using 4% hydrazine hydrate in DMF. The peptide was cleaved from the resin with King's cocktail (D. S. King, C. G. Fields, G. B. Fields, Int. J. Peptide Protein Res. 36, 1990, 255-266). The crude product was purified via preparative HPLC using an acetonitrile/water gradient (both buffers with 0.1% TFA). The purified peptide was analysed by LCMS (Method B). Deconvolution of the mass signals found under the peak with retention time 14.29 min revealed the peptide mass 4649.20 which is in line with the expected value of 4649.29.


Example 2
Synthesis of SEQ ID NO: 8

The manual synthesis procedure as described in Methods was carried out on a desiccated Rink amide MBHA Resin (0.66 mmol/g). The Fmoc-synthesis strategy was applied with DIC/HOBT-activation. In position 14 Fmoc-Lys(ivDde)-OH and in position 1 Boc-His(Boc)-OH were used. The ivDde-group was cleaved from the peptide on resin according to a modified literature procedure (S. R. Chhabra et al., Tetrahedron Lett. 39, (1998), 1603), using 4% hydrazine hydrate in DMF. The peptide was cleaved from the resin with King's cocktail (D. S. King, C. G. Fields, G. B. Fields, Int. J. Peptide Protein Res. 36, 1990, 255-266). The crude product was purified via preparative HPLC using an acetonitrile/water gradient (both buffers with 0.1% TFA). The purified peptide was analysed by LCMS (Method B). Deconvolution of the mass signals found under the peak with retention time 14.05 min revealed the peptide mass 4634.80 which is in line with the expected value of 4635.27.


In an analogous way, the peptides listed in Table 3 were synthesized and characterized.









TABLE 3







list of synthesized peptides and comparison


of calculated vs. found molecular weight










SEQ
calc.
found
Monoisotopic or


ID NO
Mass
mass
average mass













6
4545.4
4546.0
monoisotopic


7
4649.3
4649.2
average


8
4635.3
4634.8
average


9
4534.2
4533.0
average


10
4506.1
4504.8
average


11
4520.2
4518.3
average


12
4662.4
4662.2
monoisotopic


13
4648.4
4648.4
monoisotopic


14
4703.5
4703.6
monoisotopic


15
4689.5
4689.5
monoisotopic


16
4793.5
4793.6
monoisotopic


17
4821.6
4821.6
monoisotopic


18
4837.6
4837.6
monoisotopic


20
4150.1
4150.2
monoisotopic


21
4675.5
4675.4
monoisotopic


22
4689.5
4689.5
monoisotopic


23
4138.6
4139.4
average


24
4123.6
4122.6
average


25
4164.1
4164.1
monoisotopic









In an analogous way, the following peptides of Table 4 can be synthesized:









TABLE 4





List of peptides that can be


synthesized in an analogous way.


SEQ ID NO







19









Example 3
Stability and Solubility

Solubility and stability of peptidic compounds were assessed as described in Methods. The results are given in Table 5.









TABLE 5







Stability and solubility









SEQ
Stability [%]
solubility [mg/ml]











ID NO
pH 4.5
pH 7.4
pH 4.5
pH 7.4














7
89
100
>8
>8


8
98
100
>8
>8


14
93
100
>8
>8


15
96
96
>8
>8









Example 4
In Vitro Data on GLP-1, Glucagon and GIP Receptor

Potencies of peptidic compounds at the GLP-1, glucagon and GIP receptors were determined by exposing cells expressing human glucagon receptor (hGlucagon R), human GIP receptor (hGIP-R) or human GLP-1 receptor (hGLP-1 R) to the listed compounds at increasing concentrations and measuring the formed cAMP as described in Methods.


The results are shown in Table 6:









TABLE 6







EC50 values of exendin-4 derivatives at GLP-1,


Glucagon and GIP receptors (indicated in pM)












SEQ ID
EC50
EC50
EC50



NO
hGLP-1R
hGlucagon-R
hGIP-R
















1
0.4
>10000000
12500.0



6
14.1
136.0
2760.0



7
3.4
101.3
7617.5



8
2.3
28.1
2140.0



9
6.4
15.4
1160.0



10
3.5
52.4
890.0



11
10.3
261.0
13400.0



12
3.7
130.0
8290.0



13
1.8
22.8
2390.0



14
4.1
194.0
6530.0



15
2.4
42.6
1855.0



16
2.0
42.0
1870.0



17
2.8
16.2
906.0



18
8.3
8.6
2160.0










Example 5
Comparison Testing

A selection of inventive exendin-4 derivatives comprising a functionalized amino acid in position 14 has been tested versus corresponding compounds having in this position 14 a ‘non-functionalized’ amino acid with otherwise identical amino acid sequence. The reference pair compounds and the corresponding EC50 values at GLP-1, Glucagon and GIP receptors (indicated in pM) are given in Table 7. As shown, the inventive exendin-4 derivatives show a superior activity in comparison to the compounds with a ‘non-functionalized’ amino acid in position 14.


Furthermore, a selection of inventive exendin-4 derivatives comprising an Aib in position 27 has been tested versus corresponding compounds having in this position a lysine residue as in native exendin-4 and otherwise identical amino acid sequence. The reference pair compounds and the corresponding EC50 values at GLP-1, Glucagon and GIP receptors (indicated in pM) are given in Table 8. As shown, the inventive exendin-4 derivatives show a reduced activity on the GIP receptor compared to the corresponding derivatives with Lys at position 27 as in native exendin-4.









TABLE 7







Comparison of exendin-4 derivatives comprising a non-functionalized amino acid in


position 14 vs. exendin-4 derivatives comprising a functionalized amino acid in


position 14 and otherwise identical amino acid sequence. EC50 values at GLP-1,


Glucagon and GIP receptors are indicated in pM. (K = lysine, Nle = norleucine,


L = leucine, E-x53 = (S)-4-Carboxy-4-hexadecanoylamino-butyryl-,


E-x70 = (S)-4-Carboxy-4-octadecanoylamino-butyryl-, Ac = acetate,


E-E-x53 = (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-)











SEQ ID
EC50
EC50
EC50
residue in


NO
hGLP-1R
hGlucagon-R
hGIP-1
position 14














24
8.0
3090.0
114000.0
L


23
52.5
42900.0
177000.0
K


8
2.3
28.1
2140.0
K(γE-γE-x53)


9
6.4
15.4
1160.0
K(γE-x70)


10
3.5
52.4
890.0
K(γE-x53)


15
1.2
394.0
11900.0
L


21
1.2
3.2
193.0
K(γE-γE-x53)
















TABLE 8







Comparison of exendin-4 derivatives comprising an Aib in position 27 vs. exendin-4


derivatives comprising a Lys in position 27 and otherwise identical amino acid sequence.


EC50 values at GLP-1, Glucagon and GIP receptors are indicated in pM.











SEQ ID
EC50
EC50
EC50
residue in


NO
hGLP-1R
hGlucagon-R
hGIP-1
position 27














21
1.2
3.2
193.0
K


8
2.3
28.1
2140.0
Aib


22
1.8
5.9
148.0
K


7
3.4
101.3
7617.5
Aib









Example 6
Pharmacokinetic Testing

Pharmacokinetic profiles were determined as described in Methods. Calculated T1/2 and Cmax values are shown in Table 9.









TABLE 9







Pharmacokinetic profiles of exendin-4 derivatives.












Mice (1 mg/kg)
Mini pigs (0.1 mg/kg)













SEQ ID
T1/2
Cmax
T1/2
Cmax



NO
[h]
[ng/ml]
[h]
[ng/ml]

















7
3.1
5510.0
29
667



8
3.8
4360.0
18.1
476










Example 7
Acute and Chronic Effects of SEQ ID NO: 7 and of SEQ ID NO: 8 After Bid Subcutaneous Treatment on Blood Glucose and Body Weight in Female Diet-Induced Obese (DIO) C57BL/6 Mice

1) Glucose Profile


After blood sampling to determine the blood glucose baseline level, fed diet-induced obese female C57BL/6 mice were administered 50 μg/kg of SEQ ID NO: 7, 50 μg/kg of SEQ ID NO: 8 or phosphate buffered solution (vehicle control on standard or high-fat diet) subcutaneously. At predefined time points, more blood samples were taken to measure blood glucose and generate the blood glucose profile over 24 h.


SEQ ID NO: 7 and SEQ ID NO: 8 demonstrated a significant decrease in blood glucose compared to DIO control mice for time points t=1, 2, 3, 4, 6 and 24 h post compound dosing (p<0.0001, 2-W-ANOVA-RM, post hoc Dunnett's Test; mean±SEM) (see FIG. 4).


2) Body Weight


Female obese C57BL/6 mice were treated for 4 weeks twice daily subcutaneously with 50 μg/kg SEQ ID NO: 7, 50 μg/kg SEQ ID NO: 8 or vehicle. Body weight was recorded daily, and body fat content was determined before the start and after 4 weeks of treatment. Treatment with 50 μg/kg SEQ ID NO: 7 showed a statistically significant decrease when compared to vehicle DIO control mice in daily body weight beginning on day 7 and continuing through the end of the study (p>0.0001 by the end of the study). Treatment with 50 μg/kg SEQ ID NO: 8 reduced body weight significantly when compared to vehicle DIO control mice beginning on day 5 and continuing through the end of the study (p>0.0001 by the end of the study, Table 10, FIGS. 1 and 2). These changes resulted from a decrease in body fat, as shown by the absolute changes in body fat content (Table 10, FIG. 3).









TABLE 10







Weight change in DIO mice over a 4-week


treatment period (mean ± SEM)












Overall weight
Body fat



Example (Dose)
change (g)
change (g)







Control standard diet
+0.94 ± 0.4
+2.56 ± 0.4



Control high-fat diet
+3.83 ± 0.5
+5.00 ± 0.5



SEQ ID NO: 7 (50 μg/kg bid)
−5.49 ± 0.9
−3.73 ± 0.8



SEQ ID NO: 8 (50 μg/kg bid)
−5.38 ± 0.5
−3.81 ± 0.6










Example 8
Acute and Chronic Effects of SEQ ID NO: 15 After qd Subcutaneous Treatment on Blood Glucose and Body Weight in Female Diet-Induced Obese (DIO) C57BL/6 Mice

1) Glucose Profile


After blood sampling to determine the blood glucose baseline level, fed diet-induced obese female C57BL/6 mice were administered 50 μg/kg of SEQ ID NO: 15 or phosphate buffered solution (vehicle control on standard or high-fat diet) subcutaneously once daily. At predefined time points, more blood samples were taken to measure blood glucose and generate the blood glucose profile over 24 h.


SEQ ID NO: 15 demonstrated a significant decrease in blood glucose compared to DIO control mice for time points t=1, 2, 3, 4, 6 and 24 h post compound dosing (p<0.001, 2-W-ANOVA-RM, post hoc Dunnett's Test; mean±SEM) (see FIG. 5).


2) Body Weight


Female obese C57BL/6 mice were treated for 4 weeks once daily subcutaneously with 50 μg/kg SEQ ID NO: 15 or vehicle. Body weight was recorded daily, and body fat content was determined before the start and after 4 weeks of treatment.


Treatment with 50 μg/kg SEQ ID NO: 15 showed a statistically significant decrease when compared to vehicle DIO control mice in daily body weight beginning on day 4 and continuing through the end of the study (p>0.001 by the end of the study, Table 11, FIG. 6). These changes resulted from a decrease in body fat, as shown by the absolute changes in body fat content (Table 11, FIG. 7).









