Expression of SARS-CoV-2 spike protein receptor binding domain in attenuated salmonella as a vaccine

Description

FIELD OF THE INVENTION

The present invention relates to the field of live bacterial vectors as vaccines, and more particularly to a live attenuated bacteria expressing a portion of the SARS-CoV-2 spike protein receptor binding domain, adapted for oral administration to a human without substantial morbidity and to induce an effective preventative vaccine response.

BACKGROUND OF THE INVENTION

Coronavirus disease 2019 (COVID-19) is an infectious disease caused by severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2). It was first identified in Wuhan, China, and has since spread globally, resulting in an ongoing pandemic. As of 10 May 2020, more than 4.08 million cases have been reported across 187 countries and territories, resulting in more than 281,000 deaths. More than 1.39 million people have been infected. en.wikipedia.org/wiki/Coronavirus_disease_2019.

Common symptoms include fever, cough, fatigue, shortness of breath, and loss of smell and taste. While the majority of cases result in mild symptoms, some progress to acute respiratory distress syndrome (ARDS), multi-organ failure, septic shock, and blood clots. The time from exposure to onset of symptoms is typically around five days but may range from two to fourteen days.

The virus is believed to be spread between people during close contact, most often via small droplets produced by coughing, sneezing, and talking. It is most contagious during the first three days after the onset of symptoms, although spread may be possible before symptoms appear, or from people who do not show symptoms. The standard method of diagnosis is by real-time reverse transcription polymerase chain reaction (rRT-PCR) from a nasopharyngeal swab. Chest CT imaging may also be helpful for diagnosis in individuals where there is a high suspicion of infection based on symptoms and risk factors; however, guidelines do not recommend using it for routine screening. Chest X-ray shows a characteristic ground glass appearance.

As is common with infections, there is a delay between the moment a person is first infected and the time he or she develops symptoms. This is called the incubation period. The incubation period for COVID 19 is typically five to six days but may range from two to 14 days, although 97.5% of people who develop symptoms will do so within 11.5 days of infection.

A minority of cases do not develop noticeable symptoms at any point in time. These asymptomatic carriers tend not to get tested, and their role in transmission is not yet fully known. However, preliminary evidence suggests they may contribute to the spread of the disease.

SARS-CoV-2 is closely related to the original SARS-CoV. [6] It is thought to have a zoonotic origin. Genetic analysis has revealed that the coronavirus genetically clusters with the genus Betacoronavirus, in subgenus Sarbecovirus (lineage B) together with two bat-derived strains. It is 96% identical at the whole genome level to other bat coronavirus samples (BatCov RaTG13). In February 2020, Chinese researchers found that there is only one amino acid difference in the binding domain of the S protein between the coronaviruses from pangolins and those from humans; however, whole-genome comparison to date found that at most 92% of genetic material was shared between pangolin coronavirus and SARS-CoV-2, which is insufficient to prove pangolins to be the intermediate host. [7]

The lungs are the organs most affected by COVID 19 because the virus accesses host cells via the enzyme angiotensin-converting enzyme 2 (ACE2), which is most abundant in type II alveolar cells of the lungs. The virus uses a special surface glycoprotein called a “spike” (peplomer) to connect to ACE2 and enter the host cell. [8] The density of ACE2 in each tissue correlates with the severity of the disease in that tissue and some have suggested that decreasing ACE2 activity might be protective, [9][10] though another view is that increasing ACE2 using angiotensin II receptor blocker medications could be protective and these hypotheses need to be tested. [11] As the alveolar disease progresses, respiratory failure might develop and death may follow. [10]

The virus also affects gastrointestinal organs as ACE2 is abundantly expressed in the glandular cells of gastric, duodenal and rectal epithelium[12] as well as endothelial cells and enterocytes of the small intestine. [13]

The virus can cause acute myocardial injury and chronic damage to the cardiovascular system. [14] Rates of cardiovascular symptoms are high, owing to the systemic inflammatory response and immune system disorders during disease progression, but acute myocardial injuries may also be related to ACE2 receptors in the heart. [14] ACE2 receptors are highly expressed in the heart and are involved in heart function. [14][15]

Although SARS-COV-2 has a tropism for ACE2-expressing epithelial cells of the respiratory tract, patients with severe COVID 19 have symptoms of systemic hyperinflammation. Clinical laboratory findings of elevated IL-2, IL-7, IL-6, granulocyte-macrophage colony-stimulating factor (GM-CSF), interferon-γ inducible protein 10 (IP-10), monocyte chemoattractant protein 1 (MCP-1), macrophage inflammatory protein 1-α (MIP-1α), and tumour necrosis factor-α (TNF-α) indicative of cytokine release syndrome (CRS) suggest an underlying immunopathology. Additionally, people with COVID 19 and acute respiratory distress syndrome (ARDS) have classical serum biomarkers of CRS, including elevated C-reactive protein (CRP), lactate dehydrogenase (LDH), D-dimer, and ferritin. [16]

Systemic inflammation results in vasodilation, allowing inflammatory lymphocytic and monocytic infiltration of the lung and the heart. In particular, pathogenic GM-CSF-secreting T-cells were shown to correlate with the recruitment of inflammatory IL-6-secreting monocytes and severe lung pathology in COVID 19 patients. [17]

It is unknown if past infection provides effective and long-term immunity in people who recover from the disease. [18][19] Some of the infected have been reported to develop protective antibodies, so acquired immunity is presumed likely, based on the behaviour of other coronaviruses. [20] However, cases in which recovery from COVID 19 was followed by positive tests for coronavirus at a later date have been reported. [21][22][23][24] These cases are believed to be lingering infection rather than reinfection,[24] or false positives due to remaining RNA fragments. [15] Some other coronaviruses circulating in people are capable of reinfection after roughly a year. [26][27]

Three vaccination strategies are generally being investigated. First, researchers aim to build a whole virus vaccine. The use of such a virus, be it inactive or dead, aims to elicit a prompt immune response of the human body to a new infection with COVID 19. A second strategy, subunit vaccines, aims to create a vaccine that sensitizes the immune system to certain subunits of the virus. In the case of SARS-CoV-2, such research focuses on the S-spike protein that helps the virus intrude the ACE2 enzyme receptor. A third strategy is that of the nucleic acid vaccines (DNA or RNA vaccines). Experimental vaccines from any of these strategies would have to be tested for safety and efficacy. [28] Antibody-dependent enhancement has been suggested as a potential challenge for vaccine development for SARS-COV-2, but this is controversial. [29]

Cytokine release syndrome (CRS) can be a complication in the later stages of severe COVID 19. There is preliminary evidence that hydroxychloroquine may have anti-cytokine storm properties. [30]

Tocilizumab has been included in treatment guidelines by China's National Health Commission after a small study was completed. [31][32] It is undergoing a phase 2 non-randomised trial at the national level in Italy after showing positive results in people with severe disease. [33][34] Combined with a serum ferritin blood test to identify cytokine storms, it is meant to counter such developments, which are thought to be the cause of death in some affected people. [35][36][37] The interleukin-6 receptor antagonist was approved by the FDA to undergo a phase III clinical trial assessing the medication's impact on COVID 19 based on retrospective case studies for the treatment of steroid-refractory cytokine release syndrome induced by a different cause, CAR T cell therapy, in 2017. [38] Lenzilumab, an anti-GM-CSF monoclonal antibody, is protective in murine models for CAR T cell-induced CRS and neurotoxicity and is a viable therapeutic option due to the observed increase of pathogenic GM-CSF secreting T-cells in hospitalised patients with COVID 19. [39]

The Feinstein Institute of Northwell Health announced in March a study on “a human antibody that may prevent the activity” of IL-6. [40]

Transferring purified and concentrated antibodies produced by the immune systems of those who have recovered from COVID 19 to people who need them is being investigated as a non-vaccine method of passive immunisation. [41] This strategy was tried for SARS with inconclusive results. [41] Viral neutralisation is the anticipated mechanism of action by which passive antibody therapy can mediate defence against SARS-CoV-2. Other mechanisms, however, such as antibody-dependent cellular cytotoxicity and/or phagocytosis, may be possible. [41] Other forms of passive antibody therapy, for example, using manufactured monoclonal antibodies, are in development. [41] Production of convalescent serum, which consists of the liquid portion of the blood from recovered patients and contains antibodies specific to this virus, could be increased for quicker deployment. [42]

The world experienced the outbreaks of coronavirus infection that threaten global pandemic in 2002-2003 by Severe Acute Respiratory Syndrome (SARS) and in 2011 by Middle East Respiratory Syndrome (MERS). In both cases, the causative agents (SARS-CoV and MERS-CoV, respectively) were newly identified coronavirus in the genus Betacoronavirus with zoonotic origin. At the end of 2019, outbreak of another coronavirus that causes respiratory-related illness was reported in Wuhan, Hubei, China, a disease now officially called “the Corona Virus Disease 2019; COVID-19”. The coronavirus that is the causative agent of this respiratory disease was identified and its genome is fully sequenced. [42] The genomic sequence of SARS-CoV-2 showed similar, but distinct genome composition of SARS-CoV and MERS-CoV. Since its first reported case in late 2019, the infection has spread to other regions in China and other countries, and the transmission rate, the mortality rate and the clinical manifestation slowly emerged. However, it will take months and maybe years until we will fully grasp the whole picture of the characteristics of the pathogens and its likely origin, symptoms and the host immune responses to combat the infection. [83]

Identification of SARS-CoV-2 tropism is also warranted. In agreement with genome similarity with SARS, analysis of nucleic acid sequence within the spike protein receptor-binding domain (RBD) has been predicted that SAR-CoV-2 might also use angiotensin-converting enzyme 2 (ACE2) as a cell receptor. [43] The study performed in vitro experiments which could confirm that SAR-CoV-2 used ACE2 for cellular entry. [44] Because wild range of animal species (except rat and mouse) express ACE2, it could support the observed cross-species and human-to-human transmission events.

Currently, only limited information is available on the host innate immune status of SARS-CoV-2 infected patients. In one report where 99 cases in Wuhan were investigated, increased total neutrophils (38%), reduced total lymphocytes (35%), increased serum IL-6 (52%) and increased c-reactive protein (84%) were observed. [45] In a separate report also from Wuhan, it revealed that in 41 patients, increased total neutrophils, decreased total lymphocytes in patients of ICU vs. non-ICU care were found to be statistically different. Increased neutrophils and decreased lymphocytes also correlate with disease severity and death. Furthermore, patients needing ICU care had higher plasma levels of many innate cytokines, IP-10, MCP-1, MIP-1A, and TNFα. [46] These clinical features suggested the likelihood of involvement of highly pro-inflammatory condition in the disease progression and severity. This early high rise in the serum levels of pro-inflammatory cytokines were also observed in SARS-CoV and MERS-CoV infection, suggesting a potential similar cytokine storm-mediated disease severity. [47][48]Effective innate immune response against viral infection relies heavily on the interferon (IFN) type I responses and its downstream cascade that culminates in controlling viral replication and induction of effective adaptive immune response. While SARS-CoV and SARS-CoV-2 seem to share the entry receptor of ACE2, MERS-CoV uses dipeptidyl peptidase (DPP)-4 as a specific receptor. [45] The putative receptor of SARS-CoV-2, ACE2, is mainly expressed in a small subset of cells in the lung called type 2 alveolar cells. It has been reported that SARS-CoV directly infects macrophages and T cells, a key feature in SARS-CoV-mediated pathogenesis. [49] Whether SARS-CoV-2 infects any immune cells are still unknown. Only minimal percentages of monocytes/macrophages in the lung expressed ACE2. [50] If ACE2 is minimally expressed in the potential target immune cells, it is possible that other receptors may exist, or other cellular entry mode is utilized such as antibody-dependent enhancement.

To mount an antiviral response, innate immune cells need to recognize the invasion of the virus, often by pathogen-associated molecular patterns (PAMPs). For RNA virus such as coronavirus, it is known that PAMPs in the form of viral genomic RNA or the intermediates during viral replication including dsRNA, are recognized by either the endosomal RNA receptors, TLR3 and TLR7 and the cytosolic RNA sensor, RIG-I/MDA5. This recognition event leads to activation of the downstream signaling cascade, i.e. NF-κB and IRF3, accompanied by their nuclear translocation. In the nuclei, these transcription factors induce expression of type I IFN and other pro-inflammatory cytokines and this initial responses comprise the first line defense against viral infection at the entry site. [51] Type I IFN via IFNAR, in turn, activates the JAK-STAT pathway, where JAK and TYK2 kinases phosphorylate STAT1 and STAT2. STAT1/2 form a complex with IRF9, and together they move into the nucleus to initiate the transcription of IFN-stimulated genes (ISGs) under the control of IFN-stimulated response element (ISRE) containing promoters. A successful mounting of this type I IFN response should be able to suppress viral replication and dissemination at an early stage.

For SARS-CoV and MERS-CoV, the response to viral infection by type I IFN is suppressed. Both coronaviruses employ multiple strategies to interfere with the signaling leading to type I IFN production and/or the signaling downstream of IFNAR. This dampening strategy is closely associated with the disease severity. At the step of type I IFN induction, SARS-CoV interferes with the signaling downstream of RNA sensors directly or indirectly such as ubiquitination and degradation of RNA sensor adaptor molecules MAVS and TRAF3/6 and inhibiting IRF3 nuclear translocation. [52] MERS-CoV also utilizes some of these strategies with additional mechanism such as repressive histone modification. Once type I IFN is secreted, these two viruses are equipped with mechanism that inhibit IFN signaling such as decreasing STAT1 phosphorylation. The viral proteins involved in the modulation of this host type I IFN response are both structural proteins (such as M, N) and non-structural proteins (ORF proteins).

Based on the genomic sequence comparison, SARS-CoV shares overall genomic similarity with SARS-CoV or MERS-CoV, approximately 79% and 50%, respectively. The genome of SARS-CoV-2 also contains additional gene regions (10b, 13, 14). In addition, the amino acid sequences of some putative proteins of SARS-CoV-2 show only 68% similarity with that of SARS-CoV. Therefore, careful sequence comparison of each gene region may yield better prediction as how SARS-CoV-2 interferes with host innate immune response. It is partially speculative that SARS-CoV-2 utilizes similar strategies to modulate the host innate immune response, especially in dampening the type I IFN response but additional novel mechanisms may be uncovered.