TABLE 11







Weight change in DIO mice over a 4-week


treatment period (mean ± SEM)











Example
Overall weight
Body fat



(Dose)
change (g)
change (g)







Control standard diet
+1.71 ± 0.3
+0.71 ± 0.4 



Control high-fat diet
+5.41 ± 0.5
+3.26 ± 0.4 



SEQ ID NO: 15
−4.59 ± 1.1
−4.01 ± 0.68



(50 μg/kg qd)

















TABLE 12







Sequences








SEQ. ID
sequence











1
H-G-E-G-T-F-T-S-D-L-S-K-Q-M-E-E-E-A-V-



R-L-F-I-E-W-L-K-N-G-G-P-S-S-G-A-P-P-P-



S-NH2





2
H-A-E-G-T-F-T-S-D-V-S-S-Y-L-E-G-Q-A-A-



K-E-F-I-A-W-L-V-K-G-R-NH2





3
H-S-Q-G-T-F-T-S-D-Y-S-K-Y-L-D-S-R-R-A-



Q-D-F-V-Q-W-L-M-N-T-OH





4
H-A-E-G-T-F-T-S-D-V-S-S-Y-L-E-G-Q-A-A-



K(γE-x53)-E-F-I-A-W-L-V-R-G-R-G-OH





5
Y-A-E-G-T-F-I-S-D-Y-S-I-A-M-D-K-I-H-Q-



Q-D-F-V-N-W-L-L-A-Q-K-G-K-K-N-D-W-K-H-



N-I-T-Q-OH





6
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(γE-x70)-



D-E-Q-R-A-K-L-F-I-E-W-L-Aib-A-dAla-G-



P-S-S-G-A-P-P-P-S-NH2





7
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(γE-γE-



x53)-D-E-Q-R-A-K-L-F-I-E-W-L-Aib-A-



dAla-G-P-S-S-G-A-P-P-P-S-NH2





8
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(γE-γE-



x53)-D-E-Q-R-A-K-L-F-I-E-W-L-Aib-A-G-



G-P-S-S-G-A-P-P-P-S-NH2





9
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(γE-x70)-



D-E-Q-R-A-K-L-F-I-E-W-L-Aib-A-G-G-P-S-



S-G-A-P-P-P-S-NH2





10
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(γE-x53)-



D-E-Q-R-A-K-L-F-I-E-W-L-Aib-A-G-G-P-S-



S-G-A-P-P-P-S-NH2





11
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(γE-x53)-



D-E-Q-R-A-K-L-F-I-E-W-L-Aib-A-dAla-G-



P-S-S-G-A-P-P-P-S-NH2





12
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(γE-γE-



x53)-D-E-Q-R-A-K-L-F-I-E-W-L-Aib-S-



dAla-G-P-S-S-G-A-P-P-P-S-NH2





13
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(γE-γE-



x53)-D-E-Q-R-A-K-L-F-I-E-W-L-Aib-S-



G-G-P-S-S-G-A-P-P-P-S-NH2





14
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(γE-γE-



x53)-D-E-Q-R-A-K-L-F-I-E-W-L-Aib-K-



dAla-G-P-S-S-G-A-P-P-P-S-NH2





15
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(γE-γE-



x53)-D-E-Q-R-A-K-L-F-I-E-W-L-Aib-K-



G-G-P-S-S-G-A-P-P-P-S-NH2





16
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(AEEAc-



AEEAc- E-x53)-D-E-Q-R-A-K-L-F-I-E-W-



L-Aib-A-G-G-P-S-S-G-A-P-P-P-S-NH2





17
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(AEEAc-



AEEAc- E-x70)-D-E-Q-R-A-K-L-F-I-E-W-



L-Aib-A-G-G-P-S-S-G-A-P-P-P-S-NH2





18
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(AEEAc-



AEEAc-AEEAc-x70)-D-E-Q-R-A-K-L-F-I-



E-W-L-Aib-A-G-G-P-S-S-G-A-P-P-P-S-NH2





19
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(AEEAc-



AEEAc- E-x99)-D-E-Q-R-A-K-L-F-I-E-W-



L-Aib-A-G-G-P-S-S-G-A-P-P-P-S-NH2





20
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K-D-E-Q-



R-A-K-L-F-I-E-W-L-Aib-A-dAla-G-P-S-



S-G-A-P-P-P-S-NH2





21
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(γE-γE-



x53)-D-E-Q-R-A-K-L-F-I-E-W-L-K-A-G-G-



P-S-S-G-A-P-P-P-S-NH2





22
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(γE-γE-



x53)-D-E-Q-R-A-K-L-F-I-E-W-L-K-A-dAla-



G-P-S-S-G-A-P-P-P-S-NH2





23
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K-D-E-Q-R-



A-K-L-F-I-E-W-L-Aib-A-G-G-P-S-S-G-A-P-



P-P-S-NH2





24
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-L-D-E-Q-R-



A-K-L-F-I-E-W-L-Aib-A-G-G-P-S-S-G-A-P-



P-P-S-NH2





25
H-Aib-Q-G-T-F-T-S-D-L-S-K-Q-L-D-E-Q-R-



A-K-L-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-



P-S-NH2








Claims
  • 1. A peptidic compound of formula (I):
  • 2. The compound or salt or solvate thereof of claim 1, wherein R1 is NH2.
  • 3. The compound or salt or solvate thereof according to claim 1, wherein the peptidic compound has a relative activity of at least 0.09% compared to that of natural glucagon at the glucagon receptor.
  • 4. The compound or salt or solvate thereof according to claim 1, wherein the peptidic compound exhibits a relative activity of at least 0.1% compared to that of a glucagon-like peptide (GLP-1)(7-36)-amide at the GLP-1 receptor.
  • 5. The compound or salt or solvate thereof according to claim 1, wherein X14 is Lys, wherein the —NH2 side chain group is functionalized with a group —Z—C(O)R5, wherein Z is a group selected from the group consisting of γE, γE-γE, AEEAc-AEEAc-γE, and AEEAc-AEEAc-AEEAc, andR5 is a group selected from the group consisting of pentadecanyl, heptadecanyl, and 16-carboxy hexadecanyl.
  • 6. The compound or salt or solvate thereof according to claim 1, wherein X14 is Lys, wherein the —NH2 side chain group is functionalized with a group —Z—C(O)R5, wherein Z is a group selected from the group consisting of γE, γE-γE, AEEAc-AEEAc-γE, and AEEAc-AEEAc-AEEAc, and R5 is a group selected from the group consisting of pentadecanyl and heptadecanyl.
  • 7. The compound or salt or solvate thereof according to claim 1, wherein X14 is Lys, wherein the —NH2 side chain group is functionalized by a group selected from the group consisting of (S)-4-Carboxy-4-hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-hexadecanoylamino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl, and (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-octadecanoylamino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl, [2-(2-{2-[2-(2-{2-[2-(2-Octadecanoylamino-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetyl-,X28 is Ala,X29 is an amino acid residue selected from the group consisting of D-Ala and Gly, andR1 is NH2.
  • 8. The compound or salt or solvate thereof according to claim 1, wherein X14 is Lys, wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-,X28 is Ser,X29 is an amino acid residue selected from the group consisting of D-Ala and Gly, andR1 is NH2.
  • 9. The compound or salt or solvate thereof according to claim 1, wherein X14 is Lys, wherein the —NH2 side chain group is functionalized by (S)-4-carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-,X28 is Lys,X29 is an amino acid residue selected from the group consisting of D-Ala and Gly, andR1 is NH2.
  • 10. The compound or salt or solvate thereof according to claim 1, wherein X14 is Lys, wherein the —NH2 side chain group is functionalized by a group selected from the group consisting of (S)-4-Carboxy-4-hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino-butyryl-, and (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-,X28 is an amino acid residue selected from the group consisting of Ala, Lys, and Ser,X29 is D-Ala, andR1 is NH2.
  • 11. The compound or salt or solvate thereof of claim 1, wherein X14 is Lys, wherein the —NH2 side chain group is functionalized by a group selected from the group consisting of (S)-4-Carboxy-4-hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-, (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-hexadecanoylamino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl, and (2-{2-[2-(2-{2-[(4S)-4-Carboxy-4-octadecanoylamino-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl, [2-(2-{2-[2-(2-{2-[2-(2-Octadecanoylamino-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetyl-,X28 is an amino acid residue selected from the group consisting of Ala, Lys, and Ser,X29 is Gly, andR1 is NH2.
  • 12. The compound or salt or solvate thereof of claim 1, wherein X14 is Lys, wherein the —NH2 side chain group is functionalized by (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl-,X28 is Ala,X29 is an amino acid residue selected from the group consisting of Gly and D-Ala, andR1 is NH2.
  • 13. The compound or salt or solvate thereof of claim 1, selected from the compounds of SEQ ID NOs: 6-19, or a salt or solvate thereof.
  • 14. The compound or salt or solvate thereof of claim 13, selected from the compounds of SEQ ID NOs: 6-18, or a salt or solvate thereof.
  • 15. The compound, salt or solvate according to claim 1, wherein the compound is the amino acid sequence of SEQ ID NO: 7.
  • 16. The compound, salt or solvate according to claim 1, wherein the compound is the amino acid sequence of SEQ ID NO: 8.
  • 17. A solvate of a compound of claim 1.
  • 18. A hydrate of a compound of claim 1.
  • 19. A pharmaceutical composition comprising one or more compounds of claim 1, or a salt or solvate thereof as an active ingredient and at least one pharmaceutically acceptable carrier.
  • 20. The pharmaceutical composition according to claim 19, further comprising at least one additional therapeutically active agent, wherein the additional therapeutically active agent is selected from the group consisting of: insulin and insulin derivatives selected from the group consisting of insulin glargine, insulin glusiline, insulin detemir, insulin lispro, insulin degludec, insulin aspart, basal insulin and analogues thereof, pegylated insulin, recombinant human insulin, polysialated insulins, long-acting insulin, NN1045, insulin in combination with pramlintide, PE0139, fast-acting and short-acting insulins, insulin hydrogel, oral insulin, inhalable insulin, transdermal insulin and sublingual insulin, and insulin derivatives which are bonded to albumin or another protein by a bifunctional linker;GLP-1; GLP-1 analogues; GLP-1 receptor agonists selected from the group consisting of lixisenatide, exenatide, ITCA 650, AC-2993, liraglutide, semaglutide, taspoglutide, albiglutide, dulaglutide, rExendin-4, CJC-1134-PC, PB-1023, TTP-054, Langlenatide, HM-11260C, CM-3, ORMD-0901, NN-9924, NN-9926, NN-9927, CVX-096, ZYOG-1, ZYD-1, GSK-2374697, DA-3091, MAR-701, MAR709, ZP-2929, ZP-3022, TT-401, BHM-034, MOD-6030, CAM-2036, DA-15864, ARI-2651, ARI-2255, xtenylated exenatide, xtenylated glucagon, and polymer bound derivatives thereof;dual GLP-1/GIP receptor agonists; dual GLP-1/glucagon receptor agonists; protein YY3-36 (PYY3-36); pancreatic polypeptide; glucagon receptor agonists; GIP receptor agonists or antagonists; ghrelin antagonists or inverse agonists; xenin; dipeptidyl peptidase IV (DPP-IV) inhibitors; sodium glucose cotransporter 2 (SGLT2) inhibitors; dual SGLT2/SGLT1 inhibitors; biguanides; thiazolidinediones; dual peroxisome proliferator-activated receptor (PPAR) agonists; sulfonylureas; meglitinides; alpha-glucosidase inhibitors; amylin and pramlintide; G protein-coupled receptor 119 (GPR119) agonists; GPR40 agonists; GPR120 agonists; GPR142 agonists; systemic or low-absorbable transmembrane G protein-coupled receptor 5 (TGR5) agonists; bromocriptine mesylate; inhibitors of 11-beta-hydroxysteroid dehydrogenase (HSD); activators of glucokinase; inhibitors of diacylglycerol acyltransferase (DGAT); inhibitors of protein tyrosinephosphatase 1; inhibitors of glucose-6-phosphatase; inhibitors of fructose-1,6-bisphosphatase; inhibitors of glycogen phosphorylase; inhibitors of phosphoenol pyruvate carboxykinase; inhibitors of glycogen synthase kinase; inhibitors of pyruvate dehydrogenase kinase; alpha2-antagonists; C—C motif receptor (CCR-2) antagonists; modulators of glucose transporter-4; somatostatin receptor 3 agonists; 3-hydroxy-3-methyl-glutaryl-coenzyme A (HMG-CoA)-reductase inhibitors; fibrates; nicotinic acid and derivatives thereof; nicotinic acid receptor 1 agonists; PPAR-alpha, gamma, or alpha/gamma agonists or modulators; PPAR-delta agonists; acyl-CoA cholesterol acyltransferase (ACAT) inhibitors; cholesterol absorption inhibitors; bile acid-binding substances; ileal bile acid transporter (IBAT) inhibitors; microsomal triglyceride transfer protein (MTP) inhibitors; modulators of proprotein convertase subtilisin/kinexin type 9 (PCSK9); low-density lipoprotein (LDL) receptor up-regulators by liver selective thyroid hormone receptor 13 agonists; high-density lipoprotein (HDL)-raising compounds; lipid metabolism modulators; phospholipase A2 (PLA2) inhibitors; apolipoprotein A1 (ApoA-1) enhancers; thyroid hormone receptor agonists; cholesterol synthesis inhibitors; omega-3 fatty acids and derivatives thereof;substances for the treatment of obesity selected from the group consisting of sibutramine, tesofensine, tetrahydrolipstatin, cannabinoid-1 (CB-1) receptor antagonists, melanin-concentrating hormone-1 (MCH-1) antagonists, melanocortin 4 (MC4) receptor agonists and partial agonists, neuropeptide Y5 (NPY5) or NPY2 antagonists, NPY4 agonists, beta-3-agonists, leptin or leptin mimetics, agonists of the 5-hydroxy tryptophan 2c (5HT2c) receptor, combinations of bupropione/naltrexone, combinations of bupropione/zonisamide, combinations of bupropione/phentermine, combinations of pramlintide/metreleptin, and combinations of phentermine/topiramate; andlipase inhibitors; angiogenesis inhibitors; H3 antagonists; Agouti-related protein (AgRP) inhibitors; triple monoamine uptake inhibitors; methionine aminopeptidase type 2 (MetAP2) inhibitors; nasal formulation of the calcium channel blocker diltiazem; antisense molecules against production of fibroblast growth factor receptor 4; prohibitin targeting peptide-1; and drugs for influencing high blood pressure, chronic heart failure, or atherosclerosis selected from the group consisting of angiotensin II receptor antagonists, angiotensin-converting-enzyme (ACE) inhibitors, endothelin-converting-enzyme (ECE) inhibitors, diuretics, beta-blockers, calcium antagonists, centrally acting hypertensives, antagonists of the alpha-2-adrenergic receptor, inhibitors of neutral endopeptidase, and thrombocyte aggregation inhibitors.
  • 21. A pharmaceutical composition comprising one or more compounds of claim 1, or a physiologically acceptable salt or hydrate thereof as an active ingredient and at least one pharmaceutically acceptable carrier.
  • 22. A method for the treatment of hyperglycemia, type 1 diabetes, type 2 diabetes, or obesity, which comprises administering to a patient in need of such treatment an effective amount of one or more compounds, salts or solvates of claim 1.
  • 23. The method of claim 22, for the treatment or prevention of hyperglycemia, or type 2 diabetes.
  • 24. A method for the simultaneous treatment of diabetes and obesity which comprises administering to a patient in need of such treatment an effective amount of one or more compounds, salts or solvates of claim 1.
  • 25. A method for the treatment hyperglycemia, type 1 diabetes, type 2 diabetes, or obesity, which comprises administering to a patient in need of such treatment an effective amount of a pharmaceutical composition of claim 19.
  • 26. The method of claim 25 for the treatment of hyperglycemia or type 2 diabetes.
  • 27. A method for the simultaneous treatment of diabetes and obesity which comprises administering to a patient in need of such treatment an effective amount of a pharmaceutical composition of claim 19.
Priority Claims (1)
Number Date Country Kind
14305501 Apr 2014 EP regional
US Referenced Citations (634)
Number Name Date Kind
5424286 Eng Jun 1995 A
5641757 Bornstein et al. Jun 1997 A
6284727 Kim et al. Sep 2001 B1
6329336 Bridon et al. Dec 2001 B1
6344180 Holst et al. Feb 2002 B1
6410511 L'Italien et al. Jun 2002 B2
6429197 Coolidge et al. Aug 2002 B1
6451974 Hansen Sep 2002 B1
6458924 Knudsen et al. Oct 2002 B2
6482799 Tusé et al. Nov 2002 B1
6506724 Hiles et al. Jan 2003 B1
6514500 Bridon et al. Feb 2003 B1
6528486 Larsen et al. Mar 2003 B1
6579851 Goeke et al. Jun 2003 B2
6593295 Bridon et al. Jul 2003 B2
6703359 Young et al. Mar 2004 B1
6706689 Coolidge et al. Mar 2004 B2
6723530 Drucker Apr 2004 B1
6821949 Bridon et al. Nov 2004 B2
6828303 Kim et al. Dec 2004 B2
6849714 Bridon et al. Feb 2005 B1
6858576 Young et al. Feb 2005 B1
6861236 Moll et al. Mar 2005 B2
6872700 Young et al. Mar 2005 B1
6884579 Holst et al. Apr 2005 B2
6887470 Bridon et al. May 2005 B1
6887849 Bridon et al. May 2005 B2
6894024 Coolidge et al. May 2005 B2
6902744 Kolterman et al. Jun 2005 B1
6924264 Prickett et al. Aug 2005 B1
6956026 Beeley et al. Oct 2005 B2
6969702 Bertilsson et al. Nov 2005 B2
6972319 Pan et al. Dec 2005 B1
6982248 Coolidge et al. Jan 2006 B2
6989366 Beeley et al. Jan 2006 B2
6998387 Goke et al. Feb 2006 B1
7056734 Egan et al. Jun 2006 B1
7056887 Coolidge et al. Jun 2006 B2
7105489 Hathaway et al. Sep 2006 B2
7105490 Beeley et al. Sep 2006 B2
7115569 Beeley et al. Oct 2006 B2
7138375 Beeley et al. Nov 2006 B2
7138546 Tang Nov 2006 B2
7141240 Perfetti et al. Nov 2006 B2
7141547 Rosen et al. Nov 2006 B2
7144863 DeFelippis et al. Dec 2006 B2
7153825 Young et al. Dec 2006 B2
7157555 Beeley et al. Jan 2007 B1
7179788 DeFelippis et al. Feb 2007 B2
7189690 Rosen et al. Mar 2007 B2
7220721 Beeley et al. May 2007 B1
7223725 Beeley et al. May 2007 B1
7256253 Bridon et al. Aug 2007 B2
7259136 Hathaway et al. Aug 2007 B2
7259233 Dodd et al. Aug 2007 B2
7259234 Bachovchin et al. Aug 2007 B2
7265087 Göke et al. Sep 2007 B1
7271149 Glaesner et al. Sep 2007 B2
7297761 Beeley et al. Nov 2007 B2
7312196 L'Italien et al. Dec 2007 B2
7329646 Sun et al. Feb 2008 B2
7399489 Kolterman et al. Jul 2008 B2
7399744 Mack et al. Jul 2008 B2
7407932 Young et al. Aug 2008 B2
7407955 Himmelsbach et al. Aug 2008 B2
7414107 Larsen Aug 2008 B2
7419952 Beeley et al. Sep 2008 B2
7442680 Young et al. Oct 2008 B2
7442682 Kitaura et al. Oct 2008 B2
7452858 Hiles et al. Nov 2008 B2
7456254 Wright et al. Nov 2008 B2
7476652 Brunner-Schwarz et al. Jan 2009 B2
7507714 Pan et al. Mar 2009 B2
7521423 Young et al. Apr 2009 B2
7544657 Ebbehøj et al. Jun 2009 B2
7563871 Wright et al. Jul 2009 B2
7576050 Greig et al. Aug 2009 B2
7585837 Shechter et al. Sep 2009 B2
7592010 Rosen et al. Sep 2009 B2
7595293 Engelund et al. Sep 2009 B2
7595294 Nestor Sep 2009 B2
7608692 Prickett et al. Oct 2009 B2
7612176 Wright et al. Nov 2009 B2
7632806 Juul-Mortensen et al. Dec 2009 B2
7638299 Cho et al. Dec 2009 B2
7682356 Alessi et al. Mar 2010 B2
7683030 Prickett et al. Mar 2010 B2
7691963 Prickett et al. Apr 2010 B2
7696161 Beeley et al. Apr 2010 B2
7700549 Beeley et al. Apr 2010 B2
7704953 Herman et al. Apr 2010 B2
7713930 Brunner-Schwarz et al. May 2010 B2
7723471 Levy et al. May 2010 B2
7741269 Young et al. Jun 2010 B2
7749955 Hansen et al. Jul 2010 B2
7772189 Herman et al. Aug 2010 B2
7790681 Hathaway et al. Sep 2010 B2
7799344 Oberg Sep 2010 B2
7799759 Rosen et al. Sep 2010 B2
7803404 Hokenson et al. Sep 2010 B2
7829664 Tatake et al. Nov 2010 B2
7847079 Rosen et al. Dec 2010 B2
7858740 Beeley et al. Dec 2010 B2
7867972 Ballance et al. Jan 2011 B2
7879028 Alessi et al. Feb 2011 B2
7888314 Hathaway et al. Feb 2011 B2
7897560 Dorwald et al. Mar 2011 B2
7906146 Kolterman et al. Mar 2011 B2
7928065 Young et al. Apr 2011 B2
7928186 Chang Apr 2011 B2
7935786 Larsen May 2011 B2
7939494 Khan et al. May 2011 B2
7960341 Hathaway et al. Jun 2011 B2
7977306 Rosen et al. Jul 2011 B2
7981861 Coolidge et al. Jul 2011 B2
7989585 Dodd et al. Aug 2011 B2
7994121 Bachovchin et al. Aug 2011 B2
7994122 Riber et al. Aug 2011 B2
8008255 Ong et al. Aug 2011 B2
8012464 Rosen et al. Sep 2011 B2
8026210 Young et al. Sep 2011 B2
8030273 Au et al. Oct 2011 B2
8039432 Bridon et al. Oct 2011 B2
8057822 Prickett et al. Nov 2011 B2
8071539 Rosen et al. Dec 2011 B2
8076288 Levy et al. Dec 2011 B2
8080516 Bridon et al. Dec 2011 B2
8084414 Bridon et al. Dec 2011 B2
8093206 Bridon et al. Jan 2012 B2
8097239 Johnsson et al. Jan 2012 B2
8097586 Lv et al. Jan 2012 B2
8114632 Melarkode et al. Feb 2012 B2
8114833 Pedersen et al. Feb 2012 B2
8114958 Soares et al. Feb 2012 B2
8114959 Juul-Mortensen Feb 2012 B2
8119648 Himmelsbach et al. Feb 2012 B2
8143217 Balkan et al. Mar 2012 B2
8158579 Ballance et al. Apr 2012 B2
8158583 Knudsen et al. Apr 2012 B2
8178495 Chilkoti May 2012 B2
8178541 Himmelsbach et al. May 2012 B2
8197450 Glejbol et al. Jun 2012 B2
8211439 Rosen et al. Jul 2012 B2
8232281 Dugi et al. Jul 2012 B2
8236760 Pimentel et al. Aug 2012 B2
8252739 Rosen et al. Aug 2012 B2
8263545 Levy et al. Sep 2012 B2
8263550 Beeley et al. Sep 2012 B2
8263554 Tatarkiewicz et al. Sep 2012 B2
8268781 Gotthardt et al. Sep 2012 B2
8278272 Greig et al. Oct 2012 B2
8278420 Wang et al. Oct 2012 B2
8288338 Young et al. Oct 2012 B2
8293726 Habib Oct 2012 B2
8293869 Bossard et al. Oct 2012 B2
8293871 Wright et al. Oct 2012 B2
8299024 Rabinovitch et al. Oct 2012 B2
8299025 Alessi et al. Oct 2012 B2
8329419 Nicolaou et al. Dec 2012 B2
8329648 Fineman et al. Dec 2012 B2
8338368 Dimarchi et al. Dec 2012 B2
8343910 Shechter et al. Jan 2013 B2
8372804 Richardson et al. Feb 2013 B2
8377869 Richardson et al. Feb 2013 B2
8389473 Hathaway et al. Mar 2013 B2
8404637 Levy et al. Mar 2013 B2
8410047 Bock et al. Apr 2013 B2
8420604 Hokenson et al. Apr 2013 B2
8424518 Smutney et al. Apr 2013 B2
8426361 Levy et al. Apr 2013 B2
8431685 Wright et al. Apr 2013 B2
8445647 Prickett et al. May 2013 B2
8450270 Dimarchi et al. May 2013 B2
8454971 Day et al. Jun 2013 B2
8461105 Wright et al. Jun 2013 B2
8481490 Tatarkiewicz et al. Jul 2013 B2
8485180 Smutney et al. Jul 2013 B2
8497240 Levy et al. Jul 2013 B2
8499757 Smutney et al. Aug 2013 B2
8546327 Dimarchi et al. Oct 2013 B2
8551946 Dimarchi et al. Oct 2013 B2
8551947 Coolidge et al. Oct 2013 B2
8557769 Coskun et al. Oct 2013 B2
8557771 Fan et al. Oct 2013 B2
8569481 Köster et al. Oct 2013 B2
8575097 Xu et al. Nov 2013 B2
8580919 Bossard et al. Nov 2013 B2
8598120 Soares et al. Dec 2013 B2
8603761 Nicolaou et al. Dec 2013 B2
8603969 Levy et al. Dec 2013 B2
8614181 Juul-Mortensen et al. Dec 2013 B2
8617613 Wright et al. Dec 2013 B2
8636001 Smutney et al. Jan 2014 B2
8641683 Glejbol et al. Feb 2014 B2
8642544 Alfaro-Lopez et al. Feb 2014 B2
8664232 Himmelsbach et al. Mar 2014 B2
8669228 Dimarchi et al. Mar 2014 B2
8673927 Dugi et al. Mar 2014 B2
8697647 Levy et al. Apr 2014 B2
8697838 Dimarchi et al. Apr 2014 B2
8710002 Rothkopf Apr 2014 B2