Aerosolized uptake of SARS-CoV-2 leads to infection of ACE2 expressing target cells such as alveolar type 2 cells or other unknown target cells. Virus may dampen anti-viral IFN responses resulting in uncontrolled viral replication. The influx of neutrophils and monocytes/macrophages results in hyperproduction of pro-inflammatory cytokines. The immunopathology of lung may be the result of the “cytokine storms”. Specific Th1/Th17 may be activated and contributes to exacerbate inflammatory responses. B cells/plasma cells produce SARS-CoV-2 specific antibodies that may help neutralize viruses. The question marks indicated events that are still speculative or unknown.

In the severe or lethal cases of SARS-CoV or MERS-CoV infection, increased neutrophil and monocyte-macrophages influx are consistently observed. [53][54] In a mouse model of SARS-CoV infection, dysregulated type I IFN and inflammatory monocyte-macrophages are the main cause of lethal pneumonia. Therefore, excessive type I IFN with the infiltrated myeloid cells are the main cause of lung dysfunction and negatively impact the outcome of the infection. It is speculated that upon SARS-CoV or MERS-CoV infection, delayed type I IFN compromises the early viral control, leading to influx of hyperinflammatory neutrophils and monocytes-macrophages. The increases in these innate immune cells yields deteriorating consequences to infected host that manifested in lung immunopathology, including pneumonia or acute respiratory distress syndrome. In SARS-CoV-2 infection, similar scenario is expected with varying degree of immune interference. Interestingly, transmission of virus is reported to occur even in asymptomatic infected individuals. This may be indicative of delayed early response of the innate immune response.

Based on the accumulated data for previous coronavirus infection, innate immune response plays crucial role in protective or destructive responses and may open a window for immune intervention. Active viral replication later results in hyperproduction type I IFN and influx of neutrophils and macrophages which are the major sources of pro-inflammatory cytokines. With similar changes in total neutrophils and lymphocytes during COVID19, SARS-CoV-2 probably induces delayed type I IFN and loss of viral control in an early phase of infection. Individuals susceptible to CoVID19 are those with underlying diseases, including diabetes, hypertension, and cardiovascular disease. In addition, no severe cases were reported in young children, when innate immune response is highly effective. These facts strongly indicate that innate immune response is a critical factor for disease outcome.

Based on the assumption that innate immunity plays a key role, several interventions can be proposed. Type I IFN, antagonists of some key pro-inflammatory cytokines and anti-viral agents are some of these examples. When using type I IFN for treatment, in a mouse model of either SARS-CoV or MERSCoV infection, the timing of administration is key to yield protective response. [55]

In general, the Th1 type immune response plays a dominant role in an adaptive immunity to viral infections. Cytokine microenvironment generated by antigen presenting cells dictate the direction of T cell responses. Helper T cells orchestrate the overall adaptive response, while cytotoxic T cells are essential in killing of viral infected cells. Humoral immune response, especially production of neutralizing antibody, plays a protective role by limiting infection at later phase and prevents reinfection in the future. In SARS-CoV, both T and B cell epitopes were extensively mapped for the structural proteins, S, N, M and E protein. [56]

SARS-CoV infection induces seroconversion as early as day 4 after onset of disease and was found in most patients by 14 days. Long lasting specific IgG and neutralizing antibody are reported as long as 2 years after infection. [57] For MERS-CoV infection, seroconversion is seen at the second or third week of disease onset. For both types of coronavirus infections, delayed and weak antibody response are associated with severe outcome. [56] A limited serology details of SARS-CoV-2 was reported. In a preliminary study, one patient showed peak specific IgM at day 9 after disease onset and the switching to IgG by week 2.25 Interestingly, sera from 5 patients of confirmed COVID-19 show some cross-reactivity with SARS-CoV, but not other coronavirus. Furthermore, all sera from patients were able to neutralize SARS-CoV-2 in an in vitro plaque assay, suggesting a possible successful mounting of the humoral responses.

T cell response in SARS-CoV was extensively investigated. In one study using 128 convalescent samples, it was reported that CD8+ T cell responses were more frequent with greater magnitude than CD4+ T cell responses. Furthermore, the virus-specific T cells from the severe group tended to be a central memory phenotype with a significantly higher frequency of polyfunctional CD4+ T cells (IFNγ, TNFα, and IL-2) and CD8+ T cells (IFNγ, TNFα and degranulated state), as compared with the mild-moderate group. Strong T cell responses correlated significantly with higher neutralizing antibody while more serum Th2 cytokines (IL-4, IL-5, IL-10) were detected in the fatal group. [58] For the epitope mapping, most responses (70%) were found against the structural proteins (spike, envelope, membrane, and nucleocapsid). In MERS-CoV infection, early rise of CD8+ T cells correlates with disease severity and at the convalescent phase, dominant Th1 type helper T cells are observed. [59] In an animal model, airway memory CD4+ T cells specific for conserved epitope are protective against lethal challenge and can cross react with SARS-CoV and MERSCoV. [60] As neutrophils play a destructive role in all infections, the protective or destructive role of Th17 in human coronavirus infection remains unanswered.

Current evidences strongly indicated that Th1 type response is a key for successful control of SARS-CoV and MERSCoV and probably true for SARS-CoV-2 as well. CD8+ T cell response, even though crucial, needs to be well controlled in order not to cause lung pathology. Because most epitopes identified for both viruses concentrate on the viral structural proteins, it will be informative to map those epitopes identified with SARS-CoV/MERS-CoV with those of SARS-CoV-2. If overlapping epitopes among the three viruses can be identified, it will be beneficial for application in passive immunization using convalescent serum from recovered SARS or MERS patients. For T cell epitopes, it will help in designing cross reactive vaccine that protect against all three human coronaviruses in the future.

Current observations indicate that coronaviruses are particularly adapted to evade immune detection and dampen human immune responses. This partly explains why they tend to have a longer incubation period, 2-11 days on average compared to influenza, 1-4 days. The longer incubation period is probably due to their immune evasion properties, efficiently escaping host immune detection at the early stage of infection. As a member of the Betacoronavirus genus, immune evasion mechanism is potentially similar to those of SARS-CoV and MERS-CoV. The mechanisms of how SARS-CoV and MERSCoV modulate host immune responses were extensively reviewed and discussed. [61][62] In brief, most mechanisms rely on the inhibition of innate immune responses, especially type I interferon recognition and signaling. The viral proteins including membrane (M) or nonstructural (NS) proteins (eg. NS4a, NS4b, NS15) are the key molecules in host immune modulation. In agreement with the aforementioned study, analysis of two MERS-CoV-infected individuals with different severity found that the type I interferon response in the poor outcome (death) patient was remarkably lower than the recovered patient. [63] For adaptive immune evasion, antigen presentation via MHC class I and MHC class II was downregulated when the macrophages or dendritic cells were infected with MERS-CoV, which would markedly diminish T cells activation. [61]

Coronaviruses interfere with multiple steps during initial innate immune response, including RNA sensing, signaling pathway of type I IFN production, and STAT1/2 activation downstream of IFN/IFNAR. This delayed or dampening type I IFN responses impinge upon adaptive immune activation. Prolonged viral persistence exacerbates inflammatory responses that may lead to immune exhaustion and immune suppression as a feedback regulatory mechanism. Biased Th2 type response also favors poor outcome of the disease.

Due to the rapid increase of SAR-CoV2 infections and affected countries, efforts toward developing an effective SARCoV2 vaccine have been ignited in many countries. By gaining knowledge from SARS and MERS vaccines development path, several research groups have been able to start SAR-CoV2 vaccine development within only a few weeks after the outbreak. The target antigen selection and vaccine platform are probably based on SARS-CoV and MERS-CoV vaccine studies. Full-length spike (S) or S1 which contains receptor binding domain (RDB) might be considered as a good vaccine antigen because it could induce neutralizing antibodies that prevent host cell attachment and infection. [64][65][66]

A nucleic acid-based vaccine, a DNA vaccine, showed the most advance platform in response to emerging pathogens. Moreover, during Zika virus outbreak, DNA vaccine was the first vaccine candidate that entered clinical trial (NCT02809443) (less than 1-year after the outbreak). According to the current technological advancement, mRNA vaccine, another nucleic acid-based vaccine, has been considered as disruptive vaccine technology. Recent mRNA vaccine designs have improved stability and protein translation efficiency thus it could induce robust immune responses. [67][68] Delivery system such as lipid nanoparticle, LNP was also well-optimized. [69]

By looking at the similarities and differences between the current SARS-CoV-2 and the previous outbreak of SARS and MERS, a striking similarity emerges with some unique features of its own. As the COVID-19 causes serious public health concerns across Asia and on the blink to affect world population, investigation into the characteristics of SARS-CoV-2, its interaction with the host immune responses may help provide a clearer picture of how the pathogen causes diseases in some individuals while most infected people only show mild or no symptoms at all. In addition, the study of the immune correlates of protection and the long-term immune memory from convalescent individuals may help in design prophylactic and therapeutic measures for future outbreak of similar coronaviruses.

SARS-CoV-2 has a genome size of ˜30 kilobases which, like other coronaviruses, encodes for multiple structural and non-structural proteins. The structural proteins include the spike (S) protein, the envelope (E) protein, the membrane (M) protein, and the nucleocapsid (N) protein. With SARS-CoV-2 being discovered very recently, there is currently a lack of immunological information available about the virus (e.g., information about immunogenic epitopes eliciting antibody or T cell responses). Preliminary studies suggest that SARS-CoV-2 is quite similar to SARS-CoV based on the full-length genome phylogenetic analysis [70][71], and the putatively similar cell entry mechanism and human cell receptor usage [70][72][73]. Due to this apparent similarity between the two viruses, previous research that has provided an understanding of protective immune responses against SARS-CoV may potentially be leveraged to aid vaccine development for SARS-CoV-2. [84]

Various reports related to SARS-CoV suggest a protective role of both humoral and cell-mediated immune responses. For the former case, antibody responses generated against the S protein, the most exposed protein of SARS-CoV, have been shown to protect from infection in mouse models [70][71][72]. In addition, multiple studies have shown that antibodies generated against the N protein of SARS-CoV, a highly immunogenic and abundantly expressed protein during infection [73], were particularly prevalent in SARS-CoV-infected patients [74][75]. While being effective, the antibody response was found to be short-lived in convalescent SARS-CoV patients [21]. In contrast, T cell responses have been shown to provide long-term protection [76][77][78], even up to 11 years post-infection [79], and thus have also attracted interest for a prospective vaccine against SARS-CoV [reviewed in [80]]. Among all SARS-CoV proteins, T cell responses against the structural proteins have been found to be the most immunogenic in peripheral blood mononuclear cells of convalescent SARS-CoV patients as compared to the non-structural proteins [81]. Further, of the structural proteins, T cell responses against the S and N proteins have been reported to be the most dominant and long-lasting [82].

The availability of the highly attenuated Salmonella enterica Typhimurium strain YS1646 that had been used in a phase 1 clinical cancer trial at doses up to 3×10⁸IV was attractive for many reasons. Although S. enterica species replicate in a membrane-bound host cell compartment or vacuole [85], foreign protein antigens can be efficiently exported from the vacuole into the cytoplasm using the organism's T3SS. Like all Salmonella enterica species, YS1646 has two distinct T3SS located in Salmonella pathogenicity islands 1 and 2 (SPI-I and SPI-II) [86] that are active at different phases of infection [87]. The SPI-I T3SS translocates proteins upon first contact of the bacterium with epithelium cells through to the stage of early cell invasion while SPI-II expression is induced once the bacterium has been phagocytosed [88]. These T3SS have been used by many groups to deliver heterologous antigens in Salmonella-based vaccine development programs [89, 90, reviewed by 91].

In recent years, live attenuated Salmonella has been increasingly used to express foreign antigens against infectious diseases and cancers. [92][93][94][95][96][97][98][99][101][102][103][104][105][106][107][108][109]

Salmonella enterica is a facultative intracellular pathogen that replicates in a unique membrane-bound host cell compartment, the Salmonella-containing vacuole [85]. Although this location limits exposure of both Salmonella and foreign proteins produced by the bacterium to the immune system, the organism's type III secretion systems (T3SS) can be exploited to translocate heterologous antigens into the host cell cytoplasm. Salmonella enterica encodes two distinct T3SS within the Salmonella pathogenicity islands 1 and 2 (SPI-I and SPI-II) that become active at different phases of infection [87]. The SPI-I T3SS translocates effector proteins upon first contact of the bacterium with epithelium cells through to the stage of early cell invasion. In contrast, SPI-II expression is induced when the bacterium has been phagocytosed. Several effector proteins translocated by these T3SSs have been tested in the promotion of heterologous antigen expression in Salmonella-based vaccine development programs but how effector protein-mediated secretion of heterologous antigens affects immune responses is still poorly understood. [89][111]

There is considerable experience in using the attenuated S. typhi vaccine strain (Ty21a: Vivotif™) in the delivery of heterologous antigens. [89] However, S. typhimurium YS1646 was selected as a candidate vector. This strain is attenuated by mutations in its msbB (LPS) and purl (purine biosynthesis pathway) genes and was originally developed as a non-specific ‘cancer vaccine’ for solid tumors. With a major investment from Vion Inc., YS1646 was carried through pre-clinical and toxicity testing in rodents, dogs and non-human primates before a phase I clinical trial where it ultimately failed [94]. More recently, YS1646 has been used to express a chimeric Schistosoma japonicum antigen that was tested in a murine model of schistosomiasis [112]. Repeated oral administration of one of the engineered strains in this study elicited a strong systemic IgG antibody response, induced antigen-specific T cells and provided up to 75% protection against S. japonicum challenge.