8710181 Christiansen et al. Apr 2014 B2
8716221 Lv et al. May 2014 B2
8729018 Chilkoti May 2014 B2
8729019 Oberg et al. May 2014 B2
8735350 Shechter et al. May 2014 B2
8748376 Ludvigsen et al. Jun 2014 B2
8759290 James Jun 2014 B2
8759295 Ghosh et al. Jun 2014 B2
8772232 Lau et al. Jul 2014 B2
8778872 Dimarchi et al. Jul 2014 B2
8785396 Leone-Bay et al. Jul 2014 B2
8801700 Alessi et al. Aug 2014 B2
8809499 Fan et al. Aug 2014 B2
8816047 Levetan et al. Aug 2014 B2
8841255 Chilkoti Sep 2014 B2
8853157 Knudsen et al. Oct 2014 B2
8853160 Greig et al. Oct 2014 B2
8877252 Wright et al. Nov 2014 B2
8877709 Shechter et al. Nov 2014 B2
8883449 Kjeldsen et al. Nov 2014 B2
8889619 Bai et al. Nov 2014 B2
8900593 Day et al. Dec 2014 B2
8969288 Dimarchi et al. Mar 2015 B2
8969294 Bianchi et al. Mar 2015 B2
8980830 Dimarchi et al. Mar 2015 B2
8981047 Dimarchi et al. Mar 2015 B2
9018164 Dimarchi et al. Apr 2015 B2
9181305 Haack et al. Nov 2015 B2
20010011071 Knudsen et al. Aug 2001 A1
20010027180 Isaacs Oct 2001 A1
20010043934 L'Italien et al. Nov 2001 A1
20020061838 Holmquist et al. May 2002 A1
20020137666 Beeley et al. Sep 2002 A1
20020146405 Coolidge et al. Oct 2002 A1
20030036504 Kolterman et al. Feb 2003 A1
20030050237 Kim et al. Mar 2003 A1
20030069182 Rinella et al. Apr 2003 A1
20030087820 Young et al. May 2003 A1
20030087821 Beeley et al. May 2003 A1
20030092606 L'Italien et al. May 2003 A1
20030119021 Koster et al. Jun 2003 A1
20030119734 Flink et al. Jun 2003 A1
20030180287 Gombotz et al. Sep 2003 A1
20030216287 Tang Nov 2003 A1
20030220255 Knudsen et al. Nov 2003 A1
20040023871 Hiles et al. Feb 2004 A1
20040029784 Hathaway Feb 2004 A1
20040037826 Michelsen et al. Feb 2004 A1
20040038865 Gelber et al. Feb 2004 A1
20040048783 Brunner-Schwarz et al. Mar 2004 A1
20040097510 Himmelsbach et al. May 2004 A1
20040209255 Koster et al. Oct 2004 A1
20040209803 Baron et al. Oct 2004 A1
20040242853 Greig et al. Dec 2004 A1
20040266670 Hiles et al. Dec 2004 A9
20040266678 Beeley et al. Dec 2004 A1
20040266683 Hathaway et al. Dec 2004 A1
20040266692 Young et al. Dec 2004 A1
20050009742 Bertilsson et al. Jan 2005 A1
20050009847 Bertilsson et al. Jan 2005 A1
20050009988 Harris et al. Jan 2005 A1
20050043238 Young et al. Feb 2005 A1
20050059601 Beeley et al. Mar 2005 A1
20050096276 Coolidge et al. May 2005 A1
20050101537 Beeley et al. May 2005 A1
20050106214 Chen May 2005 A1
20050143303 Quay et al. Jun 2005 A1
20050171019 Young et al. Aug 2005 A1
20050186174 Bossard Aug 2005 A1
20050197287 Mack et al. Sep 2005 A1
20050209142 Bertilsson et al. Sep 2005 A1
20050215469 Beeley et al. Sep 2005 A1
20050215475 Ong et al. Sep 2005 A1
20050267034 Prickett et al. Dec 2005 A1
20050271702 Wright et al. Dec 2005 A1
20050281879 Chen et al. Dec 2005 A1
20060003918 Kim et al. Jan 2006 A1
20060057137 Steiness Mar 2006 A1
20060069029 Kolterman et al. Mar 2006 A1
20060073182 Wong et al. Apr 2006 A1
20060074012 Hiles et al. Apr 2006 A1
20060079448 Bertilsson et al. Apr 2006 A1
20060084605 Engelund et al. Apr 2006 A1
20060094652 Levy et al. May 2006 A1
20060094653 Levy et al. May 2006 A1
20060110423 Wright et al. May 2006 A1
20060135586 Kozlowski et al. Jun 2006 A1
20060135747 Levy et al. Jun 2006 A1
20060148713 Beeley et al. Jul 2006 A1
20060165733 Betz et al. Jul 2006 A1
20060171920 Shechter et al. Aug 2006 A1
20060172001 Ong et al. Aug 2006 A1
20060178304 Juul-Mortensen et al. Aug 2006 A1
20060183677 Young et al. Aug 2006 A1
20060183682 Juul-Mortensen Aug 2006 A1
20060210614 Quay et al. Sep 2006 A1
20060247167 Schlein et al. Nov 2006 A1
20060275252 Harris et al. Dec 2006 A1
20060287221 Knudsen et al. Dec 2006 A1
20060293232 Levy et al. Dec 2006 A1
20060293499 Bentley et al. Dec 2006 A1
20070010424 Pedersen et al. Jan 2007 A1
20070010656 Beeley et al. Jan 2007 A1
20070014818 Betz et al. Jan 2007 A1
20070021336 Anderson et al. Jan 2007 A1
20070037750 Young et al. Feb 2007 A1
20070049531 Knudsen et al. Mar 2007 A1
20070059373 Oberg Mar 2007 A1
20070059374 Hokenson et al. Mar 2007 A1
20070065469 Betz et al. Mar 2007 A1
20070066528 Beeley et al. Mar 2007 A1
20070092482 Bossard et al. Apr 2007 A1
20070129284 Kjeldsen et al. Jun 2007 A1
20070166352 Wright et al. Jul 2007 A1
20070196416 Li et al. Aug 2007 A1
20070281940 Dugi et al. Dec 2007 A1
20080071063 Allan et al. Mar 2008 A1
20080091176 Alessi et al. Apr 2008 A1
20080119393 Beeley et al. May 2008 A1
20080119569 Wright et al. May 2008 A1
20080125348 Wright et al. May 2008 A1
20080125349 Wright et al. May 2008 A1
20080125351 Wright et al. May 2008 A1
20080125353 Hiles et al. May 2008 A1
20080125361 Ludvigsen et al. May 2008 A1
20080171848 Christiansen et al. Jul 2008 A1
20080176802 Prickett et al. Jul 2008 A1
20080176804 Mack et al. Jul 2008 A1
20080200390 Prickett et al. Aug 2008 A1
20080213288 Michelsen et al. Sep 2008 A1
20080214467 Prickett et al. Sep 2008 A1
20080233053 Gross et al. Sep 2008 A1
20080249007 Lau et al. Oct 2008 A1
20080249018 Kolterman et al. Oct 2008 A1
20080249089 Himmelsbach et al. Oct 2008 A1
20080255159 Himmelsbach et al. Oct 2008 A1
20080260838 Hokenson et al. Oct 2008 A1
20080260847 Wright et al. Oct 2008 A1
20080274952 Soares et al. Nov 2008 A1
20080280814 Ludvigsen et al. Nov 2008 A1
20080300171 Balkan et al. Dec 2008 A1
20080312157 Levy et al. Dec 2008 A1
20080318865 Juul-Mortensen Dec 2008 A1
20090011976 Ludvigsen et al. Jan 2009 A1
20090018053 L'Italien et al. Jan 2009 A1
20090029913 Beeley et al. Jan 2009 A1
20090035253 Wright et al. Feb 2009 A1
20090036364 Levy et al. Feb 2009 A1
20090043264 Glejbol et al. Feb 2009 A1
20090054315 Bock et al. Feb 2009 A1
20090069226 Ong et al. Mar 2009 A1
20090082255 Brunner-Schwarz et al. Mar 2009 A1
20090088369 Steiness Apr 2009 A1
20090098130 Bradshaw et al. Apr 2009 A1
20090110647 Richardson et al. Apr 2009 A1
20090111749 Richardson et al. Apr 2009 A1
20090137456 Dimarchi et al. May 2009 A1
20090137466 Anderson et al. May 2009 A1
20090163423 Young et al. Jun 2009 A1
20090170750 Kjeldsen et al. Jul 2009 A1
20090176704 Beeley et al. Jul 2009 A1
20090180953 Gotthardt et al. Jul 2009 A1
20090186817 Ghosh et al. Jul 2009 A1
20090186819 Carrier et al. Jul 2009 A1
20090203597 Rabinovitch et al. Aug 2009 A1
20090203603 Baron et al. Aug 2009 A1
20090215688 Knudsen et al. Aug 2009 A1
20090215694 Kolterman et al. Aug 2009 A1
20090221485 James Sep 2009 A1
20090226431 Habib Sep 2009 A1
20090232775 Bertilsson et al. Sep 2009 A1
20090232807 Glaesner et al. Sep 2009 A1
20090232891 Gelber et al. Sep 2009 A1
20090239796 Fineman et al. Sep 2009 A1
20090247463 Wright et al. Oct 2009 A1
20090253625 Greig et al. Oct 2009 A1
20090258818 Surolia et al. Oct 2009 A1
20090264352 Anderson et al. Oct 2009 A1
20090280169 Leonard Nov 2009 A1
20090280170 Lee et al. Nov 2009 A1
20090286716 Knudsen et al. Nov 2009 A1
20090286723 Levy et al. Nov 2009 A1
20090291886 Ong et al. Nov 2009 A1
20090298757 Bloom et al. Dec 2009 A1
20090308390 Smutney et al. Dec 2009 A1
20090308391 Smutney et al. Dec 2009 A1
20090308392 Smutney et al. Dec 2009 A1
20090325860 Costantino et al. Dec 2009 A1
20100009904 Lv et al. Jan 2010 A1
20100016806 Glejbol et al. Jan 2010 A1
20100022455 Chilkoti Jan 2010 A1
20100029554 Ghosh et al. Feb 2010 A1
20100041867 Shechter et al. Feb 2010 A1
20100056451 Juul-Mortensen et al. Mar 2010 A1
20100087365 Cherif-Cheikh et al. Apr 2010 A1
20100099619 Levy et al. Apr 2010 A1
20100137558 Lee et al. Jun 2010 A1
20100152097 Wright et al. Jun 2010 A1
20100152111 Wright et al. Jun 2010 A1
20100168011 Jennings, Jr. et al. Jul 2010 A1
20100173844 Ludvigsen et al. Jul 2010 A1
20100185184 Alessi et al. Jul 2010 A1
20100190699 Dimarchi et al. Jul 2010 A1
20100190701 Day et al. Jul 2010 A1
20100190715 Schlein et al. Jul 2010 A1
20100196405 Ng et al. Aug 2010 A1
20100197565 Smutney et al. Aug 2010 A1
20100210505 Bossard et al. Aug 2010 A1
20100216692 Brunner-Schwarz et al. Aug 2010 A1
20100240586 Bao et al. Sep 2010 A1
20100247661 Hokenson et al. Sep 2010 A1
20100261637 Spetzler et al. Oct 2010 A1
20100278924 Oberg et al. Nov 2010 A1
20100292172 Ghosh et al. Nov 2010 A1
20100317056 Tiwari et al. Dec 2010 A1
20100317576 Rothkopf Dec 2010 A1
20100331246 Dimarchi et al. Dec 2010 A1
20110003004 Hokenson et al. Jan 2011 A1
20110034373 Coskun et al. Feb 2011 A1
20110034377 Young et al. Feb 2011 A1
20110059181 Hu et al. Mar 2011 A1
20110065633 Dimarchi et al. Mar 2011 A1
20110065731 Dugi et al. Mar 2011 A1
20110071076 Beeley et al. Mar 2011 A1
20110091420 Liu et al. Apr 2011 A1
20110097386 Steiner et al. Apr 2011 A1
20110097751 Nicolaou et al. Apr 2011 A1
20110098217 Dimarchi et al. Apr 2011 A1
20110112277 Kozlowski et al. May 2011 A1
20110118136 Köster et al. May 2011 A1
20110123487 Chilkoti May 2011 A1
20110129522 Mevorat-Kaplan et al. Jun 2011 A1
20110136737 Levy et al. Jun 2011 A1
20110152181 Alsina-Fernandez et al. Jun 2011 A1
20110152182 Alsina-Fernandez et al. Jun 2011 A1
20110152185 Plum et al. Jun 2011 A1
20110166062 Dimarchi et al. Jul 2011 A1
20110166554 Alessi et al. Jul 2011 A1
20110171178 Levetan et al. Jul 2011 A1
20110178014 Hathaway et al. Jul 2011 A1
20110178242 Harris et al. Jul 2011 A1
20110190200 Dimarchi et al. Aug 2011 A1
20110195897 Kajihara et al. Aug 2011 A1
20110230409 Knudsen et al. Sep 2011 A1
20110237503 Alsina-Fernandez et al. Sep 2011 A1
20110237510 Steiner et al. Sep 2011 A1
20110245162 Fineman et al. Oct 2011 A1
20110257092 Dimarchi et al. Oct 2011 A1
20110263496 Fineman et al. Oct 2011 A1
20110281798 Kolterman et al. Nov 2011 A1
20110288003 Dimarchi et al. Nov 2011 A1
20110301080 Bush et al. Dec 2011 A1
20110301081 Becker et al. Dec 2011 A1
20110301084 Lau et al. Dec 2011 A1
20110306549 Tatarkiewicz et al. Dec 2011 A1
20120004168 Young et al. Jan 2012 A1
20120021978 Werner et al. Jan 2012 A1
20120040899 Costello et al. Feb 2012 A1
20120046222 Alfaro-Lopez et al. Feb 2012 A1
20120071510 Leone-Bay et al. Mar 2012 A1
20120071817 Ward et al. Mar 2012 A1
20120094356 Chung et al. Apr 2012 A1
20120100070 Ahn et al. Apr 2012 A1
20120122783 Dimarchi et al. May 2012 A1
20120135922 Prickett et al. May 2012 A1
20120136318 Lanin et al. May 2012 A1
20120148586 Chou et al. Jun 2012 A1
20120149639 Balkan et al. Jun 2012 A1
20120157932 Glejbol et al. Jun 2012 A1
20120172295 Dimarchi et al. Jul 2012 A1
20120177697 Chen Jul 2012 A1
20120196795 Xu et al. Aug 2012 A1
20120196796 Soares et al. Aug 2012 A1
20120196802 Lv et al. Aug 2012 A1
20120196804 Dimarchi et al. Aug 2012 A1
20120208755 Leung et al. Aug 2012 A1
20120208831 Himmelsbach et al. Aug 2012 A1
20120209213 Theucher Aug 2012 A1
20120225810 Pedersen et al. Sep 2012 A1
20120231022 Bass et al. Sep 2012 A1
20120238493 Dimarchi et al. Sep 2012 A1
20120238496 Fan et al. Sep 2012 A1
20120253023 Levy et al. Oct 2012 A1
20120258912 Bentley et al. Oct 2012 A1
20120258985 Kozlowski et al. Oct 2012 A1
20120264683 Coskun et al. Oct 2012 A1
20120264684 Kajihara et al. Oct 2012 A1
20120276098 Hamilton et al. Nov 2012 A1
20120277154 Fan et al. Nov 2012 A1
20120283179 Brunner-Schwarz et al. Nov 2012 A1
20120294855 Van Cauter et al. Nov 2012 A1
20120295836 Knudsen et al. Nov 2012 A1
20120295846 Hagendorf et al. Nov 2012 A1
20120295850 Tatarkiewicz et al. Nov 2012 A1
20120302501 Coolidge et al. Nov 2012 A1
20120309975 Colca et al. Dec 2012 A1
20120316108 Chen et al. Dec 2012 A1
20120316138 Colca et al. Dec 2012 A1
20120322725 Dimarchi et al. Dec 2012 A1
20120322728 Colca et al. Dec 2012 A1
20120329715 Greig et al. Dec 2012 A1
20130005664 Chilkoti Jan 2013 A1
20130023470 Young et al. Jan 2013 A1
20130023471 Rabinovitch et al. Jan 2013 A1
20130046245 Raab et al. Feb 2013 A1
20130053350 Colca et al. Feb 2013 A1
20130065826 Soula et al. Mar 2013 A1
20130079277 Chilkoti Mar 2013 A1
20130079278 Lau et al. Mar 2013 A1
20130084277 Arnold et al. Apr 2013 A1
20130085099 Chilkoti Apr 2013 A1
20130085104 Chilkoti Apr 2013 A1
20130089878 Nicolaou et al. Apr 2013 A1
20130090286 Dimarchi et al. Apr 2013 A1
20130095037 Gotthardt et al. Apr 2013 A1
20130096258 Bossard et al. Apr 2013 A1
20130104887 Smutney et al. May 2013 A1
20130116172 Dimarchi et al. May 2013 A1
20130116175 Shechter et al. May 2013 A1
20130118491 Richardson et al. May 2013 A1
20130123178 Dimarchi et al. May 2013 A1
20130123462 Dimarchi et al. May 2013 A1
20130125886 Richardson et al. May 2013 A1
20130130977 Wright et al. May 2013 A1
20130137631 Levy et al. May 2013 A1
20130137645 Rosendahl May 2013 A1
20130142795 Bai et al. Jun 2013 A1
20130156849 De Fougerolles et al. Jun 2013 A1
20130157934 Dimarchi et al. Jun 2013 A1
20130157953 Petersen et al. Jun 2013 A1
20130164310 Annathur et al. Jun 2013 A1
20130165370 Bock et al. Jun 2013 A1
20130165379 Kolterman et al. Jun 2013 A1
20130172274 Chilkoti Jul 2013 A1
20130178411 Chilkoti Jul 2013 A1
20130178415 Soula Jul 2013 A1
20130184203 Alfaro-Lopez et al. Jul 2013 A1
20130184443 Bentley et al. Jul 2013 A1
20130189365 Hokenson et al. Jul 2013 A1
20130199527 Smutney et al. Aug 2013 A1
20130203660 Day et al. Aug 2013 A1
20130209586 Hathaway et al. Aug 2013 A1
20130217622 Lee et al. Aug 2013 A1
20130236974 De Fougerolles Sep 2013 A1
20130237592 De Fougerolles et al. Sep 2013 A1
20130237593 De Fougerolles et al. Sep 2013 A1
20130237594 De Fougerolles et al. Sep 2013 A1
20130244278 De Fougerolles et al. Sep 2013 A1
20130244279 De Fougerolles et al. Sep 2013 A1
20130245104 De Fougerolles et al. Sep 2013 A1
20130245105 De Fougerolles et al. Sep 2013 A1
20130245106 De Fougerolles et al. Sep 2013 A1
20130245107 De Fougerolles et al. Sep 2013 A1
20130252281 De Fougerolles et al. Sep 2013 A1
20130253043 De Fougerolles et al. Sep 2013 A1
20130259923 Bancel et al. Oct 2013 A1
20130259924 Bancel et al. Oct 2013 A1
20130266640 De Fougerolles et al. Oct 2013 A1
20130280206 Kozlowski et al. Oct 2013 A1
20130281368 Bilsky et al. Oct 2013 A1
20130281374 Levy et al. Oct 2013 A1
20130284912 Vogel et al. Oct 2013 A1
20130288958 Lau et al. Oct 2013 A1
20130289241 Bai et al. Oct 2013 A1
20130291866 Smutney et al. Nov 2013 A1
20130291867 Smutney et al. Nov 2013 A1
20130296236 Silvestre et al. Nov 2013 A1
20130303442 Levy et al. Nov 2013 A1
20130310310 Liu et al. Nov 2013 A1
20130310538 Chilkoti Nov 2013 A1
20130331322 Young et al. Dec 2013 A1
20130336893 Haack Dec 2013 A1
20130338065 Smutney et al. Dec 2013 A1
20130338071 Knudsen et al. Dec 2013 A1
20130345134 Sauerberg et al. Dec 2013 A1
20140007873 Smutney et al. Jan 2014 A1
20140011732 Spetzler et al. Jan 2014 A1
20140014106 Smutney et al. Jan 2014 A1
20140017208 Osei Jan 2014 A1
20140031281 Wright et al. Jan 2014 A1
20140038891 Prickett et al. Feb 2014 A1
20140056924 Van Cauter Feb 2014 A1
20140066368 Mack et al. Mar 2014 A1
20140083421 Smutney et al. Mar 2014 A1
20140088003 Wright et al. Mar 2014 A1
20140100156 Haack et al. Apr 2014 A1
20140107019 Erickson et al. Apr 2014 A1
20140107021 Dimarchi et al. Apr 2014 A1
20140120120 Woo et al. May 2014 A1
20140121352 Shechter et al. May 2014 A1
20140128318 Jung et al. May 2014 A1
20140128604 Himmelsbach et al. May 2014 A1
20140135348 Dugi et al. May 2014 A1
20140141467 Tiwari et al. May 2014 A1
20140142037 Yue May 2014 A1
20140162943 Alfaro-Lopez et al. Jun 2014 A1
20140187483 Steiness Jul 2014 A1
20140200183 Hathaway et al. Jul 2014 A1
20140206608 Haack et al. Jul 2014 A1
20140206609 Haack et al. Jul 2014 A1
20140206613 Rabinovitch et al. Jul 2014 A1
20140206615 Knudsen et al. Jul 2014 A1
20140212419 Dimarchi et al. Jul 2014 A1
20140212440 Jung et al. Jul 2014 A1
20140213513 Haack et al. Jul 2014 A1
20140213516 Chilkoti Jul 2014 A1
20140220029 Michelsen et al. Aug 2014 A1
20140220134 Zierhut et al. Aug 2014 A1
20140221280 Bloom Aug 2014 A1
20140221281 Haack et al. Aug 2014 A1
20140221282 Sun et al. Aug 2014 A1
20140227264 Hamilton et al. Aug 2014 A1
20140235535 Erickson et al. Aug 2014 A1
20140243263 Rothkopf Aug 2014 A1
20140249299 Levy et al. Sep 2014 A1
20140308358 Oberg et al. Oct 2014 A1
20140309168 Rosendahl Oct 2014 A1
20140315953 Leone-Bay et al. Oct 2014 A1
20150011467 Bloom et al. Jan 2015 A1
20150126440 Day et al. May 2015 A1
20150164995 Kadereit et al. Jun 2015 A1
20150164996 Kadereit et al. Jun 2015 A1
20150164997 Haack et al. Jun 2015 A1
20150166625 Haack et al. Jun 2015 A1
20150166627 Kadereit et al. Jun 2015 A1
20150216941 Bley et al. Aug 2015 A1
20150232527 Gong et al. Aug 2015 A1
20150315260 Bossart et al. Nov 2015 A1
20150322128 Bossart et al. Nov 2015 A1
20150322129 Bossart et al. Nov 2015 A1
20150368311 Haack et al. Dec 2015 A1
20160168225 Haack et al. Jun 2016 A1
20160235855 Xiong et al. Aug 2016 A1
Foreign Referenced Citations (331)
Number Date Country
101538323 Sep 2009 CN
101559041 Oct 2009 CN
101663317 Mar 2010 CN
101798588 Aug 2010 CN
101870728 Oct 2010 CN
101601646 Mar 2011 CN
102100906 Jun 2011 CN
102363633 Feb 2012 CN
102421796 Apr 2012 CN
101444618 Jun 2012 CN
102532301 Jul 2012 CN
102649947 Aug 2012 CN
102816244 Dec 2012 CN
102827270 Dec 2012 CN
101670096 Jan 2013 CN
103304660 Sep 2013 CN
103421094 Dec 2013 CN
103665148 Mar 2014 CN
103833841 Jun 2014 CN
103908657 Jul 2014 CN
102766204 Oct 2014 CN
104926934 Sep 2015 CN
1 140 145 Jul 2005 EP
0 619 322 Dec 2005 EP
1 609 478 Dec 2005 EP
1 143 989 Dec 2006 EP
1 658 856 Mar 2010 EP
1 684 793 Sep 2011 EP
1 633 391 Oct 2011 EP
2 387 989 Nov 2011 EP
1 633 390 Jan 2012 EP
2 494 983 Sep 2012 EP
2 626 368 Aug 2013 EP
2 664 374 Nov 2013 EP
1 817 048 Feb 2014 EP
2 769 990 Aug 2014 EP
2014-227368 Dec 2014 JP
10-2012-0137271 Dec 2012 KR
10-2012-0139579 Dec 2012 KR
10-2014-0018462 Feb 2014 KR
10-2014-0058104 May 2014 KR
10-2014-0058387 May 2014 KR
10-2014-0130659 Nov 2014 KR
10-2014-0133493 Nov 2014 KR
2009121626 Feb 2011 RU
9619229 Jun 1996 WO
9805351 Mar 1998 WO
9808871 Mar 1998 WO
9830231 Jul 1998 WO
9907404 Feb 1999 WO
9925727 May 1999 WO
9925728 May 1999 WO
9934822 Jul 1999 WO
9943708 Sep 1999 WO
9947160 Sep 1999 WO
9964061 Dec 1999 WO
0015224 Mar 2000 WO
0037098 Jun 2000 WO
0041546 Jul 2000 WO
0041548 Jul 2000 WO
0055119 Sep 2000 WO
0066629 Nov 2000 WO
0071175 Nov 2000 WO
0073331 Dec 2000 WO
0151078 Jul 2001 WO
0216309 Feb 2002 WO
0234285 May 2002 WO
02067989 Sep 2002 WO
03011892 Feb 2003 WO
03020201 Mar 2003 WO
03061362 Jul 2003 WO
03077851 Sep 2003 WO
03084563 Oct 2003 WO
03092581 Nov 2003 WO
03099314 Dec 2003 WO
03101395 Dec 2003 WO
03105888 Dec 2003 WO
03105897 Dec 2003 WO
2004004779 Jan 2004 WO
2004004780 Jan 2004 WO
2004004781 Jan 2004 WO
2004005342 Jan 2004 WO
2004012672 Feb 2004 WO
2004018468 Mar 2004 WO
2004035623 Apr 2004 WO
2004045592 Jun 2004 WO
2004056313 Jul 2004 WO
2004056317 Jul 2004 WO
2004089280 Oct 2004 WO
2004089985 Oct 2004 WO
2004105781 Dec 2004 WO
2004105790 Dec 2004 WO
2005000222 Jan 2005 WO
2005000360 Jan 2005 WO
2005012347 Mar 2005 WO
2005021022 Mar 2005 WO
2005046716 May 2005 WO
2005048989 Jun 2005 WO
2005049061 Jun 2005 WO
2005049069 Jun 2005 WO
2005054291 Jun 2005 WO
2005077072 Aug 2005 WO
2005077094 Aug 2005 WO
2005081619 Sep 2005 WO
2005102293 Nov 2005 WO
2005110425 Nov 2005 WO
2005115437 Dec 2005 WO
2005117584 Dec 2005 WO
2005120492 Dec 2005 WO
2006017688 Feb 2006 WO
2006024275 Mar 2006 WO
2006024631 Mar 2006 WO
2006029634 Mar 2006 WO
2006037811 Apr 2006 WO
2006044531 Apr 2006 WO
2006051103 May 2006 WO
2006051110 May 2006 WO
2006066024 Jun 2006 WO
2006069388 Jun 2006 WO
2006073890 Jul 2006 WO
2006074600 Jul 2006 WO
2006083254 Aug 2006 WO
2006086769 Aug 2006 WO
2006097535 Sep 2006 WO
2006110887 Oct 2006 WO
2006114396 Nov 2006 WO
2006125763 Nov 2006 WO
2006134340 Dec 2006 WO
2006138572 Dec 2006 WO
2007019331 Feb 2007 WO
2007022123 Mar 2007 WO
2007024700 Mar 2007 WO
2007033316 Mar 2007 WO
2007033372 Mar 2007 WO
2007035665 Mar 2007 WO
2007047834 Apr 2007 WO
2007047922 Apr 2007 WO
2007056362 May 2007 WO
2007064691 Jun 2007 WO
2007065156 Jun 2007 WO
2007067964 Jun 2007 WO
2007075534 Jul 2007 WO
2007109354 Sep 2007 WO
2007120899 Oct 2007 WO
2007121411 Oct 2007 WO
2007128761 Nov 2007 WO
2007133778 Nov 2007 WO
2007139941 Dec 2007 WO
2007140284 Dec 2007 WO
2008021133 Feb 2008 WO
2008021560 Feb 2008 WO
2008023050 Feb 2008 WO
2008038147 Apr 2008 WO
2008058461 May 2008 WO
2008071972 Jun 2008 WO
2008073448 Jun 2008 WO
2008081418 Jul 2008 WO
2008086086 Jul 2008 WO
2008098212 Aug 2008 WO
2008101017 Aug 2008 WO
2008148839 Dec 2008 WO
2008152403 Dec 2008 WO
2009020802 Feb 2009 WO
2009024015 Feb 2009 WO
2009029847 Mar 2009 WO
2009030771 Mar 2009 WO
2009035540 Mar 2009 WO
2009055740 Apr 2009 WO
2009055742 Apr 2009 WO
2009058662 May 2009 WO
2009058734 May 2009 WO
2009063072 May 2009 WO
2009067268 May 2009 WO
2009095479 Aug 2009 WO
2009099763 Aug 2009 WO
2009113099 Sep 2009 WO
2009137078 Nov 2009 WO
2009137080 Nov 2009 WO
2009143014 Nov 2009 WO
2009143285 Nov 2009 WO
2009152477 Dec 2009 WO
2009153960 Dec 2009 WO
2009155257 Dec 2009 WO
2009155258 Dec 2009 WO
2009158704 Dec 2009 WO
2010011439 Jan 2010 WO
2011006497 Jan 2010 WO
2010013012 Feb 2010 WO
2010043566 Apr 2010 WO
2010070251 Jun 2010 WO
2010070252 Jun 2010 WO
2010070253 Jun 2010 WO
2010070255 Jun 2010 WO
2010071807 Jun 2010 WO
2010096052 Aug 2010 WO
2010096142 Aug 2010 WO
2010102148 Sep 2010 WO
2010120476 Oct 2010 WO
2010121559 Oct 2010 WO
2010123290 Oct 2010 WO
2010133675 Nov 2010 WO
2010133676 Nov 2010 WO
2010138671 Dec 2010 WO
2010142665 Dec 2010 WO
2010148089 Dec 2010 WO
2011000095 Jan 2011 WO
2011011675 Jan 2011 WO
2011012718 Feb 2011 WO
2011020319 Feb 2011 WO
2011020320 Feb 2011 WO
2011024110 Mar 2011 WO
2011039096 Apr 2011 WO
2011049713 Apr 2011 WO
2011052523 May 2011 WO
2011056713 May 2011 WO
2011058082 May 2011 WO
2011058083 May 2011 WO
2011075393 Jun 2011 WO
2011075514 Jun 2011 WO
2011075623 Jun 2011 WO
2011080103 Jul 2011 WO
2011084453 Jul 2011 WO
2011084456 Jul 2011 WO
2011084459 Jul 2011 WO
2011087671 Jul 2011 WO
2011087672 Jul 2011 WO
2011088837 Jul 2011 WO
2011094337 Aug 2011 WO
2011109784 Sep 2011 WO
2011117415 Sep 2011 WO