The present technology, according to various embodiments, consists of known and/or antigens, chimeric proteins, or combinations of proteins, that are expressed, secreted, surface displayed and/or released by bacteria and result in immunologic activity, and may optionally include the combination with secreted protease inhibitors. The bacterial delivery vector may be attenuated, non-pathogenic, low pathogenic (including wild type), or a probiotic bacterium. The bacteria are introduced either systemically (e.g., parentral, intravenous (IV), intramuscular (IM), intralymphatic (IL), intradermal (ID), subcutaneously (sub-q), local-regionally (e.g., intralesionally, intratumorally (IT), intrapaeritoneally (IP), topically, intrathecally (intrathecal), by inhaler or nasal spray) or to the mucosal system through oral, nasal, pulmonary intravessically, enema or suppository administration where they are able to undergo limited replication, express, surface display, secrete and/or release the anti-cancer inhibitory proteins or a combination thereof, and thereby provide a therapeutic or preventive benefit.

Promoters, i.e., genetic regulatory elements that control the expression of the genes encoding the therapeutic molecules described above that are useful in the present technology, according to various embodiments, include constitutive and inducible promoters. A preferred constitutive promoter is that from the vector pTrc99a (Promega). Preferred inducible promoters include the tetracycline inducible promoter (TET promoter), colicin promoters, sulA promoters and hypoxic-inducible promoters including but not limited to the PepT promoter (Bermudes et al., WO 01/25397), the arabinose inducible promoter (AraBAD) (Lossner et al., 2007, Cell Microbiol. 9: 1529-1537; WO/2006/048344) the salicylate (aspirin) derivatives inducible promoter (Royo et al., 2007, Nature Methods 4: 937-942; WO/2005/054477), or a quorum-sensing (autoinduction) promoter Anerson et al., 2006 Environmentally controlled invasion of cancer cells by engineered bacteria, J. Mol. Biol. 355: 619-627.

A single promoter may be used to drive the expression of more than one gene, such as an antigen and a protease inhibitor. The genes may be part of a single synthetic operon (polycistronic), or may be separate, monocystronic constructs, with separate individual promoters of the same type used to drive the expression of their respective genes. The promoters may also be of different types, with different genes expressed by different constitutive or inducible promoters. Use of two separate inducible promoters for more than one antigen or other effector type peptide allows, when sufficient tetracycline, arabinose or salicylic acid is administered following administration of the bacterial vector, their expression to occur simultaneously, sequentially, or alternatingly (i.e., repeated). An inducible promoter is not required, and a constitutive promoter may be employed.

The T3SS secretion system is discussed in U.S. 2019/0055569, 2010/0120124, 2012/0021517, 2015/0359909, U.S. Pat. Nos. 9,951,340, 6,306,387, expressly incorporated herein by reference.

Some bacterial pathogens comprise a type three secretion system (T3SS), which serves as a needle-like system for delivering bacterial polypeptides (effectors) into host cells. These effector polypeptides typically contribute to the virulence of the bacterial cell. In contrast, commensal microbes have not been described to comprise a T3SS.

A T3SS is a multi-protein structure found in gram negative bacteria. It moves polypeptides from the cytoplasm of the bacterial cell through the interior of the T3SS “needle” into the cytoplasm of a target cell. T3SS's are found in pathogenic strains and have been observed in pathogenic isolates of, e.g., Shigella, Salmonella, E. coli, Burkholderia, Yersinia, Chlamydia, Pseudomonas, Erwinia, Ralstonia, Rhizobium, Vibrio, and Xanthamonas. Further discussion of T3SS's can be found, e.g. in Izore et al. Structure 2011 19:603-612; Korotkov et al. Nature Reviews Microbiology 2012 10:336-351; Wooldridge, K. (ed) Bacterial Secreted Proteins. Caster Academic Press 2009; Snyder and Champness (eds.) Molecular Genetics of Bacteria. 3rd Ed. ASM Press: 2007; each of which is incorporated by reference herein in its entirety.

The suite of T3SS-related proteins in a given wild-type cell is typically divided into structural proteins (those proteins which form the needle itself), substrate proteins (those proteins which are transported through the needle to the host), and chaperones (those proteins that bind effectors in the cytoplasm to protect, process, and/or shuttle the effectors to the needle). As used herein, a “functional T3SS” refers, minimally, to the set of structural proteins which are required in order to transfer at least one polypeptide to a target cell. In some embodiments, a functional T3SS system can comprise one or more chaperone proteins. In some embodiments, a functional T3SS can comprise one or more, for example, two, three, or four, substrates which are not virulence factor (e.g. certain translocators). In some embodiments, a functional T3SS does not comprise a virulence factor which is delivered to the target cell.

Bacteriocins are a class of compounds produced by bacteria to control their relationship with other bacteria. Bacteriocins are proteinaceous or peptidic toxins produced by bacteria to inhibit the growth of similar or closely related bacterial strain(s). en.wikipedia.org/wiki/Bacteriocin.

Bacteriocins are categorized in several ways, including producing strain, common resistance mechanisms, and mechanism of killing. There are several large categories of bacteriocin which are only phenomenologically related. These include the bacteriocins from gram-positive bacteria, the colicins, the microcins, and the bacteriocins from Archaea. The bacteriocins from E. coli are called colicins.

Gram negative bacteriocins are typically classified by size. Microcins are less than 20 kDa in size, colicin-like bacteriocins are 20 to 90 kDa in size and tailocins or so called high molecular weight bacteriocins which are multi subunit bacteriocins that resemble the tails of bacteriophages. This size classification also coincides with genetic, structural and functional similarities.

Colicins are bacteriocins (CLBs) found in the Gram-negative E. coli. [113] Similar bacteriocins occur in other Gram-negative bacteria. These CLBs are distinct from Gram-positive bacteriocins. They are modular proteins between 20 and 90 kDa in size. They often consist of a receptor binding domain, a translocation domain and a cytotoxic domain. Combinations of these domains between different CLBs occur frequently in nature and can be created in the laboratory. Due to these combinations further subclassification can be based on either import mechanism (group A and B) or on cytotoxic mechanism (nucleases, pore forming, M-type, L-type).

A colicin is a type of bacteriocin produced by and toxic to some strains of Escherichia coli. Colicins are released into the environment to reduce competition from other bacterial strains. Colicins bind to outer membrane receptors, using them to translocate to the cytoplasm or cytoplasmic membrane, where they exert their cytotoxic effect, including depolarisation of the cytoplasmic membrane, DNase activity, RNase activity, or inhibition of murein synthesis.

Channel-forming colicins (colicins A, B, E1, Ia, Ib, and N) are transmembrane proteins that depolarize the cytoplasmic membrane, leading to dissipation of cellular energy. These colicins contain at least three domains: an N-terminal translocation domain responsible for movement across the outer membrane and periplasmic space; a central domain responsible for receptor recognition; and a C-terminal cytotoxic domain responsible for channel formation in the cytoplasmic membrane. One domain regulates the target and binds to the receptor on the sensitive cell. The second is involved with translocation, co-opting the machinery of the target cell. The third is the ‘killing’ domain and may produce a pore in the target cell membrane, or act as a nuclease to chop up the DNA or RNA of the target cell.

Most colicins are able to translocate the outer membrane by a two-receptor system, where one receptor is used for the initial binding and the second for translocation. The initial binding is to cell surface receptors such as the outer membrane proteins OmpF, FepA, BtuB, Cir and FhuA; colicins have been classified according to which receptors they bind to. The presence of specific periplasmic proteins, such as TolA, TolB, TolC, or TonB, are required for translocation across the membrane. Cloacin DF13 is a bacteriocin that inactivates ribosomes by hydrolysing 16S RNA in 30S ribosomes at a specific site.

Because they target specific receptors and use specific translocation machinery, cells can make themselves resistant to the colicin by repressing or deleting the genes for these proteins. Such resistant cells may suffer the lack of a key nutrient (such as iron or a B vitamin), but benefit by not being killed. Pore-forming colicins depolarize the membrane and thus eliminate the energy source for the cell. The colicins are highly effective toxins.

Virtually all colicins are carried on plasmids. The two general classes of colicinogenic plasmids are large, low-copy-number plasmids, and small, high-copy-number plasmids. The larger plasmids carry other genes, as well as the colicin operon. The colicin operons are generally organized with several major genes. These include an immunity gene, a colicin structural gene, and a bacteriocin release protein (BRP), or lysis, gene. The immunity gene is often produced constitutively, while the BRP is generally produced only as a read-through of the stop codon on the colicin structural gene. The colicin itself is repressed by the SOS response and may be regulated in other ways, as well.

Retaining the colicin plasmid is very important for cells that live with their relatives, because if a cell loses the immunity gene, it quickly becomes subject to destruction by circulating colicin. At the same time, colicin is only released from a producing cell by the use of the lysis protein, which results in that cell's death. This suicidal production mechanism would appear to be very costly, except for the fact that it is regulated by the SOS response, which responds to significant DNA damage. In short, colicin production may only occur in terminally ill cells. [114] [115] [116] [117] [118]

As used herein, a “virulence factor” refers to those substrates which affect and/or manipulate a target cell in a manner which is beneficial to infection and deleterious to the target cell, i.e., they perturb the normal function of the target cell. Examples of actions of virulence factors include, but are not limited to, modulation of actin polymerization, induction of apoptosis, modulation of the cell cycle, modulation of gene transcription. Not all substrates are necessarily virulence factors. By way of non-limiting example, a T3SS (and a functional T3SS) can comprise proteins referred to as translocators. These substrates are secreted by the T3SS as it nears a complete form and create a pore in the target cell membrane, allowing further substrates to be delivered into the cytoplasm of the target cell, i.e., translocators are substrates in that they travel through the needle to the target cell and are also structural proteins in that they form part of the structure through which other substrates are delivered into the target cell. In some embodiments, a single polypeptide can be both a translocator and a virulence factor (e.g. IpaB of Shigella). A functional T3SS system can be introduced into a non-pathogenic bacterial cell.

Homologs of any given polypeptide or nucleic acid sequence can be found using, e.g., BLAST programs (freely available on the world wide web at blast.ncbi.nlm.nih.gov/), e.g. by searching freely available databases of sequence for homologous sequences, or by querying those databases for annotations indicating a homolog (e.g. search strings that comprise a gene name or describe the activity of a gene). The homologous amino acid or DNA sequence can be at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more, identical to a reference sequence. The degree of homology (percent identity) between a reference and a second sequence can be determined, for example, by comparing the two sequences using freely available computer programs commonly employed for this purpose on the world wide web.

Examples of T3SS secretion signals and chaperone-binding domains are known in the art, see, e.g. Schmitz et al. Nat Methods 2009 6:500-2; which described the signals and domains of Shigella effectors and which is incorporated by reference herein in its entirety. Additional examples are known in the art, e.g. Sory et al. PNAS 1995 92:11998-20002; which is incorporated by reference herein in its entirety. It is contemplated that a T3SS signal may reduce the activity of the non-T3SS signal portion of the T3SS-compatible polypeptide once it is delivered to the target cell. Accordingly, in some embodiments, the T3SS-compatible polypeptide can comprise a cleavage site after the T3SS signal sequence. In some embodiments, the cleavage site is a site recognized by an endogenous component of the target cell, e.g. a calpain, sumo, and/or furin cleavage site. In some embodiments, instead of a cleavage site, the T3SS-compatible polypeptide can comprise an ubiquitin molecule after the T3SS signal sequence such that the ubiquitin molecule and the sequence N-terminal of it is removed from the remainder of the polypeptide by a eukaryotic target cell. In some embodiments, the first amino acid C-terminal of the ubiquitin molecule can be a methionine.

The T3SS-compatible polypeptide may be an antigen. An engineered microbial cell comprising a T3SS-compatible antigen polypeptide may be to a subject, e.g., orally.

In one aspect, described herein is a kit comprising an engineered microbial cell as described herein. In one aspect, described herein is a kit comprising an engineered microbial cell comprising a first nucleic acid sequence comprising genes encoding a functional type three secretion system (T3SS); and a second nucleic acid sequence encoding an T3SS-compatible polypeptide; wherein the engineered microbial cell is non-pathogenic with respect to a target cell. Citation or identification of any reference herein, in any section of this application, shall not be construed as an admission that such reference is available as prior art to the present application. The disclosures of each reference disclosed herein, whether U.S. or foreign patent literature, or non-patent literature, are hereby incorporated by reference in their entirety in this application, and shall be treated as if the entirety thereof forms a part of this application.

Such references are provided for their disclosure of technologies to enable practice of the present invention, to provide basis for claim language, to make clear applicant's possession of the invention with respect to the various aggregates, combinations, and subcombinations of the respective disclosures or portions thereof (within a particular reference or across multiple references). The citation of references is intended to be part of the disclosure of the invention, and not merely supplementary background information. The incorporation by reference does not extend to teachings which are inconsistent with the invention as expressly described herein, and is evidence of a proper interpretation by persons of ordinary skill in the art of the terms, phrase and concepts discussed herein, without being limiting as the sole interpretation available.

Genetically-engineered bacterial vectors represent a promising method of therapy for various diseases and as a biomolecule delivery system.

Tumor-targeted bacteria, especially those derived from wild type samples, are typically capable of producing a chronic infection without strong acute response. That is, these bacteria seem to have evolved to avoid triggering a debilitating immune response in the host while at the same time establishing long term colonization of tissues, in the case of tumor targeting bacteria, tissues which may include necrotic regions. According to some evolutionary theories, the attenuated host response to these bacteria may result from a survival benefit for the host in permitting the colonization. Indeed, there are at least anecdotal reports of successful eradication of tumors by bacterial therapy. This implies that bacteria derived from these strains can be pharmaceutically acceptable, for administration through various routes of administration.