2011117416 Sep 2011 WO
2011119657 Sep 2011 WO
2010142665 Nov 2011 WO
2011143208 Nov 2011 WO
2011143209 Nov 2011 WO
2011144751 Nov 2011 WO
2011153965 Dec 2011 WO
2011156407 Dec 2011 WO
2011160630 Dec 2011 WO
2011162830 Dec 2011 WO
2011163012 Dec 2011 WO
2011163272 Dec 2011 WO
2011163473 Dec 2011 WO
2012012352 Jan 2012 WO
2012012460 Jan 2012 WO
2012015975 Feb 2012 WO
2012031518 Mar 2012 WO
2012035139 Mar 2012 WO
2012050923 Apr 2012 WO
2012059762 May 2012 WO
2012064892 May 2012 WO
2012080471 Jun 2012 WO
2012088116 Jun 2012 WO
2012088157 Jun 2012 WO
2012122535 Sep 2012 WO
2012130015 Oct 2012 WO
2012138941 Oct 2012 WO
2012140647 Oct 2012 WO
2012150503 Nov 2012 WO
2012158965 Nov 2012 WO
2012162547 Nov 2012 WO
2012167744 Dec 2012 WO
2012169798 Dec 2012 WO
2012173422 Dec 2012 WO
2012177443 Dec 2012 WO
2012177444 Dec 2012 WO
2012177929 Dec 2012 WO
2013002580 Jan 2013 WO
2013004983 Jan 2013 WO
2013009545 Jan 2013 WO
2013029279 Mar 2013 WO
2013041678 Mar 2013 WO
2012174478 May 2013 WO
2013060850 May 2013 WO
2013074910 May 2013 WO
2013078500 Jun 2013 WO
2013090648 Jun 2013 WO
2013092703 Jun 2013 WO
2013093720 Jun 2013 WO
2013101749 Jul 2013 WO
2013104861 Jul 2013 WO
2013148871 Oct 2013 WO
2013148966 Oct 2013 WO
2013151663 Oct 2013 WO
2013151664 Oct 2013 WO
2013151665 Oct 2013 WO
2013151666 Oct 2013 WO
2013151667 Oct 2013 WO
2013151668 Oct 2013 WO
2013151669 Oct 2013 WO
2013151670 Oct 2013 WO
2013151671 Oct 2013 WO
2013151672 Oct 2013 WO
2013151736 Oct 2013 WO
2013160397 Oct 2013 WO
2013163162 Oct 2013 WO
2013164484 Nov 2013 WO
2013171135 Nov 2013 WO
2013177565 Nov 2013 WO
2013186240 Dec 2013 WO
2013192130 Dec 2013 WO
2014012069 Jan 2014 WO
2014016300 Jan 2014 WO
2014017843 Jan 2014 WO
2014017845 Jan 2014 WO
2014017849 Jan 2014 WO
2014027253 Feb 2014 WO
2014027254 Feb 2014 WO
2014041195 Mar 2014 WO
2014041375 Mar 2014 WO
2014056872 Apr 2014 WO
2014073842 May 2014 WO
2014073845 May 2014 WO
2014081872 May 2014 WO
2014091316 Jun 2014 WO
2014096145 Jun 2014 WO
2014140222 Sep 2014 WO
2014152460 Sep 2014 WO
2014158900 Oct 2014 WO
2014170496 Oct 2014 WO
2015055801 Apr 2015 WO
2015055802 Apr 2015 WO
2015067716 May 2015 WO
2015086728 Jun 2015 WO
2015086729 Jun 2015 WO
2015086730 Jun 2015 WO
2015086731 Jun 2015 WO
2015086732 Jun 2015 WO
2015086733 Jun 2015 WO
2015100876 Jul 2015 WO
2015104314 Jul 2015 WO
Non-Patent Literature Citations (195)
Entry
US 8,729,011, 05/2014, Dimarchi et al. (withdrawn)
WHO Cardiovascular guidelines “Prevention of Cardiovascular Disease: Guidelines for assessment and management of cardiovascular risk” accessed at Mar. 16, 2015 at URL who.intJcardiovascular—diseases/guidelines/Full%20text.pdf.
Martin, et al. “Neurodegenation in excitotoxcity, global cerebral ischemia, and target deprivation: A perspective on the contributions of aptopsis and necrosis,” Brain Res. Bull, 46:281-309 (1998).
United Healthcare, diabetes, http://www.uhc.com/source4women/health—topics/diabetes/relatedinformation/d0f0417b073bf110VgnVCM1000002f10b10a—.htm—referenced Aug. 22, 2013.
eMedicine Health, diabetes causes, http://www.onhealth.com/diabetes—health/page3.htm#diabetes—causes (referenced Aug. 22, 2013).
St. John Providence Health Center; Preventing Obesity; http://www.stjohnprovidence.org/HealthInfoLib/swarticle.aspx?type=85&id=P07863 (referenced Aug. 22, 2013).
Medline Plus, obesity, available at http://www.nlm.nih.gov/medlineplus/obesity.html—(referenced Aug. 22, 2013).
Bhat et al. (Jun. 1, 2013) “A novel GIP-oxyntomodulin hybrid peptide acting through GIP, glucagon and GLP-1 receptors exhibits weight reducing and anti-diabetic properties,” Biochem. Pharmacol. 85:1655-1662.
Pocai (2009) “Glucagon-like peptide 1/glucagon receptor dual agonism reverses obesity in mice,” Diabetes. 58 (10):2258-2266.
Extended European Search Report corresponding to European Patent Application No. 14305503.6, dated Sep. 23, 2014.
International Search Report with Written Opinion correpsonding to International Patent Application No. PCT/EP2015/057416, mailed Jun. 22, 2015.
Vojkovsky (1995) “Detection of secondary amines on solid phase,” Peptide Research 8:236-237.
Ward et al. (Nov. 2013) “Peptide lipidation stabilizes structure to enhance biological function,” Mol. Metabol. 2 (4):468-479.
World Health Organization (2007) “Prevention of Cardiovascular Disease,” WorldHealth Organization. pp. 1-86.
Yun et al. (Feb. 2012) “Solution Structure of LXXLL-related Cofactor Peptide of Orphan Nuclear Receptor FTZ-F1.” Bulletin of the Korean Chemical Society, 33(2):583-588.
European Search Report corresponding to European Patent Application No. 12172010, dated Apr. 19, 2013.
European Search Report corresponding to European Patent Application No. 12306232, dated Apr. 19, 2013.
European Search Report corresponding to European Patent Application No. 12306647, dated May 22, 2013.
European Search Report corresponding to European Patent Application No. 13306712, dated May 27, 2014.
European Search Report corresponding to European Patent Application No. 13306713, dated Jun. 12, 2014.
European Search Report corresponding to European Patent Application No. 13306714, dated May 28, 2014.
European Search Report corresponding to European Patent Application No. 13306715, dated Jun. 12, 2014.
European Search Report corresponding to European Patent Application No. 13306716, dated May 27, 2014.
European Search Report corresponding to European Patent Application No. 13306717, dated Jun. 3, 2014.
International Preliminary Report on Patentability corresponding to International Patent Application No. PCT/EP2013/062090, issued Nov. 24, 2014.
International Preliminary Report on Patentability corresponding to International Patent Application No. PCT/EP2013/070882, issued Dec. 1, 2014.
International Preliminary Report on Patentability corresponding to International Patent Application No. PCT/EP2013/077307, issued Feb. 12, 2015.
International Preliminary Report on Patentability corresponding to International Patent Application No. PCT/EP2013/077310, issued Feb. 2, 2015.
International Preliminary Report on Patentability corresponding to International Patent Application No. PCT/EP2013/077312, issued Feb. 13, 2015.
International Preliminary Report on Patentability corresponding to International Patent Application No. PCT/EP2013/077313, issued Feb. 12, 2015.
International Preliminary Report on Patentability corresponding to International Patent Application No. PCT/EP2014/077336, dated Feb. 26, 2016.
International Preliminary Report on Patentability corresponding to International Patent Application No. PCT/EP2014/077337, dated Jun. 14, 2016.
International Preliminary Report on Patentability corresponding to International Patent Application No. PCT/EP2014/077338, dated Jun. 14, 2016.
International Preliminary Report on Patentability corresponding to International Patent Application No. PCT/EP2014/077339, dated Jun. 14, 2016.
International Preliminary Report on Patentability corresponding to International Patent Application No. PCT/EP2014/077340, dated Jun. 14, 2016.
International Preliminary Report on Patentability corresponding to International Patent Application No. PCT/EP2014/077341, dated Jun. 14, 2016.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2013/062090, mailed Feb. 7, 2014.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2013/070882, mailed Dec. 5, 2013.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2013/077307, mailed Feb. 18, 2014.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2013/077310, mailed Feb. 18, 2014.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2013/077312, mailed Feb. 18, 2014.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2013/077313, mailed Feb. 18, 2014.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2014/077336, mailed Mar. 18, 2015.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2014/077337, mailed Apr. 1, 2015.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2014/077338, mailed Mar. 26, 2015.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2014/077339, mailed May 11, 2015.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2014/077340, mailed Mar. 18, 2015.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2014/077341, mailed Mar. 18, 2015.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2015/057417, mailed Jun. 17, 2015.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2015/057418, mailed Jun. 19, 2015.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2015/063607, mailed Sep. 23, 2015.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2016/062496, mailed Aug. 3, 2016.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2016/063332, mailed Aug. 10, 2016.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2016/063339, mailed Aug. 8, 2016.
Amylin Pharmaceuticals, Inc. (2007) “Byetta: Exenatide Injection,” Product Information. Accessible on the Internet at URL: http://www.accessdata.fda.gov/drugsatfda—docs/label/2008/021773s012lbl.pdf. [Last Accessed Jun. 2, 2014].
Biron et al. (2006) “Optimized selective N-methylation of peptides on solid support,” J. Peptide Sci. 12:213-219.
Bis et al. (Jun. 27, 2014) “Antimicrobial preservatives induce aggregation of interferon alpha-2a: the order in which preservatives induce protein aggregation is independent of the protein,” Int. J. Pharm. 472:356-361.
Braga et al. (2005) “Making Crystals from Crystals: a green route to crystal engineering and polymorphism,” Chem. Commun. 2005:3635-3645.
Bromer (1983) “Chemical Characteristics of Glucagon,” Handbook of Experimental Pharmacology. 66:1-22.
Chae et al. (2010) “The fatty acid conjugated exendin-4 analogs for type 2 antidiabetic therapeutics,” Journal of controlled Release. 144:10-16.
Chen et al. (Jan. 2014) “Hyaluronic acid-based drug conjugates: state-of-the-art and perspectives,” J. Biomed. Nanotechnol. 10(1):4-16.
Deacon (2004) “Circulation and degradation of GIP and GLP-1,” Horm. Metab. Res. 36:761-765.
Donnelly (May 2012) “The structure and function of the glucagon-like peptide-1 receptor and its ligands,” Br. J. Pharmacol. 166(1):27-41.
Eng et al. (1990) “Purification and structure of exendin-3, a new pancreatic secretagogue isolated from Heloderma horridum venom,” J. Biol. Chem. 265:20259-20262.
Ferry, Jr. “Diabetes Health (cont.),” MedicineNet. Accessible on the Internet at URL: http://www.onhelath.com/diabetes—health/page3.htm. [Last Accessed Aug. 22, 2013].
Ficht et al. (2008) “Solid-phase Synthesis of Peptide and Glycopeptide Thioesters through Side-Chain-Anchoring Strategies,” Chem. Eur. J. 14:3620-3629.
Finan et al. (Dec. 8, 2014) “A rationally designed monomeric peptide triagonist corrects obesity and diabetes in odents,” Nat. Med. 21(1):27-36.—with supplementary information.
Finan et al. (Oct. 30, 2013) “Unimolecular Dual Incretins Maximize Metabolic Benefits in Rodents, Monkeys, and Humans,” Sci. Trans. Med. 5:209RA151.
Furman (Mar. 15, 2012) “The development of Byetta (exenatide) from the venom of the Gilo monster as an anti-diabetic agent,” Toxicon. 59:464-471.
Gault et al. (2007) “Chemical gastric inhibitory polypeptide receptor antagonism protects against obesity, insulin esistance, glucose intolerance and associated disturbances in mice fed high-fat and cafeteria diets,” Diabetologia. 50:1752-1762.
Göke et al. (1993) “Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of insulin-secreting beta-cells,” J. Biol. Chem. 268:19650-19655.
Herling et al. (1998) “Pharmacodynamic profile of a novel inhibitor of the hepatic glucose-6-phosphatase system,” Am. J. Physiol. 274(6 Pt 1):G1087-G1093.
Joshi et al. (2000) “The degradation pathways of glucagon in acidic solutions,” Int. J. Pharm. 203(1-2):115-125.
Kaiser et al. (1970) “Color test for detection of free terminal amino groups in the solid-phase synthesis of peptides.” Anal. Biochem. 34:595-598.
Kamerzell et al. (2011) “Protein-excipient interactions: Mechanisms and biophysical characterization applied to protein formulation development,” Adv. Drug Deilv. Rev. 63:1118-1159.
Kazakos et al. (2011) “Incretin effect: GLP-1, GIP, DPP4,” Diabetes Res Clin Pract. 93(Suppl 1):S32-S36. et al. (2011) “Incretin effect: GLP-1, GIP, DPP4,” Diabetes Res Clin Pract. 93(Suppl 1):S32-S36.
Knudsen et al. (2000) “Potent derivatives of glucagon-like peptide-1 with pharmacokinetic properties suitable for once daily administration” J. Med. Chem. 43(9):1664-1669.
Kong et al. (2010) “Long acting hyaluronate-exendin 4 conjugate for the treatment of type 2 diabetes,” Biomaterials. 31:4121-4128.
Korczyn et al. (2002) “Emerging Therapies in the Pharmacological Treatment of Parkinson's Disease,” Drugs. 62:775-786.
Lee et al. (May 10, 2013) “Hormonal Response to a Mixed-Meal Challenge After Reversal of Gastric Bypass for Hypoglycemia,” J. Clin. Endocrinol. Metab. 98(7):E1208-E1212.
Li et al. (Jul. 25, 2012) “Cloning, expressing of Exendin-4 analogue and bioactivity analysis in vivo,” Chinese Journal of Biotechnology. 28(7):877-886.
Liu et al (2011) “Solid phase peptide synthesis and analysis for exendin-4,” China Biotechnology. 31(2):69-73.—English abstract and drawings.
Lorenz et al. (2013) “Recent progress and future options in the development of GLP-1 receptor agonists for the reatment of diabesity” Bioorg. Med. Chem. Lett. 23(14):4011-4018.
Lozano et al. (2013) “Polyarginine nanocapsules: a new platform for intracellular drug delivery,” Journal of Vanoparticle Research. 15:1515. pp. 1-14.
Margolis (2004) “Diagnosis of Huntington Disease,” Clin. Chem. 49:1726-1732.
Martin et al. (1998) “Neurodegeneration in excitotoxicity, global cerebral ischemia, and target deprivation: A perspective on the contributions of apoptosis and necrosis,” Brain Res. Bull. 46:281-309.
Medline Plus “Obesity,” National Insitute of Health. Accessible on the Internet at URL: http://www.nlm.nih.gov/medlineplus/obesity.html. [Last Accessed Aug. 22, 2013].
Mieier et al. (May 21, 2015) “Incretin-based therapies: where will we be 50 years from now?” Diabetologia. 58:1745-1750.
Nauck et al. (1993) “Additive insulinotropic effects of exogenous synthetic human gastric inhibitory polypeptide and glucagon-like peptide-1-(7-36) amide infused at near-physiological insulinotropic hormone and glucose concentrations,” J. Clin. Endocrinol. Metab. 76:912-917.
Norwegian Institute of Public Health (Dec. 19, 2013) ATC/DDD Index for Cardiovascular System.
Oh et al. (2010) “Target specific and long-acting delivery of protein, peptide, and nucleotide therapeutics using hyaluronic acid derivatives,” Journal of Controlled Release. 141:2-12.
Pan et al. (2006) “Design of a long acting peptide functioning as both a glucagon-like peptide-1 receptor agonist and a glucagon receptor antagonist.”Joumal of Biological Chemistry. 281(18):12506-12515.
Pocai (Dec. 14, 2013) “Action and therapeutic potential of oxyntomodulin,” Molecular Metabolism 3:2412-51.
Rentier et al. (Mar. 26, 2015) “Synthesis of diastereomerically pure Lys(Nε-lipoyl) building blocks and their use in Fmoc/tBu solid phase synthesis of lipoyl-containing peptides for diagnosis of primary biliary cirrhosis,” Journal of Peptide Science. 21(5):408-414.
Robberecht et al. (1986) “Comparative efficacy of seven synthetic glucagon analogs, modified in position 1, 2 and/or 12, on liver and heart adenylate cyclase from rat,” Peptides. 7(1):109-112.
Rovo et al. (May 2014) “Rational design of a-helix-stabilized exendin-4 analogues,” Biochemistry. 53(22):3540-3552.
Seddon (2004) “Pseudopolymorph: A polemic,” Crystal Growth and Design. 4(6):1087.
Shiau et al. (1998) “The structural basis of estrogen receptor/coactivator recognition and the antagonism of this interaction by tamoxifen,” Cell. 95(7):927-937.
St. John Providence Health System “Preventing Obesity in Children,” St. John Providence Health System. Accessible on the Internet at URL: http://www.stjohnprovidence.org/HealthInfoLib/swarticle.aspx?type=85&id=P07863. [Last Accessed Aug. 22, 2013].
Tasyurek et al. (Jul. 2014) “Incretins: Their physiology and application in the treatment of diabetes mellitus,” Diabetes Metab. Res. Rev. 30(5):354-371.
Ueda et al. (2010) “Identification of glycosylated exendin-4 analogue with prolonged blood glucose-lowering activity through glycosylation scanning substitution,” Bioorg. Med. Chem. Lett. 20(15):4631-4634.
United Healthcare “Diabetes,” United Healthcare. Accessible on the Internet at URL: http://www.uhc.com/source4women/health—topics/diabetes/relatedinformation/d0f0417b073bf110VgnVCM1000002f10b10a.htm. [Last Accessed Aug. 22, 2013].
Unson et al. (1993) “The role of histidine-1 in glucagon action,” Arch. Biochem. Biophys. 300(2):747-750.
Vippagunta et al. (2001) “Crystalline Solids,” Advanced Drug Delivery Reviews. 48:3-26.
Bayram et al. (Sep. 2014) “Effects of glucagon-like peptide-1 in diabetic rat small resistance arteries,” Journal of Cardiovascular Pharmacology. 64(3):277-84.
Brom et al. (Feb. 1, 2014) “Non-invasive quantification of the beta cell mass by SPECT with 111In-labelled exendin,” Diabetologia. 57(5):950-959.
Cai et al. (Dec. 2014) “Rb and p107 are required for alpha cell survival, beta cell cycle control and glucagon-like peptide-1 action,” Diabetologia. 57(12):2555-2565.
Charokopou et al. (Nov. 2014) “Cost-effectiveness of saxagliptin compared to GLP-1 analogues as an add-on to insulin in the treatment of type 2 diabetes mellitus from a UK health care perspective,” Value in Health. 17(7):A347. Abstract No. PDB89.
Chen et al. (Dec. 14, 2013) “Exendin-4 is effective against metabolic disorders induced by intrauterine and postnatal overnutrition in rodents,” Diabetologia. 57(3):614-622.
Choi et al. (Jun. 2014) “A long-acting exendin-4 analog conjugate to the human fcfragment reveals low immunogenic potential,” Diabetes. 63(Suppl 1):A259-A260. Abstract No. 1009-P.
Clemmensen et al. (Dec. 30, 2013) “GLP-1/glucagon coagonism restores leptin responsiveness in obese mice chronically maintained on an obesogenic diet,” Diabetes. 63(4):1422-1427.
De Marinis et al. (Jun. 2014) “Differential action of GLP-1 and GIP on human pancreatic islet function and viability,” Diabetes. 63(Suppl 1):A52. Abstract No. 196-OR.
De Marinis et al. (Sep. 2014) “Differential action of GLP-1 and GIP on human pancreatic islet function and viability,” Diabetologia. 57(Suppl 1):S171. Abstract No. 401.
Eriksson et al. (Feb. 10, 2014) “Detection of metastatic insulinoma by positron emission tomography with [(68)ga] exendin-4-a case report,” J. Clin. Endocrinol. Metab. 99(5):1519-1524.
Eriksson et al. (May 2014) “Effects of the glucagon-like peptide-1 analog exendin-4 on reendothelialization and intimal hyperplasia formation in an animal model of vascular injury,” Arteriosclerosis, Thrombosis, and Vascular Biology. 34(Suppl 1): Abstract No. 515.
Gong et al. (Apr. 18, 2014) “Geniposide and its iridoid analogs exhibit antinociception by acting at the spinal GLP-1 receptors,” Neuropharmacology. 84:31-45.
Gupta et al. (Sep. 25, 2014) “Mitigation of autophagy ameliorates hepatocellular damage following ischemia reperfusion injury in murine steatotic liver,” Am. J. Physiol. Gastrointest. Liver Physiol. 307(11):G1088-G1099.
Jerlhag et al. (Jun. 2014) “A glucagon like peptide-1 analogue reduces alcohol intake and prevents relapse drinking,” Alcoholism: Clinical and Experimental Research. 38(Suppl 1):85A. Abstract No. 0339.
Jin et al. (Jun. 24, 2014) “Dipeptidyl peptidase IV inhibitor MK-0626 attenuates pancreatic islet injury in tacrolimus-induced diabetic rats,” PloS one. 9(6):e100798. pp 1-10.
Johnson et al. (Sep. 5, 2014) “A Potent α/β-Peptide Analogue of GLP-1 with Prolonged Action in Vivo,” Journal of the American Chemical Society. 136(37)12848-12851.
Kwon et al. (Sep. 2014) “Pharmacological evaluation of once-weekly potentials by combination of long-acting insulin with long-acting exendin4 in an animal model,” Diabetologia. 57(Suppl 1):S398-S399. Abstract No. 972.
Li et al. (Apr. 2014) “Vascular protective effect of exendin-4 in experimental models of oxidative stress,” Cytotherapy. 16(4 Suppl):S37-S38. Abstract No. 115.
Li et al. (Nov. 5, 2014) “Exendin-4 promotes endothelial barrier enhancement via PKA-and Epac1-dependent Rac1 activation,” American Journal of Physiology. 308(2):C164-C175.
Lim et al. (Nov. 18, 2014) “Evaluation of PEGylated Exendin-4 Released from Poly (Lactic-co-Glycolic Acid) Microspheres for Antidiabetic Therapy,” Journal of Pharmaceutical Sciences. 104(1):72-80.
Lovshin et al. (Oct. 2014) “Blood pressure-lowering effects of incretin-based diabetes therapies,” Canadian Journal of Diabetes. 38(5):364-71.
Lynch et al. (Jun. 24, 2014) “A novel DPP IV-resistant C-terminally extended glucagon analogue exhibits weight-lowering and diabetes-protective effects in high-fat-fed mice mediated through glucagon and GLP-1 receptor activation,” Diabetologia. 57(9):1927-1936.
Maas et al. (Oct. 2014) “Impact of the mTOR inhibitor Everolimus on peptide receptor radionuclide therapy in a transgenic neuroendocrine tumor mouse model,” European Journal of Nuclear Medicine and Molecular Imaging. 41(Suppl 2):S529. Abstract No. P593.
Masjkur et al. (Nov. 4, 2014) “Hes3 is Expressed in the Adult Pancreatic Islet and Regulates Gene Expression, Cell Growth, and Insulin Release,” The Journal of Biological Chemistry. 289(51):35503-35516.
Mondragon et al. (Aug. 13, 2014) “Divergent effects of liraglutide, exendin-4, and sitagliptin on beta-cell mass and indicators of pancreatitis in a mouse model of hyperglycaemia,” PloS one. 9(8):e104873. pp. 1-9.
Nagai et al. (Sep. 2014) “Effects of sitagliptin on body fat and intrahepatic lipid content in Japanese overweight patients with type 2 diabetes,” Diabetologia. 57(Suppl 1):S356. Abstract No. 876.