Much research has been performed on bacterial therapies and bacterial delivery vectors. For example, tumor targeting bacteria offer tremendous potential advantages for the treatment of solid tumors, including the targeting from a distant inoculation site and the ability to express therapeutic agents directly within the tumor (Pawelek et al., 1997, Tumor-targeted Salmonella as a novel anticancer agent, Cancer Research 57: 4537-4544; Low et al., 1999, Lipid A mutant salmonella with suppressed virulence and TNF-alpha induction retain tumor-targeting in vivo, Nature Biotechnol. 17: 37-41). However, the primary shortcoming of tumor-targeted bacteria investigated in the human clinical trials (Salmonella strain VNP20009 also known as YS1646, and its derivative TAPET-CD; Toso et al., 2002, Phase I study of the intravenous administration of attenuated Salmonella typhimurium to patients with metastatic melanoma, J. Clin, Oncol. 20: 142-152; Meir et al., 2001, Phase 1 trial of a live, attenuated Salmonella typhimurium (VNP20009) administered by direct Intra-tumoral (IT) injection, Proc Am Soc Clin Oncol 20: abstr 1043); Nemunaitis et al., 2003, Pilot trial of genetically modified, attenuated Salmonella expressing the E. coli cytosine deaminase gene in refractory cancer patients, Cancer Gene Therapy 10: 737-744) is that no significant antitumor activity has been observed, even in patients where the bacteria was documented to target the tumor. One method of increasing the ability of the bacteria to kill tumor cells is to engineer the bacteria to express conventional bacterial toxins (e.g., WO 2009/126189, WO 03/014380, WO/2005/018332, WO/2008/073148, US 2003/0059400 U.S. Pat. Nos. 7,452,531, 7,354,592, 6,962,696, 6,923,972, 6,863,894, 6,685,935, 6,475,482, 6,447,784, 6,190,657 and 6,080,849, 8,241,623, 8,524,220 8,771,669, 8,524,220).

Use of secreted proteins in live bacterial vectors has been demonstrated by several authors. Holland et al. (U.S. Pat. No. 5,143,830) have illustrated the use of fusions with the C-terminal portion of the hemolysin A (hlyA) gene, a member of the type I secretion system. When co-expressed in the presence of the hemolysin protein secretion channel (hlyBD) and a functional TolC, heterologous fusions are readily secreted from the bacteria. The type I secretion system that has been utilized most widely, and although it is currently considered the best system available, is thought to have limitations for delivery by attenuated bacteria (Hahn and Specht, 2003, FEMS Immunology and Medical Microbiology, 37: 87-98). Those limitations include the amount of protein secreted and the ability of the protein fused to it to interfere with secretion. Improvements of the type I secretion system have been demonstrated by Sugamata and Shiba (2005 Applied and Environmental Microbiology 71: 656-662), using a modified hlyB, and by Gupta and Lee (2008 Biotechnology and Bioengineering, 101: 967-974), by addition of rare codons to the hlyA gene. Fusion to the gene ClyA (Galen et al., 2004, Infection and Immunity, 72: 7096-7106 and Type III secretion proteins have also been used. Surface display has been used to export proteins outside of the bacteria. For example, fusion of the Lpp protein amino acids 1-9 with the transmembrane region B3-B7 of OmpA has been used for surface display (Samuelson et al., 2002, Display of proteins on bacteria, J. Biotechnology 96: 129-154). The autotransporter surface display has been described by Berthet et al., WO/2002/070645.

Other heterologous protein secretion systems utilizing the autotransporter family can be modulated to result in either surface display or complete release into the medium (see Henderson et al., 2004, Type V secretion pathway: the autotransporter story, Microbiology and Molecular Biology Reviews 68: 692-744; Jose, 2006 Applied Microbiol. Biotechnol. 69: 607-614; Jose J, Zangen D (2005) Autodisplay of the protease inhibitor aprotinin in Escherichia coli. Biochem Biophys Res Commun 333:1218-1226 and Rutherford and Mourez 2006 Microbial Cell Factories 5: 22). For example, Veiga et al. (2003 Journal of Bacteriology 185: 5585-5590 and Klauser et al., 1990 EMBO Journal 9: 1991-1999), demonstrated hybrid proteins containing the b-autotransporter domain of the immunoglobulin A (IgA) protease of Nisseria gonorrhea. Fusions to flagellar proteins have been demonstrated. The peptide, usually of 15 to 36 amino acids in length, is inserted into the central, hypervariable region of the FliC gene such as that from Salmonella muenchen (Verma et al. 1995 Vaccine 13: 235-24; Wu et al., 1989 Proc. Natl. Acad. Sci. USA 86: 4726-4730; Cuadro et al., 2004 Infect. Immun. 72: 2810-2816; Newton et al., 1995, Res. Microbiol. 146: 203-216, each of which is expressly incorporated by reference in its entirety). Multihybrid FliC insertions of up to 302 amino acids have also been prepared (Tanskanen et al. 2000, Appl. Env. Microbiol. 66: 4152-4156). Trimerization of antigens and functional proteins can be achieved using the T4 fibritin foldon trimerization sequence (Wei et al. 2008 J. Virology 82: 6200-6208) and VASP tetramerization domains (Kühnel et al., 2004 PNAS 101: 17027-17032). The multimerization domains are used to create, bi-specific, tri-specific, and quatra-specific targeting agents, whereby each individual agent is expressed with a multimerization tag, each of which may have the same or separate targeting peptide, such that following expression, surface display, secretion and/or release, they form multimers with multiple targeting domains. Other secretion systems include C-terminal fusions to the protein YebF (Zhang et al., 2006, Extracellular accumulation of recombinant proteins fused to the carrier protein YebF in Escherichia coli, Nat Biotechnol 24: 100-104), which is commercially available as a kit (pAES40; AthenaES, Baltimore, Md.). Fusions to OmsY and other proteins are also capable of secreting proteins into the medium (Zian et al., 2008, Proteome-Based Identification of Fusion Partner for High-Level Extracellular Production of Recombinant Proteins in Escherichia coli, Biotechnol Bioegineer 101: 587-601). Other secretions systems usable according to the present invention include that of Kotzsch et al. 2011 (A secretory system for bacterial production of high-profile protein targets, Protein Science 20: 597-609) using OmpA, OmpF and OsmY, or those described by Yoon et al., 2010 (Secretory production of recombinant proteins in Escherichia coli, Recent Patents on Biotechnology 4: 23-29. See, US2006-7094579, WO2009021548, EP1402036, US2006-7070989, US2008/0193974, US2006-7052867, US2003-6605697, U.S. Pat. No. 5,470,719, US2007/0287171, US2009/0011995, US2008/0076157, US2006-7112434, US2005-6919198, US2002-6455279, US2007-7291325, US2008-7410788, US2000-6083715, EP1270730, US2004-6673569, US2001-6309861, U.S. Pat. No. 5,989,868, US2006-7056732, US2005-6852512, US2005-6861403, EP1407052, WO2008089132, U.S. Pat. No. 5,824,502, EP1068339B1, US2008/0166757, US2001-6329172, US2003-6596509, US2003-6642027, WO2006017929, US2003-6596510, US2008/0280346, US2007-7202059, US2008/0280346, US2007-7202059, US2009-7491528, US2008/0206814, US2008/0166764, US2008/0182295, US2008/0254511, US2008/0206818, US2006-7105327, US2004/0005695, U.S. Pat. No. 5,508,192, EP866132, U.S. Pat. Nos. 6,921,659, 6,828,121, US2008/0064062, EP786009, US2006/0270043, and U.S. Pat. No. 7,202,059.

Compositions described in accordance with various embodiments herein include, without limitation, Salmonella enterica serovar Typhimurium (“S. typhimurium”), Salmonella montevideo, Salmonella enterica serovar Typhi (“S. typhi”), Salmonella enterica serovar Paratyphi A, Paratyphi B (“S. paratyphi 13”), Salmonella enterica serovar Paratyphi C (“S. paratyphi C”), Salmonella enterica serovar Hadar (“S. hadar”), Salmonella enterica serovar Enteriditis (“S. enteriditis”), Salmonella enterica serovar Kentucky (“S. kentucky”), Salmonella enterica serovar Infantis (“S. infantis”), Salmonella enterica serovar Pullorum (“S. pullorum”), Salmonella enterica serovar Gallinarum (“S. gallinarum”), Salmonella enterica serovar Muenchen (“S. muenchen”), Salmonella enterica serovar Anatum (“S. anatum”), Salmonella enterica serovar Dublin (“S. dublin”), Salmonella enterica serovar Derby (“S. derby”), Salmonella enterica serovar Choleraesuis var. kunzendorf (“S. cholerae kunzendorf”), and Salmonella enterica serovar minnesota (S. minnesota).

By way of example, live bacteria in accordance with aspects of the invention include known strains of S. enterica serovar Typhimurium (S. typhimurium) and S. enterica serovar Typhi (S. typhi) which are further modified as provided by various embodiments of the invention. Such Strains include Ty21a, CMV906, CMV908, CMV906-htr, CMV908-htr, Ty800, aroA-/serC-, holavax, M01ZH09, VNP20009. These strains contain defined mutations within specific serotypes of bacteria. The technology also includes the use of these same (or different) mutational combinations contained within alternate serotypes or strains in order to avoid immune reactions which may occur in subsequent administrations. For example, S. Typhimurium, S. montevideo, and S. typhi which have non-overlapping O-antigen presentation (e.g., S. typhimurium is O-1, 4, 5, 12 and S. typhi is Vi, S. montevideo is O-6, 7) may be used. Thus, for example, S. typhimurium is a suitable serotype for a first administration and another serotype such as S. typhi or S. montevideo are used for a second administration and third administration. Likewise, the flagellar antigens are also selected for non-overlapping antigenicity between different administrations. The flagellar antigen may be H1 or H2 or no flagellar antigen, which, when combined with the three different O-antigen serotypes, provides three completely different antigenic profiles.

Novel strains are also encompassed that are, for example, attenuated in virulence by mutations in a variety of metabolic and structural genes. The invention therefore may provide a live composition for treating cancer comprising a live attenuated bacterium that is a serovar of Salmonella enterica comprising an attenuating mutation in a genetic locus of the chromosome of said bacterium that attenuates virulence of said bacterium and wherein said attenuating mutation is the Suwwan deletion (Murray et al., 2004. Hot spot for a large deletion in the 18-19 Cs region confers a multiple phenotype in Salmonella enterica serovar Typhimurium strain ATCC 14028. Journal of Bacteriology 186: 8516-8523 (2004)) or combinations with other known attenuating mutations. Other attenuating mutation useful in the Salmonella bacterial strains described herein may be in a genetic locus selected from the group consisting of phoP, phoQ, edt, cya, crp, poxA, rpoS, htrA, nuoG, pmi, pabA, pts, damA, met, cys, pur, purA, purB, purl, purF, zwf, aroA, aroB, aroC, aroD, serC, gua, cadA, rfc, rjb, rfa, ompR, msbB, leucine and arginine, pfkAB, crr, glk, ptsG, ptsHI, manXYZ and combinations thereof. Strains of Salmonella deleted in stn are particularly preferred.

Attenuated gram-positive bacteria are also available as delivery vectors. For example, Staphylococcus epidermidis, group B Streptococcus including S. agalaciae, and Listeria species including L. monocytogenes may be employed. It is known to those skilled in the art that variations in molecular biology techniques such as use of gram-positive origins of replication, gram-positive signal sequences and gram-positive promoters and filamentous phage (e.g., phage B5; Chopin et al., 2002 J. Bacteriol. 184: 2030-2033, described further below) may be employed and substituted as needed. Other bacterial strains may also be encompassed, including non-pathogenic bacteria of the gut skin (such as Staphylococcus epidermidis, Proprionibacteria) and other body locations known as the human microbiome (Grice et al., Topographical and temporal diversity of the human skin microbiome, Science 324: 1190-1192; A framework for human microbiome research; The Human Microbiome Project Consortium, 14 Jun. 2012 Nature 486, 215-221; Spor et al., 2011, Unravelling the effects of the environment and host genotype on the gut microbiome, Nature Reviews Microbiology 9: 279-290) such as E. coli strains, Bacteriodies, Bifidobacterium and Bacillus, attenuated pathogenic strains of E. coli including enteropathogenic and uropathogenic isolates, Enterococcus sp. and Serratia sp. as well as attenuated Neisseria sp., Shigella sp., Staphylococcus sp., Staphylococcus carnosis, Yersinia sp., Streptococcus sp. and Listeria sp. including L. monocytogenes. Bacteria of low pathogenic potential to humans and other mammals or birds or wild animals, pets and livestock, such as insect pathogenic Xenorhabdus sp., Photorhabdus sp. and human wound Photorhabdus (Xenorhabdus) are also encompassed. Probiotic strains of bacteria are also encompassed, including Lactobacillus sp. (e.g., Lactobacillus acidophilus, Lactobacillus salivarius) Lactococcus sp., (e.g., Lactococcus lactis, Lactococcus casei) Leuconostoc sp., Pediococcus sp., Streptococcus sp. (e.g., S. salivariu, S. thermophilus), Bacillus sp., Bifidobacterium sp., Bacteroides sp., and Escherichia coli such as the 1917 Nissel strain.

It is known to those skilled in the art that minor variations in molecular biology techniques such as use of gram-positive origins of replication, gram-positive signal sequences gram-positive promoters (e.g., Lactococcus expression, Mohamadzadeh et al., PNAS Mar. 17, 2009 vol. 106 no. 114331-4336) may be used and substituted as needed. The bacteria may be further modified to be internalized into the host cell (Guimaraes et al., 2006, Use of Native Lactococci as Vehicles for Delivery of DNA into Mammalian Epithelial Cells, Appl Environ Microbiol. 2006 November; 72(11): 7091-7097; Innocentin et al., 2009, Lactococcus lactis Expressing either Staphylococcus aureus Fibronectin-Binding Protein A or Listeria monocytogenes Internalin A Can Efficiently Internalize and Deliver DNA in Human Epithelial Cells Appl Environ Microbiol. 2009 July; 75(14): 4870-4878).

Recently developed approaches to delivery of therapeutic molecules (U.S. Pat. Nos. 8,241,623; 8,524,220; 8,771,669; and 8,524,220) have coupled a protease sensitive therapeutic molecule with co-expression of protease inhibitors, expressly incorporated by reference herein.

The autotransporter surface display has been described by Berthet et al., WO/2002/070645, expressly incorporated by reference herein. Other heterologous protein secretion systems utilizing the autotransporter family can be modulated to result in either surface display or complete release into the medium (see Henderson et al., 2004, Type V secretion pathway: the autotransporter story, Microbiology and Molecular Biology Reviews 68: 692-744; Jose, 2006 Applied Microbiol. Biotechnol. 69: 607-614; Jose J, Zangen D (2005) Autodisplay of the protease inhibitor aprotinin in Escherichia coli. Biochem Biophys Res Commun 333:1218-1226 and Rutherford and Mourez 2006 Microbial Cell Factories 5: 22). For example, Veiga et al. (2003 Journal of Bacteriology 185: 5585-5590 and Klauser et al., 1990 EMBO Journal 9: 1991-1999) demonstrated hybrid proteins containing the β-autotransporter domain of the immunoglobulin A (IgA) protease of Nisseria gonorrhea. Fusions to flagellar proteins have been demonstrated. The peptide, usually of 15 to 36 amino acids in length, is inserted into the central, hypervariable region of the FliC gene such as that from Salmonella muenchen (Verma et al. 1995 Vaccine 13: 235-24; Wu et al., 1989 Proc. Natl. Acad. Sci. USA 86: 4726-4730; Cuadro et al., 2004 Infect. Immun. 72: 2810-2816; Newton et al., 1995, Res. Microbiol. 146: 203-216, expressly incorporated by reference in their entirety herein). Multihybrid FliC insertions of up to 302 amino acids have also been prepared (Tanskanen et al. 2000, Appl. Env. Microbiol. 66: 4152-4156, expressly incorporated by reference in its entirety herein).

Trimerization of antigens can be achieved using the T4 fibritin foldon trimerization sequence (Wei et al. 2008 J. Virology 82: 6200-6208) and VASP tetramerization domains (Kühnel et al., 2004 PNAS 101: 17027-17032), expressly incorporated by reference in their entirety herein. The multimerization domains are used to create, bi-specific, tri-specific, and quatra-specific targeting agents, whereby each individual agent is expressed with a multimerization tag, each of which may have the same or separate targeting peptide, such that following expression, surface display, secretion and/or release, they form multimers with multiple targeting domains. A fusion with the Pseudomonas ice nucleation protein (INP) wherein the N- and C-terminus of INP with an internal deletion consisting of the first 308 amino acids is followed by the mature sequence of the protein to be displayed (Jung et al., 1998, Surface display of Zymomonas mobilis levansucrase by using ice-nucleation protein of Pseudomonas syringae, Nature Biotechnology 16: 576-580; Kim et al., 2000, Bacterial surface display of an enzyme library for selective screening of improved cellulase variants, Applied and Environmental Microbiology 66: 788-793; Part:BBa_K811003 from www.iGEM.org; WO2005005630).

Salmonella are also encompassed that are, for example, attenuated in virulence by mutations in a variety of metabolic and structural genes. The technology therefore may provide a live composition for treating cancer comprising a live attenuated bacterium that is a serovar of Salmonella enterica comprising an attenuating mutation in a genetic locus of the chromosome of said bacterium that attenuates virulence of said bacterium and wherein said attenuating mutation is a combinations of other known attenuating mutations. The strain may also contain a mutation known as “Suwwan”, which is an approximately 100 kB deletion between two IS200 elements. The strain may also carry a defective thioredoxin gene (trxA-; which may be used in combination with a TrxA fusion), a defective glutathione oxidoreductase (gor-) and optionally, overexpress a protein disulfide bond isomerase (DsbA). The strain may also be engineered to express invasion and/or escape genes tlyA, tlyC patI and pld from Rickettsia, whereby the bacteria exhibit enhanced invasion and/or escape from the phagolysosome (Witworth et al., 2005, Infect. Immun. 73:6668-6673), thereby enhancing the activity of the effector genes described below. The strain may also be engineered to be deleted in an avirulence (anti-virulence) gene, such as zirTS, grvA and/or pcgL, or express the E. coli lac repressor, which is also an avirulence gene in order to compensate for over-attenuation. The strain may also express SlyA, a known transcriptional activator. In a preferred embodiment, the Salmonella strains are msbB mutants (msbB-). In a more preferred embodiment, the strains are msbB- and Suwwan. In a more preferred embodiment the strains are msbB-, Suwwan and zwf-. Zwf has recently been shown to provide resistance to CO2, acidic pH and osmolarity (Karsten et al., 2009, BMC Microbiology August 18; 9:170). Use of the msbB zwf genetic combination is also particularly preferred for use in combination with administered carbogen (an oxygen carbon dioxide mixture that may enhance delivery of therapeutic agents to a tumor). In a more preferred embodiment, the strains are msbB⁻, Suwwan, zwf⁻ and trxA⁻. In a most preferred embodiment, the strains are msbB⁻, Suwwan, zwf⁻, trxA⁻ and gor⁻.

The technology also provides, according to one embodiment, a process for preparing genetically stable therapeutic bacterial strains comprising genetically engineering the therapeutic genes of interest into a bacterially codon optimized expression sequence within a bacterial plasmid expression vector, endogenous virulence (VIR) plasmid (of Salmonella sp.), or chromosomal localization expression vector for any of the deleted genes or IS200 genes, defective phage or intergenic regions within the strain and further containing engineered restriction endonuclease sites such that the bacterially codon optimized expression gene contains subcomponents which are easily and rapidly exchangeable, and the bacterial strains so produced.

The present technology provides, for example, and without limitation, live bacterial compositions that are genetically engineered to express one or more protease inhibitors combined with antigens.

According to various embodiments, the technology provides pharmaceutical compositions comprising pharmaceutically acceptable carriers and one or more bacterial mutants. The technology also provides pharmaceutical compositions comprising pharmaceutically acceptable carriers and one or more bacterial mutants comprising nucleotide sequences encoding one or more peptides. Preferably, the bacterial mutants are attenuated by introducing one or more mutations in one or more genes in the lipopolysaccharide (LPS) biosynthetic pathway (for gram-negative bacteria), and optionally one or more mutations to auxotrophy for one or more nutrients or metabolites.

In one embodiment, a pharmaceutical composition comprises a pharmaceutically acceptable carrier and one or more bacterial mutants, wherein said attenuated bacterial mutants are facultative anaerobes or facultative aerobes. In another embodiment, a pharmaceutical composition comprises a pharmaceutically acceptable carrier and one or more attenuated bacterial mutants, wherein said attenuated bacterial mutants are facultative anaerobes or facultative aerobes. In one embodiment, a pharmaceutical composition comprises a pharmaceutically acceptable carrier and one or more bacterial mutants, wherein said attenuated bacterial mutants are facultative anaerobes or facultative aerobes. In another embodiment, a pharmaceutical composition comprises a pharmaceutically acceptable carrier and one or more attenuated bacterial mutants, wherein said attenuated bacterial mutants are facultative anaerobes or facultative aerobes.

A pharmaceutically effective dosage form may comprise between about 10⁵to 10¹²live bacteria, within a lyophilized medium for oral administration. In some embodiments, about 10⁹live bacteria are administered.

Pharmaceutically acceptable formulations may be provided for delivery by other various routes e.g. by intramuscular injection, subcutaneous delivery, by intranasal delivery (e.g. WO 00/47222, U.S. Pat. No. 6,635,246), intradermal delivery (e.g. WO02/074336, WO02/067983, WO02/087494, WO02/0832149 WO04/016281, each of which is expressly incorporated herein by reference it its entirety) by transdermal delivery, by transcutaneous delivery, by topical routes, etc. Injection may involve a needle (including a microneedle), or may be needle-free. See, e.g., U.S. Pat. Nos. 7,452,531, 7,354,592, 6,962,696, 6,923,972, 6,863,894, 6,685,935, 6,475,482, 6,447,784, 6,190,657, 6,080,849 and US Pub. 2003/0059400, each of which is expressly incorporated herein by reference.

Bacterial vector vaccines are known, and similar techniques may be used for the present bacteria as for bacterial vaccine vectors (U.S. Pat. No. 6,500,419, Curtiss, In: New Generation Vaccines: The Molecular Approach, Ed., Marcel Dekker, Inc., New York, N.Y., pages 161-188 and 269-288 (1989); and Mims et al, In: Medical Microbiology, Eds., Mosby-Year Book Europe Ltd., London (1993)). These known vaccines can enter the host, either orally, intranasally or parenterally. Once gaining access to the host, the bacterial vector vaccines express an engineered prokaryotic expression cassette contained therein that encodes a foreign antigen(s). Foreign antigens can be any protein (or part of a protein) or combination thereof from a bacterial, viral, or parasitic pathogen that has vaccine properties (New Generation Vaccines: The Molecular Approach, supra; Vaccines and Immunotherapy, supra; Hilleman, Dev. Biol. Stand., 82:3-20 (1994); Formal et al, Infect. Immun. 34:746-751 (1981); Gonzalez et al, J. Infect. Dis., 169:927-931 (1994); Stevenson et al, FEMS Lett., 28:317-320 (1985); Aggarwal et al, J. Exp. Med., 172:1083-1090 (1990); Hone et al, Microbial. Path., 5:407-418 (1988); Flynn et al, Mol. Microbiol., 4:2111-2118 (1990); Walker et al, Infect. Immun., 60:4260-4268 (1992); Cardenas et al, Vacc., 11:126-135 (1993); Curtiss et al, Dev. Biol. Stand., 82:23-33 (1994); Simonet et al, Infect. Immun., 62:863-867 (1994); Charbit et al, Vacc., 11:1221-1228 (1993); Turner et al, Infect. Immun., 61:5374-5380 (1993); Schodel et al, Infect. Immun., 62:1669-1676 (1994); Schodel et al, J. Immunol., 145:4317-4321 (1990); Stabel et al, Infect. Immun., 59:2941-2947 (1991); Brown, J. Infect. Dis., 155:86-92 (1987); Doggett et al, Infect. Immun., 61:1859-1866 (1993); Brett et al, Immunol., 80:306-312 (1993); Yang et al, J. Immunol., 145:2281-2285 (1990); Gao et al, Infect. Immun., 60:3780-3789 (1992); and Chatfield et al, Bio/Technology, 10:888-892 (1992)). Delivery of the foreign antigen to the host tissue using bacterial vector vaccines results in host immune responses against the foreign antigen, which provide protection against the pathogen from which the foreign antigen originates (Mims, The Pathogenesis of Infectious Disease, Academic Press, London (1987); and New Generation Vaccines: The Molecular Approach, supra). See also: Formal et al, Infect. Immun., 34:746-751 (1981); Wick et al, Infect. Immun., 62:4542-4548 (1994)); Hone et al, Vaccine, 9:810-816 (1991); Tacket et al, Infect. Immun., 60:536-541 (1992); Hone et al, J. Clin. Invest., 90:412-420 (1992); Chatfield et al, Vaccine, 10:8-11 (1992); Tacket et al, Vaccine, 10:443-446 (1992); van Damme et al, Gastroenterol., 103:520-531 (1992) (Yersinia pestis), Noriega et al, Infect. Immun., 62:5168-5172 (1994) (Shigella spp), Levine et al, In: Vibrio cholerae, Molecular to Global Perspectives, Wachsmuth et al, Eds, ASM Press, Washington, D.C., pages 395-414 (1994) (Vibrio cholerae), Lagranderie et al, Vaccine, 11:1283-1290 (1993); Flynn, Cell. Molec. Biol., 40(Suppl. 1):31-36 (1994) (Mycobacterium strain BCG), Schafer et al, J. Immunol., 149:53-59 (1992)(Listeria monocytogenes), each of which is expressly incorporated herein by reference.

The bacteria are generally administered along with a pharmaceutically acceptable carrier and/or diluent. The particular pharmaceutically acceptable carrier and/or diluent employed is not critical to the present invention unless otherwise specific herein (or in a respective incorporated referenced relevant to the issue). Examples of diluents include a phosphate buffered saline, buffer for buffering against gastric acid in the stomach, such as citrate buffer (pH 7.0) containing sucrose, bicarbonate buffer (pH 7.0) alone (Levine et al, J. Clin. Invest., 79:888-902 (1987); and Black et al J. Infect. Dis., 155:1260-1265 (1987), expressly incorporated herein by reference), or bicarbonate buffer (pH 7.0) containing ascorbic acid, lactose, and optionally aspartame (Levine et al, Lancet, II:467-470 (1988), expressly incorporated herein by reference). Examples of carriers include proteins, e.g., as found in skim milk, sugars, e.g., sucrose, or polyvinylpyrrolidone. Typically, these carriers would be used at a concentration of about 0.1-30% (w/v) but preferably at a range of 1-10% (w/v).

Set forth below are other pharmaceutically acceptable carriers or diluents which may be used for delivery specific routes. Any such carrier or diluent can be used for administration of the bacteria of the invention, so long as the bacteria are still capable of invading a target cell. In vitro or in vivo tests for invasiveness can be performed to determine appropriate diluents and carriers. The compositions of the invention can be formulated for a variety of types of administration, including systemic and topical or localized administration. Lyophilized forms are also included, so long as the bacteria are invasive upon contact with a target cell or upon administration to the subject. Techniques and formulations generally may be found in Remington's Pharmaceutical Sciences, Meade Publishing Co., Easton, Pa., expressly incorporated herein by reference in its entirety. For systemic administration, injection is preferred, including intramuscular, intravenous, intraperitoneal, and subcutaneous. For injection, the composition, e.g., bacteria, of the invention can be formulated in liquid solutions, preferably in physiologically compatible buffers such as Hank's solution or Ringer's solution.

For oral administration, the pharmaceutical compositions may take the form of, for example, tablets or capsules prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinised maize starch, polyvinylpyrrolidone or hydroxypropyl methylcellulose); fillers (e.g., lactose, microcrystalline cellulose or calcium hydrogen phosphate); lubricants (e.g., magnesium stearate, talc or silica); disintegrants (e.g., potato starch or sodium starch glycolate); or wetting agents (e.g., sodium lauryl sulfate). The tablets may be coated by methods well known in the art. Liquid preparations for oral administration may take the form of, for example, solutions, syrups or suspensions, or they may be presented as a dry product for constitution with water or other suitable vehicle before use. Such liquid preparations may be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (e.g., sorbitol syrup, cellulose derivatives or hydrogenated edible fats); emulsifying agents (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol or fractionated vegetable oils); and preservatives. The preparations may also contain buffer salts, flavoring, coloring and sweetening agents as appropriate.