Patel et al. (Sep. 29, 2014) “Cannabinoid receptor 1 antagonist treatment induces glucagon release and shows an additive therapeutic effect with GLP-1 agonist in diet-induced obese mice,” Canadian Journal of Physiology and Pharmacology. 92(12):975-983.
Pathak et al. (Nov. 6, 2014) “Antagonism of gastric inhibitory polypeptide (GIP) by palmitoylation of GIP analogues with N- and C-terminal modifications improves obesity and metabolic control in high fat fed mice”; Molecular and Cellular Endocrinology. 401:120-129.
Pi et al. (2014) “ [Clinical research progresses on glucagon-like peptide-1 analogs in treatment of diabetes mellitus],” [Jianyan Yixue Yu Linchuang]. 11(6):830-832.—with English machine translation.
Qian et al. (Jun. 19, 2014) “Analysis of the interferences in quantitation of a site-specifically PEGylated exendin-4 analog by the Bradford method,” Analytical Biochemistry. 465C:50-52.
Roed et al. (Nov. 22, 2013) “Real-time trafficking and signaling of the glucagon-like peptide-1 receptor,” Mol. Cell Endocrinol. 382(2):938-949.
Russell et al. (Jun. 2014) “The novel GLP-1-GLP-2 dual agonist ZP-GG-72 increases intestinal growth and improves insulin sensitivity in DIO mice,” Diabetes. 63(Suppl 1):A98. Abstract No. 374-OR.
Schattauer GMBH (Jun. 12, 2014) Meeting Abstracts of the Swiss Society of Radiology and the Swiss Society of Nuclear Medicine 2014. Nuklearmedizin. 53(2):A111-A126.
Tashiro et al. (Jan. 10, 2014) “A glucagon-like peptide-1 analog liraglutide suppresses macrophage foam cell formation and atherosclerosis,” Peptides. 54:19-26.
Tweedie et al. (May 2014) “Exendin-4, a candidate treatment for the clinical management of traumatic brain injury,” Brain Injury. 28(5-6):549-550. Abstract No. 0101.
Vioix et al. (Nov. 2014) “Cost-minimisation analysis of dapagliflozin compared to lixisenatide as an add-on to insulin in be treatment of type 2 diabetes mellitus from a UK health care perspective,” Value in Health. 17(7):A348. Abstract No. PDB95.
Wang et al. (Jun. 2014) “Microfluidic multiplexer perifusion device for studying islet immunotoxicity,” Diabetes. 63 (Suppl 1):A555. Abstract No. 2181-P.
Wu et al. (May 24, 2014) “(64)Cu labeled sarcophagine exendin-4 for microPET imaging of glucagon like peptide-1 receptor expression,” Theranostics. 4(8):770-777.
Xu et al. (Feb. 11, 2014) “Exendin-4 alleviates high glucose-induced rat mesangial cell dysfunction through the AMPK pathway,” Cell. Physiol. Biochem. 33(2):423-432.
Xu et al. (Sep. 2014) “Insulinoma imaging with glucagon-like peptide-1 receptor targeting probe (18)F-FBEM-Cys (39)-exendin-4,” Journal of Cancer Research and Clinical Oncology. 140(9):1479-1488.
Yang et al. (2014) “Design, synthesis and biological evaluation of novel peptide MC62 analogues as potential antihyperglycemic agents,” European Journal of Medicinal Chemistry. 73:105-111.
Yang et al. (Jun. 2014) “Exendin-4, an analogue of glucagon-like peptide-1, attenuates hyperalgesia through serotonergic pathways in rats with neonatal colonic sensitivity,” J. Physiol. Pharmacol. 65(3):349-357.
Yosida et al. (May 13, 2014) “Involvement of cAMP/EPAC/TRPM2 activation in glucose- and incretin-induced insulin secretion,” Diabetes. 63(10):3394-3403.
Zhang et al. (Aug. 2014) “GLP-1 ameliorates the proliferation activity of INS-1 cells inhibited by intermittent high glucose concentrations through the regulation of cyclins,” Molecular Medicine Reports. 10(2):683-688.
International Search Report with Written Opinion corresponding to International Patent Application No. PCT/EP2016/063305, dated Oct. 4, 2016.
Stoessl et al. (2008) “Potential therapeutic targets for Parkinson's disease,” Expert Opinion on Therapeutic Targets. 12(4):425-436.
European Search Report corresponding to European Patent Application No. 13305222, dated Jul. 15, 2013.
Aramadhaka et al. (Apr. 18, 2013) “Connectivity maps for biosimilar drug discovery in venoms: The case of Gila Monster Venom and the anti-diabetes drug Byetta®,” Toxicon. 69:160-167.
Bhavsar et al. (Mar. 2013) “Evolution of exenatide as a diabetes therapeutic,” Curr. Diabetes Rev. 9(2):161-193.
Gao et al. (Jun. 4, 2012) “A site-specific PEGylated analog of exendin-4 with improved pharmacokinetics and pharmacodynamics in vivo,” J. Pharm. Pharmacol. 64(11):1646-1653.
Gupta (May 2013) “Glucagon-like peptide-1 analogues: An overview,” Indian J. Endocrinol. Metab. 17(3):413-421.
Hou et al. (Jan. 23, 2013) “Long-term treatment with EXf, a peptide analog of Exendin-4, improves β-cell function and survival in diabetic KKAy mice,” Peptides. 40:123-132.
Kim et al. (Nov. 9, 2012) “Site-specific PEGylated Exendin-4 modified with a high molecular weight trimeric PEG reduces steric hindrance and increases type 2 antidiabetic therapeutic effects,” Bioconjug. Chem. 23(11):2214-2220.
Lee et al. (Oct. 17, 2013) “Decanoic acid-modified glycol chitosan hydrogels containing tightly adsorbed palmityl-acylated exendin-4 as a long-acting sustained-release anti-diabetic system,” Acta Biomater. 10(2):812-820.
Parkes et al. (Dec. 12, 2012) “Discovery and development of exenatide: the first antidiabetic agent to leverage the multiple benefits of the incretin hormone, GLP-1,” Expert Opin. Drug Discov. 8(2):219-244.
Qian et al. (Jul. 1, 2013) “Characterization of a site-specific PEGylated analog of exendin-4 and determination of the PEGylation site,” Int. J. Pharm. 454(1):553-558.
Simonsen et al. (Jan. 11, 2013) “The C-terminal extension of exendin-4 provides additional metabolic stability when added to GLP-1, while there is minimal effect of truncating exendin-4 in anaesthetized pigs,” Regul. Pept. 181:17-21.
Sun et al. (Nov. 6, 2013) “Bifunctional PEGylated exenatide-amylinomimetic hybrids to treat metabolic disorders: an example of long-acting dual hormonal therapeutics,” J. Med. Chem. 56(22):9328-9341.
Yim et al. (Aug. 8, 2013) “Synthesis and preclinical characterization of [64Cu]NODAGA-MAL-exendin-4 with a Nε-maleoyl-L-lysyl-glycine linkage,” Nucl. Med. Biol. 40(8):1006-1012.
Yue et al. (Jan. 28, 2013) “Development of a new thiol site-specific prosthetic group and its conjugation with [Cys(40)]-exendin-4 for in vivo targeting of insulinomas,” Bioconjug. Chem. 24(7):1191-1200.
Baggio et al. (2007) “Biology of incretins: GLP-1 and GIP,” Gastroenterology. 132:2131-2157.
Bhat et al. (Jun. 1, 2013) “A novel GIP-oxyntomodulin hybrid peptide acting through GIP, glucagon and GLP-1 receptors exhibits weight reducing and anti-diabetic properties,” Biochem. Pharmacal. 85:1655-1662.
Bhat et al. (Mar. 17, 2013) “A DPP-IV-resistant triple-acting agonist of GIP, GLP-1 and glucagon receptors with potent glucose-lowering and insulinotropic actions in high-fat-fed mice,” Diabetologia. 56:1417-1424.
Bunck et al. (Sep. 2011) “Effects of Exenatide on Measures of B-Cell Function After 3 Years in Metformin-Treated Patients with Type 2 Diabetes,” Diabetes Care. 34:2041-2047.
Buse et al. (2009) “Liraglutide once a day versus exenatide twice a day for type 2 diabetes: a 26-week randomised, parallel group, multinational, open-label trial (LEAD-6),” The Lacenet. 374:39-47.
Chhabra et al. (1998) “An Appraisal of New Variants of Dde Amine Protecting Group for Solid Phase Peptide Synthesis,” Tetrahedron Letters. 39:1603-1606.
Creutzfeld et al. (1978) “Gastric inhibitory polypeptide (GIP) and insulin in obesity: increased response to stimulation and defective feedback control of serum levels,” Diabetologia. 14:15-24.
Day et al. (2009) “A New Glucagon and GLP-1 co-agonist Eliminates Obesity in Rodents,” Nature Chemical Biology. 5 (10):749-757.
Druce et al. (2009) “Investigation of structure-activity relationships of Oxyntomodulin (Oxm) using Oxm analogs,” Endocrinology. 150(4):1712-1722.
Drucker et al. (2010) “Liraglutide,” New Reviews—Drug Discovery. 9(4):267-268.
Eng et al. (1992) “Isolation and Characterization of Exendin-4, an Exendin-3 Analogue, from Heloderma Suspectum Venom,” The Journal of Biological Chemistry. 267(11):7402-7405.
Eng et al. (1996) “Prolonged Effect of Exendin-4 on Hyperglycemia of db/db Mice,” Diabetes. 45:152A. Abstract 554.
Gault et al. (2007) “Chemical gastric inhibitory polypeptide receptor antagonism protects against obesity, insulin resistance, glucose intolerance and associated disturbances in mice fed high-fat and cafeteria diets,” Diabetologia. 50:1752-1762.
Gentilella et al. (2009) “Exenatide: A Review from Pharmacology to Clinical Practice,” Diabetes, Obesity, and Metabolism. 11:544-556.
Hadji-Georgopoulos et al. (1983) “Increased gastric inhibitory polypeptide levels in patients with symptomatic postprandial hypoglycemia,” J. Endocrinol. Metabol. 56(4):648-652.
Hargrove et al. (2007) “Biological Activity of AC3174, A Peptide Analog of Exendin-4,” Regulatory Peptides. 141:113-119.
Heppner et al. (2010) “Glucagon regulation of energy metabolism,” Physiol. Behav. 100:545-548.
Hjorth et al. (1994) “Glucagon and Glucagon-like Peptide 1: Selective Receptor Recognition via Distinct Peptide Epitopes,” The Journal of Biological Chemistry. 269(48):30121-30124.
Holst (2007) “The physiology of glucagon-like peptide 1,” Physiol. Rev. 87(4):1409-1439.
King et al. (1990) “A Cleavage Method which Minimizes Side Reactions Following Fmoc Solid Phase Peptide Synthesis,” International Journal of Peptide Protein Research. 36:255-266.
Kosinski et al. (Mar. 16, 2012) “The glucagon receptor is involved in mediating the body weight-lowering effects of oxyntomodulin,” Obesity (Silver Spring). 20:1566-1571.
Krstenansky et al. (1986) “Importance of the 10-13 Region of Glucagon for Its Receptor Interaction and Activation of Adenylate Cyclase,” Biochemistry. 25(13):3833-3839.
McLaughlin et al. (2010) “Reversible Hyperinsulinemic Hypoglycemia after Gastric Bypass: A Consequence of Altered Nutrient Delivery,” J. Clin. Endocrinol. Metabol. 95(4):1851-1855.
Meier (Sep. 4, 2012) “GLP-1 receptor agonists for individualized treatment of type 2 diabetes mellitus,” Nat. Rev. Endocrinol. 8:728-742.
Miyawaki et al. (2002) “Inhibition of gastric inhibitory polypeptide signaling prevents obesity,” Nat. Med. 8(7):738-742.
Murage et al. (2008) “Search for alpha-helical propensity in the receptor-bound conformation of glucagon-like peptide-1,” Bioorg. Med. Chem. 16:10106-10112.
Norris et al. (2009) “Exenatide Efficacy and Safety: A Systematic Review,” Diabetic Medicine. 26:837-846.
Pedersen et al. (2006) “N- and C-terminal hydrophobic patches are involved in fibrillation of glucagon,” Biochemistry. 45:14503-14512.
Pocai (2009) “Glucagon-like peptide 1/glucagon receptor dual agonism reverses obesity in mice,” Diabetes. 58 :10):2258-2266.
Extended European Search Report corresponding to European Patent Application No. 14305501.0, dated Sep. 23, 2014.
International Search Report with Written Opinion correpsonding to International Patent Application No. PCT/EP2015/057416, dated Jun. 22, 2015.
Related Publications (1)
Number Date Country
20150315260 A1 Nov 2015 US