Preparations for oral administration may be suitably formulated to give controlled release or enteric release. For buccal administration the compositions may take the form of tablets or lozenges formulated in conventional manner.

For administration by inhalation, the pharmaceutical compositions for use according to the present invention are conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g., a hydrofluorocarbon (HFC), carbon dioxide or other suitable gas. In the case of a pressurized aerosol the dosage unit may be determined by providing a valve to deliver a metered amount. Capsules and cartridges of e.g. gelatin for use in an inhaler or insufflator may be formulated containing a powder mix of the composition, e.g., bacteria, and a suitable powder base such as lactose or starch.

The pharmaceutical compositions may be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion. Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative. The compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents. Alternatively, the active ingredient may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.

See also U.S. Pat. No. 6,962,696, expressly incorporated herein by reference in its entirety.

The present invention provides a pharmaceutical composition comprising a pharmaceutically acceptable carrier and an attenuated tumor-targeted bacteria comprising one or more nucleic acid molecules encoding one or more primary effector molecules operably linked to one or more appropriate promoters. The present invention provides a pharmaceutical composition comprising a pharmaceutically acceptable carrier and an attenuated tumor-targeted bacteria comprising one or more nucleic acid molecules encoding one or more primary effector molecules and one or more secondary effector molecules operably linked to one or more appropriate promoters.

The present invention provides a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a bacterium.

In a specific embodiment, the term “pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term “carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil, olive oil, and the like. Saline is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like. Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical carriers are described in “Remington's Pharmaceutical Sciences” by E. W. Martin. Such compositions will contain a therapeutically effective amount of the therapeutic attenuated tumor-targeted bacteria, in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient. The formulation should suit the mode of administration.

In a preferred embodiment, the composition is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings. Typically, compositions for intravenous administration are solutions in sterile isotonic aqueous buffer. Where necessary, the composition may also include a suspending agent and a local anesthetic such as lignocaine to ease pain at the site of the injection. Generally, the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.

The amount of the pharmaceutical composition of the invention which will be effective in the vaccination of a subject can be determined by standard clinical techniques. In addition, in vitro assays may optionally be employed to help identify optimal dosage ranges. The precise dose to be employed in the formulation will also depend on the route of administration, and should be decided according to the judgment of the practitioner and each patient's circumstances. However, suitable dosage ranges are generally from about 1.0 cfu/kg to about 1×10¹⁰cfu/kg; optionally from about 1.0 cfu/kg to about 1×10⁸cfu/kg; optionally from about 1×10²cfu/kg to about 1×10⁸cfu/kg; optionally from about 1 10⁴cfu/kg to about 1×10⁸cfu/kg; and optionally from about 1×10⁴cfu/kg to about 1×10¹⁰cfu/kg (cfu=colony forming unit). Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.

Various delivery systems are known and can be used to administer a pharmaceutical composition of the present invention. Methods of introduction include but are not limited to intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, and oral routes. The compositions may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal-mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local. Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent.

The invention also provides a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions of the invention. Optionally associated with such container(s) can be a notice in the form prescribed by governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.

The compositions and methods described herein can be administered to a subject in need of treatment, e.g. in need of treatment for inflammation or cancer. In some embodiments, the methods described herein comprise administering an effective amount of compositions described herein, e.g. engineered microbial cells to a subject in order to alleviate a symptom. As used herein, “alleviating a symptom” is ameliorating any condition or symptom associated with a given condition. As compared with an equivalent untreated control, such reduction is by at least 5%, 10%, 20%, 40%, 50%, 60%, 80%, 90%, 95%, 99% or more as measured by any standard technique. A variety of means for administering the compositions described herein to subjects are known to those of skill in the art. Such methods can include, but are not limited to oral, subcutaneous, transdermal, airway (aerosol), cutaneous, topical, or injection administration. Administration can be local or systemic.

The term “effective amount” as used herein refers to the amount of engineered microbial cells needed to alleviate at least one or more symptom of the disease or disorder, and relates to a sufficient amount of pharmacological composition to provide the desired effect. The term “therapeutically effective amount” therefore refers to an amount of engineered microbial cells that is sufficient to effect a particular effect when administered to a typical subject. An effective amount as used herein, in various contexts, would also include an amount sufficient to delay the development of a symptom of the disease, alter the course of a symptom disease (for example but not limited to, slowing the progression of a symptom of the disease), or reverse a symptom of the disease. Thus, it is not generally practicable to specify an exact “effective amount”. However, for any given case, an appropriate “effective amount” can be determined by one of ordinary skill in the art using only routine experimentation.

Effective amounts, toxicity, and therapeutic efficacy can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the ED₅₀(the dose therapeutically effective in 50% of the population). The dosage can vary depending upon the dosage form employed and the route of administration utilized. The dose ratio between toxic and therapeutic effects is the therapeutic index and can be expressed as the ratio ED₅₀. Compositions and methods that exhibit large therapeutic indices are preferred. A therapeutically effective dose can be estimated initially from cell culture assays. Also, a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC₅₀(i.e., the concentration of an engineered microbial cell which achieves a half-maximal inhibition of symptoms) as determined in cell culture, or in an appropriate animal model. Levels in plasma can be measured, for example, by high performance liquid chromatography. The effects of any particular dosage can be monitored by a suitable bioassay, e.g., assay for inflammation, among others. The dosage can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment.

In some embodiments, the technology described herein relates to a pharmaceutical composition comprising an engineered microbial cell as described herein, and optionally a pharmaceutically acceptable carrier. Pharmaceutically acceptable carriers and diluents include saline, aqueous buffer solutions, solvents and/or dispersion media. The use of such carriers and diluents is well known in the art. Some non-limiting examples of materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, methylcellulose, ethyl cellulose, microcrystalline cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) lubricating agents, such as magnesium stearate, sodium lauryl sulfate and talc; (8) excipients, such as cocoa butter and suppository waxes; (9) glycols, such as propylene glycol; (10) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol (PEG); (11) esters, such as ethyl oleate and ethyl laurate; (12) agar; (13) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (14) alginic acid; (15) pyrogen-free water; (16) isotonic saline; (17) Ringer's solution; (18) pH buffered solutions; (19) polyesters, polycarbonates and/or polyanhydrides; (20) bulking agents, such as polypeptides and amino acids (21) serum component, such as serum albumin, HDL and LDL; and (22) other non-toxic compatible substances employed in pharmaceutical formulations. Wetting agents, coloring agents, release agents, coating agents, sweetening agents, flavoring agents, perfuming agents, preservative and antioxidants can also be present in the formulation. The terms such as “excipient”, “carrier”, “pharmaceutically acceptable carrier” or the like are used interchangeably herein.

Pharmaceutical compositions comprising an engineered microbial cell can be formulated to be suitable for oral administration, for example as discrete dosage forms, such as, but not limited to, tablets (including without limitation scored or coated tablets), pills, caplets, capsules, chewable tablets, powder packets, cachets, troches, wafers, aerosol sprays, or liquids, such as but not limited to, syrups, elixirs, solutions or suspensions in an aqueous liquid. Such compositions contain a predetermined amount of the pharmaceutically acceptable salt of the disclosed compounds, and may be prepared by methods of pharmacy well known to those skilled in the art. See generally, Remington: The Science and Practice of Pharmacy, 21st Ed., Lippincott, Williams, and Wilkins, Philadelphia Pa. (2005).

In certain embodiments, an effective dose of a composition comprising engineered microbial cells as described herein can be administered to a patient once. In certain embodiments, an effective dose of a composition comprising engineered microbial cells can be administered to a patient repeatedly. In some embodiments, the dose can be a daily administration, for example oral administration, of, e.g., a capsule comprising bacterial cells as described herein. In some embodiments, the dose can be, e.g. an injection or gavage of bacterial cells. In some embodiments, the dose can be administered systemically, e.g. by intravenous injection. In some embodiments, a dose can comprise from 10⁶to 10¹²cells. In some embodiments, a dose can comprise from about 10⁸to 10¹⁰cells. A composition comprising engineered microbial cells can be administered over a period of time, such as over a 5 minute, 10 minute, 15 minute, 20 minute, or 25 minute period. The administration can be repeated, for example, on a regular basis, such as every few days, once a week, or biweekly (i.e., every two weeks) for one month, two months, three months, four months or longer.

In some embodiments, after an initial treatment regimen, the treatments can be administered on a less frequent basis. For example, after treatment biweekly for three months, treatment can be repeated once per month, for six months or a year or longer.

The efficacy of engineered microbial cells in, e.g. the raising of an appropriate immune response to a specified disease, e.g., COVID-19, can be determined by the skilled clinician. However, a treatment is considered “effective treatment,” as the term is used herein, clinically useful partial or complete immunity is achieved. Efficacy can be assessed, for example, by measuring a marker, indicator, population statistic, or any other measurable parameter appropriate.

For convenience, the meaning of some terms and phrases used in the specification, examples, and appended claims, are provided below. Unless stated otherwise, or implicit from context, the following terms and phrases include the meanings provided below. The definitions are provided to aid in describing particular embodiments, and are not intended to limit the claimed invention, because the scope of the invention is limited only by the claims. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. If there is an apparent discrepancy between the usage of a term in the art and its definition provided herein, the definition provided within the specification shall prevail.

For convenience, certain terms employed herein, in the specification, examples and appended claims are collected here.

The terms “decrease”, “reduced”, “reduction”, or “inhibit” are all used herein to mean a decrease by a statistically significant amount. In some embodiments, the terms “reduced”, “reduction”, “decrease”, or “inhibit” can mean a decrease by at least 10% as compared to a reference level, for example a decrease by at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% or more or any decrease of at least 10% as compared to a reference level. In some embodiments, the terms can represent a 100% decrease, i.e., a non-detectable level as compared to a reference level. In the context of a marker or symptom, a “decrease” is a statistically significant decrease in such level. The decrease can be, for example, at least 10%, at least 20%, at least 30%, at least 40% or more, and is preferably down to a level accepted as within the range of normal for an individual without such disorder. In some instances, the symptom can be essentially eliminated which means that the symptom is reduced, i.e., the individual is in at least temporary remission.

The terms “increased”, “increase”, “enhance”, or “activate” are all used herein to mean an increase by a statically significant amount. In some embodiments, the terms “increased”, “increase”, “enhance”, or “activate” can mean an increase of at least 10% as compared to a reference level, for example an increase of at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% or up to and including a 100% increase or any increase between 10-100% as compared to a reference level, or at least about a 2-fold, or at least about a 3-fold, or at least about a 4-fold, or at least about a 5-fold or at least about a 10-fold increase, or any increase between 2-fold and 10-fold or greater as compared to a reference level. In the context of a marker or symptom, a “increase” is a statistically significant increase in such level.

As used herein, a “subject” means a human or non-human animal. Usually the non-human animal is a vertebrate such as a primate, rodent, domestic animal or game animal. Primates include chimpanzees, cynomologous monkeys, spider monkeys, and macaques, e.g., Rhesus. Rodents include mice, rats, woodchucks, ferrets, rabbits and hamsters. Animals also include armadillos, hedgehogs, and camels, top name a few. Domestic and game animals include cows, horses, pigs, deer, bison, buffalo, feline species, e.g., domestic cat, canine species, e.g., dog, fox, wolf, avian species, e.g., chicken, emu, ostrich, and fish, e.g., trout, catfish and salmon. In some embodiments, the subject is a mammal, e.g., a primate, e.g., a human. The terms, “individual,” “patient” and “subject” are used interchangeably herein.

Preferably, the subject is a mammal. The mammal can be a human, non-human primate, mouse, rat, dog, cat, horse, cow, or pig, but is not limited to these examples. Mammals other than humans can be advantageously used as subjects that represent animal models of a given condition. A subject can be male or female.

A subject can be one who has been previously diagnosed with or identified as suffering from or having a condition in need of treatment, and optionally, have already undergone treatment. Alternatively, a subject can also be one who has not been previously diagnosed as having a condition. For example, a subject can be one who exhibits one or more risk factors or a subject who does not exhibit risk factors.

A “subject in need” of treatment for a particular condition can be a subject having that condition, diagnosed as having that condition, or at risk of developing that condition.

As used herein, the terms “protein” and “polypeptide” are used interchangeably herein to designate a series of amino acid residues, connected to each other by peptide bonds between the alpha-amino and carboxy groups of adjacent residues. The terms “protein”, and “polypeptide” refer to a polymer of amino acids, including modified amino acids (e.g., phosphorylated, glycated, glycosylated, etc.) and amino acid analogs, regardless of its size or function. “Protein” and “polypeptide” are often used in reference to relatively large polypeptides, whereas the term “peptide” is often used in reference to small polypeptides, but usage of these terms in the art overlaps. The terms “protein” and “polypeptide” are used interchangeably herein when referring to a gene product and fragments thereof. Thus, exemplary polypeptides or proteins include gene products, naturally occurring proteins, homologs, orthologs, paralogs, fragments and other equivalents, variants, fragments, and analogs of the foregoing.

As used herein, the term “nucleic acid” or “nucleic acid sequence” refers to any molecule, preferably a polymeric molecule, incorporating units of ribonucleic acid, deoxyribonucleic acid or an analog thereof. The nucleic acid can be either single-stranded or double-stranded. A single-stranded nucleic acid can be one strand nucleic acid of a denatured double-stranded DNA. Alternatively, it can be a single-stranded nucleic acid not derived from any double-stranded DNA. In one aspect, the nucleic acid can be DNA. In another aspect, the nucleic acid can be RNA. Suitable nucleic acid molecules are DNA, including genomic DNA or cDNA. Other suitable nucleic acid molecules are RNA, including mRNA.

The term “expression” refers to the cellular processes involved in producing RNA and proteins and as appropriate, secreting proteins, including where applicable, but not limited to, for example, transcription, transcript processing, translation and protein folding, modification and processing. “Expression products” include RNA transcribed from a gene, and polypeptides obtained by translation of mRNA transcribed from a gene. The term “gene” means the nucleic acid sequence which is transcribed (DNA) to RNA in vitro or in vivo when operatively linked to appropriate regulatory sequences. A gene may or may not include regions preceding and following the coding region, e.g. 5′ untranslated (5′UTR) or “leader” sequences and 3′ UTR or “trailer” sequences.

The term “operatively linked” includes having an appropriate start signal (e.g., ATG) in front of the polynucleotide sequence to be expressed, and maintaining the correct reading frame to permit expression of the polynucleotide sequence under the control of the expression control sequence, and, optionally, production of the desired polypeptide encoded by the polynucleotide sequence. In some examples, transcription of a nucleic acid is under the control of a promoter sequence (or other transcriptional regulatory sequence) which controls the expression of the nucleic acid in a cell-type in which expression is intended. It will also be understood that the nucleic acid can be under the control of transcriptional regulatory sequences which are the same or which are different from those sequences which control transcription of the naturally-occurring form of a protein.

The term “isolated” or “partially purified” as used herein refers, in the case of a nucleic acid or polypeptide, to a nucleic acid or polypeptide separated from at least one other component (e.g., nucleic acid or polypeptide) that is present with the nucleic acid or polypeptide as found in its natural source and/or that would be present with the nucleic acid or polypeptide when expressed by a cell, or secreted in the case of secreted polypeptides. A chemically synthesized nucleic acid or polypeptide or one synthesized using in vitro transcription/translation is considered “isolated.”

As used herein, the terms “treat,” “treatment,” “treating,” or “amelioration” refer to therapeutic treatments, wherein the object is to reverse, alleviate, ameliorate, inhibit, slow down or stop the progression or severity of a condition associated with a disease or disorder, e.g. cancer or inflammation. The term “treating” includes reducing or alleviating at least one adverse effect or symptom of a condition, disease or disorder. Treatment is generally “effective” if one or more symptoms or clinical markers are reduced. Alternatively, treatment is “effective” if the progression of a disease is reduced or halted. That is, “treatment” includes not just the improvement of symptoms or markers, but also a cessation of, or at least slowing of, progress or worsening of symptoms compared to what would be expected in the absence of treatment. Beneficial or desired clinical results include, but are not limited to, alleviation of one or more symptom(s), diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, remission (whether partial or total), and/or decreased mortality, whether detectable or undetectable. The term “treatment” of a disease also includes providing relief from the symptoms or side-effects of the disease (including palliative treatment).

As used herein, the term “pharmaceutical composition” refers to the active agent in combination with a pharmaceutically acceptable carrier e.g. a carrier commonly used in the pharmaceutical industry. The phrase “pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.

As used herein, the term “administering,” refers to the placement of a compound as disclosed herein into a subject by a method or route which results in at least partial delivery of the agent at a desired site. Pharmaceutical compositions comprising the compounds disclosed herein can be administered by any appropriate route which results in an effective treatment in the subject.

The term “statistically significant” or “significantly” refers to statistical significance and generally means a two standard deviation (2SD) or greater difference.

Other than in the operating examples, or where otherwise indicated, all numbers expressing quantities of ingredients or reaction conditions used herein should be understood as modified in all instances by the term “about.” The term “about” when used in connection with percentages can mean±1%.

As used herein the term “comprising” or “comprises” is used in reference to compositions, methods, and respective component(s) thereof, that are essential to the method or composition, yet open to the inclusion of unspecified elements, whether essential or not.

The term “consisting of” refers to compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the embodiment.

As used herein the term “consisting essentially of” refers to those elements required for a given embodiment. The term permits the presence of elements that do not materially affect the basic and novel or functional characteristic(s) of that embodiment.

The singular terms “a,” “an,” and “the” include plural referents unless context clearly indicates otherwise. Similarly, the word “or” is intended to include “and” unless the context clearly indicates otherwise. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of this disclosure, suitable methods and materials are described below. The abbreviation, “e.g.” is derived from the Latin exempli gratia, and is used herein to indicate a non-limiting example. Thus, the abbreviation “e.g.” is synonymous with the term “for example.”

Definitions of common terms in cell biology and molecular biology can be found in “The Merck Manual of Diagnosis and Therapy”, 19th Edition, published by Merck Research Laboratories, 2006 (ISBN 0-911910-19-0); Robert S. Porter et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0-632-02182-9); Benjamin Lewin, Genes X, published by Jones & Bartlett Publishing, 2009 (ISBN-10: 0763766321); Kendrew et al. (eds.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8) and Current Protocols in Protein Sciences 2009, Wiley Intersciences, Coligan et al., eds.

Unless otherwise stated, the present invention was performed using standard procedures, as described, for example in Sambrook et al., Molecular Cloning: A Laboratory Manual (3 ed.), Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., USA (2001); Davis et al., Basic Methods in Molecular Biology, Elsevier Science Publishing, Inc., New York, USA (1995); Current Protocols in Protein Science (CPPS) (John E. Coligan, et. al., ed., John Wiley and Sons, Inc.), Current Protocols in Cell Biology (CPCB) (Juan S. Bonifacino et. al. ed., John Wiley and Sons, Inc.), and Culture of Animal Cells: A Manual of Basic Technique by R. Ian Freshney, Publisher: Wiley-Liss; 5th edition (2005), Animal Cell Culture Methods (Methods in Cell Biology, Vol. 57, Jennie P. Mather and David Barnes editors, Academic Press, 1st edition, 1998) which are all incorporated by reference herein in their entireties.

Other terms are defined herein within the description of the various aspects of the invention.

All patents and other publications; including literature references, issued patents, published patent applications, and co-pending patent applications; cited throughout this application are expressly incorporated herein by reference for all purposes, including, but not limited to, describing and disclosing, for example, the methodologies described in such publications that might be used in connection with the technology described herein.

SUMMARY OF THE INVENTION

The recent worldwide outbreak of SARS-CoV-2 has created an urgent need for protective vaccines. Major targets for vaccines against coronaviruses have been previously identified as the capsid, nucleoprotein, and the Spike or S glycoprotein. Among these, the receptor binding domain (RBD) of the spike protein of SARS-CoV plays a particularly important role because it is necessary for viral binding to the protein ACE2 linked to entry into the host. With the goal of eliciting neutralizing antibodies, and because the bat RBD differs from the SARS-CoV-2, and that the entire protein contains immunodominant epitopes that do not include the SARS-CoV-2 RBD, analysis was focused on predicted MHC Class II responses to the RBD itself. Based on these analyses, an attenuated bacterial delivery vector (VNP20009) that has previously been safely administered in human clinical studies, was selected to express secreted, YebF fusions to different portions of the RBD.

The present invention provides a vaccine directed toward the prevention of COVID19 caused by SARS-CoV-2. A DNA construct is provided in a live bacterium, such as E. coli Nissel 1917 or attenuated strains of Salmonella such as Salmonella typhimurium VNP20009. The DNA construct may uniquely represent the receptor binding domain (RBD) of SARS-Cov-2. The live bacterium carrying the DNA construct may be administered orally to a patient or an animal (such as a bat species that could be a host for SARS-CoV-2) in order to induce protective immunity.

A preferred embodiment of the design of the DNA construct is shown in FIG. 1.

Protective immunity through prior exposure is a natural mechanism that limits pandemic spread of emerging pathogens. However, as periodically seen with influenza, immune escape through antigenic drift, or more dramatically, through antigenic shift, allows reemergence of new broadly infective variants over time. These variants are shaped in part by preexisting immunity that limits the more immunologically similar variants and creates an evolutionary opportunity for immunologically dissimilar variants that retain transmissibility.

Severe acute respiratory syndrome (SARS) caused by SARS-CoV coronavirus emerged in 2003 as a new, high mortality respiratory infection. SARS-CoV is believed to have a zoonotic origin, as similar coronaviruses have been found in a number of animal species including bats, which have the highest sequence similarities (Lau et al., 2005; Li et al., 2005).

Antibodies against SARS-CoV S protein have been shown to be neutralizing (Kapada et al., 2005). Previous studies have shown that the spike protein of SARS-CoV induces long-term protective immunity (Du et al., 2007 Vaccine. 2007 Apr. 12; 25(15):2832-8). In that study, the receptor domain was fused with the human IgG1 Fc region. Others have included rhabdovirus-based vectors carrying the SARS-CoV spike protein (Faber et al., 2005), and baculovirus expressed proteins Zhou et al., 2006). Current approaches have recently been summarized (Le et al., 2020). As of that review, there were 78 different projects, most still in the exploratory stage. The mechanisms of immunization and/or antigen delivery include live attenuated viruses, inactivated viruses, non-replicating viral vectors, replicating viral vectors, recombinant proteins, peptide-based antigens, virus-like particles, DNA and RNA. Of the five projects that have moved to the clinic, three include vaccinating against the spike S glycoprotein: an mRNA to the entire 1273 amino acid sequence (Moderna; NCT04283461), an adenovirus type 5 vector (CanSino Biologics; NCT04313127), and a plasmid DNA vector (Inovio Pharmaceuticals; NCT04336410). In that review, the mechanisms of immunization and/or antigen delivery being investigated included live attenuated viruses, inactivated viruses, non-replicating viral vectors, replicating viral vectors, recombinant proteins, peptide-based antigens, virus-like particles, DNA and RNA, while bacterial vectors were not included.

Live attenuated bacterial vectors have been used to generate heterologous vaccines. In a recent study, the Salmonella vector VNP20009 (YS1646) that had been developed as a cancer therapeutic (Low et al., 2004) was employed as a delivery vector for an antigen from Clostridium difficile (Winter et al., 2019). Clostridium difficile is the causative agent for pseudomembranous enterocolitis, an often-fatal disease, yet protection of 82% was achieved with oral immunization and up to 100% using multimodal immunization. Live attenuated bacterial vaccines have many potential advantages, including rapid molecular engineering and rapid production due to cell-free replication competence, and low cost of production.

Alternative approaches to vaccine design continue to be explored. In a recent publication by Grifoni et al. (2020), sequence homology between SARS-CoV and SARS-CoV-2 was used to predict vaccine candidates. Although this approach may generate an immune response, there is only limited evidence that there is any cross protection of SARS-CoV and SARS-CoV-2, and thus the immune response may not be effective. Furthermore, Ou et al. (2020) have now shown that there the antibodies SARS-CoV show limited cross-neutralization of SARS-CoV-2. In addition, there is growing concern that infection by and SARS-CoV-2 does not protect against and SARS-CoV-2 reinfection. It may be that the dominant antibodies produced help with immune clearance, but don't prevent infection because they don't block internalization.

SARS-CoV and SARS-CoV-2 share amino acid sequence homology and therefore a common ancestor, although the closest homology is with bats (Wu 2020, https://doi.org/10.1101/2020.03.04.975995). It therefore seems most likely that SARS-CoV-2 emerged from bats rather than from SARS-CoV. While there are many sequence differences between SARS-CoV-2 and the bat coronavirus, there are a particularly striking number of differences within the receptor binding domain. These differences are likely to contribute to lack of cross-immunity between SARS-CoV and SARS-CoV-2 (Ou et al., 2020), and are also likely to contribute to the cross over to humans and the highly infectious nature of SARS-CoV-2 toward humans, which begins with its interaction with human ACE2 (hACE2). If true, the RBD alteration responsible for host specificity and antigen escape are linked. Three mutant types (V367F, W436R, and D364Y) in the RBD showed higher binding affinity to human ACE2 (Ou et al. Emergence of RBD mutations in circulating SARS-CoV-2 strains enhancing the structural stability and human ACE2 receptor affinity of the spike protein, bioRxiv preprint doi: https://doi.org/10.1101/2020.03.15.991844).

The present approach is guided by the following presumptions:

That and SARS-CoV-2 is derived from the bat coronavirus.

- That the mutations in the RBD result in increased human specificity.
- That the mutations in the RBD result in immune escape.

That antibodies against the SARS-CoV-2 RBD would have the greatest microneutralization potential.

That the SARS-CoV-2 spike protein contains immunodominant epitopes that may limit the immune response to the RBD.

- That immunization with the RBD only removes the immunodominant epitopes and will result in an RBD-directed response.
- Thus, immunization against the SARS-CoV-2 RBD would be more effective than the spike protein alone.

That the SARS-CoV-2 RBD can be expressed and secreted by an attenuated bacterial vector as a fusion protein such as with YebF or HlyA.

- That the fusion protein is capable of eliciting a neutralizing MHC Class II response.

That an attenuated bacterial vector expressing the SARS-CoV-2 RBD, such as VNP20009 can be safe and effective for administration to humans.

It is therefore an object to provide a live genetically engineered bacterium, comprising a genetically engineered construct comprising a nucleic acid sequence encoding at least one portion of a SARS-CoV-2 antigen, the live genetically engineered bacterium being adapted for administration to a human or animal and colonization of at least one tissue under non-lethal conditions.

It is a further object to provide a genetically engineered bacterium selected from the group consisting of E. coli and Salmonella, comprising: a first genetically engineered construct comprising a nucleic acid sequence encoding at least one portion of a SARS-CoV-2 spike protein receptor binding domain, having an associated promoter; and a second genetically engineered construct comprising a nucleic acid sequence encoding an adjuvant peptide. The at least one portion of a SARS-CoV-2 spike protein receptor binding domain and the adjuvant petide may be together expressed as a fusion petide.

It is a still further object to provide a method of vaccinating a human against SARS-CoV-2, comprising: administering the live genetically engineered bacterium according to claim 1 orally, intranasally, or rectally to the human or animal; allowing the live genetically engineered bacterium to colonize a tissue of the human or animal; and clearing the live genetically engineered bacterium from the human or animal, wherein said administration, colonization, and clearance are non-lethal to the human or animal. The at least one portion of a SARS-CoV-2 antigen may comprise the SARS-Cov-2 spike protein, and the nucleic acid sequence encoding the SARS-CoV-2 spike protein may have an associated promoter.

The at least one portion of a SARS-CoV-2 antigen may comprise the SARS-Cov-2 spike protein.

The nucleic acid sequence encoding the SARS-CoV-2 spike protein may have an associated promoter.

The nucleic acid sequence may further encode a secretion signal.

The live genetically engineered bacterium may be E. coli, e.g., E. coli Nissel 1917, or Salmonella, e.g., Salmonella typhimurium or VNP20009/YS1646.

The at least one portion of the SARS-CoV-2 spike gene portion may be an antigenic subportion of the receptor binding domain.

The at least one portion of the SARS-CoV-2 spike gene portion may be fused in-frame with an adjuvant peptide encoding sequence.

The adjuvant peptide may be a dimer of at least a portion of p28.

The adjuvant peptide may be selected from the group consisting of flagellin, a subportion of flagellin that binds to a toll-like receptor, a combination of p28 and flagellin toll-like receptor binding region, a dimer of C3d p28, and a dimer of C3d p28 with an internal flagellin peptide.

The live genetically engineered bacterium may expresse a gut colonization factor.

The gut colonization factor may be selected from the group consisting of colicin A, E1, E2, E3, E4, E5, E6, E7, E8, E9, DF13, K, N, U, B, D, Ia, and M.

The nucleic acid sequence may further encode at least one of an angiotensin converting enzyme 2 binding peptide and a portion of angiotensin binding protein 2.

The nucleic acid sequence may encode a fusion protein further comprising a portion selected from the group consisting of YebF, ice nucleation protein, autodisplay proteins and HlyA.

The fusion protein may be a truncated portion containing a one or more disulfide bonds or lacking potential for such bonds.

The live genetically engineered bacterium may co-expresse a colicin immunity peptide and a colicin lysis peptide.

The nucleic acid sequence may be integrated with a bacterial chromosome.

The nucleic acid sequence may encode a secretion signal.

The nucleic acid sequence may encode a protease inhibitor, e.g., a serpin or furin inhibitor.

The colonization factor may enhance immunization. The colonization factor may be a colicin co-expressed with its immunity and lysis peptides. The colonization factor may be ColE3.

The bacteria may produce a fusion peptide comprising the antigen and an adjuvant peptide.

BRIEF DESCRIPTION OF THE DRAWINGS

FIG. 1 shows a plasmid vector for expression of SARS-CoV-2 Receptor Binding Domain in E. coli and Salmonella vaccine delivery vectors.

DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

DNA Sequence Analysis of RBD and its Mutations

Recently, a study of the global sequence variation within SARS-CoV-2 has been made available in an interactive format by NextStrain. Their analysis shows eight major strains circulating across the globe, with strong geographic preferences, suggesting the specific mutations they carry represent those of the progenitors for most of the strains in those regions.

The receptor binding domain of SARS-CoV-2, residues 488-525 (hereinafter “SARS-Cov-2 RBD 488-525”)”

SEQ ID NO. 015

CYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVC

The receptor binding domain of SARS-CoV-2, with 4 added amino acids (CGPK) predicted to be antigenic using the online analysis tool EMBOSS. The additional cysteine may provide for disulfide bonding.

SEQ ID NO. 001

NITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSAS

FSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTG

KIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKS

NLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNG

VGYQPYRVVVLSFELLHAPATVCGPK

A graphical representation of the modified portion of the circular plasmid pTrc99a (Genbank U13872.1). The lacI (repressor) has been partially deleted. Various portions of the receptor binding domain RBD of SARS-CoV-2 (Wuhan-Hu-1 NC_045512.2), e.g., 488-525, preceded by a flexible linker, are expressed under control of the ptrc promoter with an RBS as an in-frame fusion with YebF e.g., [128], followed by a stop codon. Receptor binding domain may include the cysteines for possible disulfide bonding. Optionally, and adjuvant peptide such as C3d-P28208-235 (SEQ ID NO. 004; [124]), or flagellin peptides (e.g., those of domains aD1a, aD1b, aD1C, [119]), may be inserted singly or at both sites to create repeats. A colonization enhancing factor, colicin E3 (E3) and its immunity factor (E3 immune) from Genbank KM287568 are optionally co-expressed.

Flexible linker with RBD 488-525

SEQ ID NO. 002

GGGGScyfplqsygfqptngvgygpyrvvvlsfellhapatvc

FIG. 1 shows plasmid vector for expression of SARS-CoV-2 Receptor Binding Domain in E. coli and Salmonella vaccine delivery vectors. A graphical representation of the modified portion of the circular plasmid pTrc99a (Genbank U13872.1). The lacI (repressor) has been partially deleted. Various portions of the receptor binding domain RBD of SARS-CoV-2 (Wuhan-Hu-1 NC_045512.2), e.g., 488-525, preceded by a flexible linker, are expressed under control of the ptrc promoter with an RBS as an in-frame fusion with YebF (e.g., [128]), followed by a stop codon. Receptor binding domain may include the cysteines for possible disulfide bonding. Optionally, and adjuvant peptide such as C3d-P28_208-235. The flexible linker with RBD 488-528 may be, for example,

SEQ ID NO. 003

GGGGScyfplqsygfqptngvgygpyrvvvlsfellhapatvcGPK

SEQ ID NO. 004

KFLTTAKDKNRWEDPGKQLYNVEATSYA

a synthetic peptide corresponding to the CR2-binding site on C3d, P28 [124] or flagellin peptides (e.g., those of domains aD1a, aD1b, aD1C, [119]), may be inserted singly or at both sites to create repeats. A colonization enhancing factor, colicin E3 (E3) and its immunity factor (E3 immune) from Genbank KM287568 are optionally co-expressed.

Example 1

A yebF fusion with 41 amino acids of the RBD, expressed by an attenuated Salmonella VNP20009.

An expression plasmid, pTrc99a, with a YebF, containing an in-frame fusion with a portion of the RBD consisting of 41 amino acids, from a cysteine to a cysteine with added GPK and an added artificial lysine followed by a stop codon.

SEQ ID NO. 005

atggctaaaaaaagaggggcgtttttagggctgttgttggtttc

tgcctgcgcatcagttttcgctgccaataatgaaaccagcaagt

cggtcactttcccaaagtgtgaagatctggatgctgccggaatt

gccgcgagcgtaaaacgtgattatcaacaaaatcgcgtggcgcg

ttgggcagatgatcaaaaaattgtcggtcaggccgatcccgtgg

cttgggtcagtttgcaggacattcagggtaaagatgataaatgg

tcagtaccgctaaccgtgcgtggtaaaagtgccgatattcatta

ccaggtcagcgtggactgcaaagcgggaatggcggaatatcagc

ggcgt
ctcgagGGTactagtGGCGGTGGTGGCAGTtgcTATTTT

CCACTGCAGTOTTATGGCTTTCAGCCGACTAACGGTGTGGGTTA

CCAACCGTACCGTGTGGTTGTACTGTCTTTCGAGCTGCTGCATG

CCCCGGCAACCGTATGCGgCCCGAAGAAATCTtga

An example of a complete pTrc99a plasmid, with the YebF 41aa of RBD, and the ColE3 colicin, immunity and lysis protein:

SEQ ID NO. 006

GTTTGACAGCTTATCATCGACTGCACGGTGCACCAATGCTTCTGGCGTCAGGCAGC

CATCGGAAGCTGTGGTATGGCTGTGCAGGTCGTAAATCACTGCATAATTCGTGTCGCT

CAAGGCGCACTCCCGTTCTGGATAATGTTTTTTGCGCCGACATCATAACGGTTCTGGC

AAATATTCTGAAATGAGCTGTTGACAATTAATCATCCGGCTCGTATAATGTGTGGAAT

TGTGAGCGGATAACAATTTCACACAGGAAACAGA

CC
atggctaaaaaaagaggggcgt

ttttagggctgttgttggtttctgcctgcgcatcagttttcgctgccaataatgaaac

cagcaagtcggtcactttcccaaagtgtgaagatctggatgctgccggaattgccgcg

agcgtaaaacgtgattatcaacaaaatcgcgtggcgcgttgggcagatgatcaaaaaa

ttgtcggtcaggccgatcccgtggcttgggtcagtttgcaggacattcagggtaaaga

tgataaatggtcagtaccgctaaccgtgcgtggtaaaagtgccgatattcattaccag

gtcagcgtggactgcaaagcgggaatggcggaatatcagcggcgtctcgagGGTacta

gtGGCGGTGGTGGCAGTtgcTATTTTCCACTGCAGTCTTATGGCTTTCAGCCGACTAA

CGGTGTGGGTTACCAACCGTACCGTGTGGTTGTACTGTCTTTCGAGCTGCTGCATGCC

CCGGCAACCGTATGCGgCCCGAAGAAATCTtgaTCTAGAGTCGACCTGCAGGCATGCA

AGCTTGGCTGTTTTGGCGGATGAGAGAAGATTTTCAGCCTGATACAGATTAAATCAGA

ACGCAGAAGCGGTCTGATAAAACAGAATTTGCCTGGCGGCAGTAGCGCGGTGGTCCCA

CCTGACCCCATGCCGAACTCAGAAGTGAAACGCCGTAGCGCCGATGGTAGTGTGGGGT

CTCCCCATGCGAGAGTAGGGAACTGCCAGGCATCAAATAAAACGAAAGGCTCAGTCGA

AAGACTGGGCCTTTCGTTTTATCTGTTGTTTGTCGGTGAACGCTCTCCTGAGTAGGAC

AAATCCGCCGGGAGCGGATTTGAACGTTGCGAAGCAACGGCCCGGAGGGTGGCGGGCA

GGACGCCCGCCATAAACTGCCAGGCATCAAATTAAGCAGAAGGCCATCCTGACGGATG

GCCTTTTTGCGTTTCTACAAACTCTTTTTGTTTATTTTTCTAAATACATTCAAATATG

TATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGA

GTATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCT

TCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTG

GGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTT

TTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGC

GGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCT

CAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGA

CAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTT

ACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGG

GATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACG

ACGAGCGTGACACCACGATGCCTACAGCAATGGCAACAACGTTGCGCAAACTATTAAC

TGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGAT

AAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATA

AATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGG

TAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAA

CGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAG

ACCAAGTTTACTCATATATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAG

GATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTT

TCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTT

TTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGT

TTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGA

GCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGA

ACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGC

CAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAG

GCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGA

CCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGA

AGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACG

AGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACC

TCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAA

CGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATG

TTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAG

CTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGAGCGAGGAAGC

GGAAGAGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGc

atatgcccgctctgcgttttctaagtgttatccctcctgatttctaaaaaattttcca

cctgaacTTGACagaaaaaacgatgacgagtactttttgatctgtacataaacccagt

ggttttatgtacagtattaatcgtgtaatcaattgttttaaCgCttaaaagagggaat

ttttatgagcggtggcgatggacgcggccataacacgggcgcgcatagcacaagtggt

aacattaatggtggcccgaccgggcttggtgtaggtggtggtgcttctgatggctccg

gatggagttcggaaaataacccgtggggtggtggttccggtagcggcattcactgggg

tggtggttccggtcatggtaatggcggggggaatggtaattccggtggtggttcggga

acaggcggtaatctgtcagcagtagctgcgccagtggcatttggttttccggcacttt

ccactccaggagctggcggtctggcggtcagtatttcagcgggagcattatcggcagc

tattgctgatattatggctgccctgaaaggaccgtttaaatttggtctttggggggtg

gctttatatggtgtattgccatcacaaatagcgaaagatgaccccaatatgatgtcaa

agattgtgacgtcattacccgcagatgatattactgaatcacctgtcagttcattacc

tctcgataaggcaacagtaaacgtaaatgttcgtgttgttgatgatgtaaaagacgag

cgacagaatatttcggttgtttcaggtgttccgatgagtgttccggtggttgatgcaa

aacctaccgaacgtccgggtgtttttacggcatcaattccaggtgcacctgttctgaa

tatttcagttaataacagtacgccagcagtacagacattaagcccaggtgttacaaat

aatactgataaggatgttcgcccggcaggatttactcagggtggtaataccagggatg

cagttattcgattcccgaaggacagcggtcataatgccgtatatgtttcagtgagtga

tgttcttagccctgaccaggtaaaacaacgtcaagatgaagaaaatcgccgtcagcag

gaatgggatgctacgcatccggttgaagcggctgagcgaaattatgaacgcgcgcgtg

cagagctgaatcaggcaaatgaagatgttgccagaaatcaggagcgacaggctaaagc

tgttcaggtttataattcgcgtaaaagcgaacttgatgcagcgaataaaactcttgct

gatgcaatagctgaaataaaacaatttaatcgatttgcccatgacccaatggctggcg

gtcacagaatgtggcaaatggccgggcttaaagcccagcgggcgcagacggatgtaaa

taataagcaggctgcatttgatgctgctgcaaaagagaagtcagatgctgatgctgca

ttgagttctgctatggaaagcaggaagaagaaagaagataagaaaaggagtgctgaaa

ataatttaaacgatgaaaagaataagcccagaaaaggttttaaagattacgggcatga

ttatcatccagctccgaaaactgagaatattaaagggcttggtgatcttaagcctggg

ataccaaaaacaccaaagcagaatggtggtggaaaacgcaagcgctggactggagata

aagggcgtaagatttatgagtgggattctcagcatggtgagcttgaggggtatcgtgc

cagtgatggtcagcatcttggctcatttgaccctaaaacaggcaatcagttgaaaggt

ccagatccgaaacgaaatatcaagaaatatctttgagaggaagttatgggacttaaat

tggatttaacttggtttgataaaagtacagaagattttaagggtgaggagtattcaaa

agattttggagatgacggttcagttatggaaagtctaggtgtgccttttaaggataat

gttaataacggttgctttgatgttatagctgaatgggtacctttgctacaaccatact

ttaatcatcaaattgatatttccgataatgagtattttgtttcgtttgattatcqTGA

TGGTGATTGGTGAtcaaatattatcagggatgagttgatatacgggcttctagtgttc

atggatgaacgctggagcctccaaatgtagaaatgttatattttttattgagttcttg

gttataattgctccgcaatgatttaaataagcattatttaaaacattctcaggagagg

tgaaggtggagctaaaaaaaagtattggtgattacactgaaaccgaattcaaaaaatt

tattgaagacatcatcaattgtgaaggtgatgaaaaaaaacaggatgataacctcgag

tattttataaatgttactgagcatcctagtggttctgatctgatttattacccagaag

gtaataatgatggtagccctgaaggtgttattaaagagattaaagaatggcgagccgc

taacggtaagtcaggatttaaacagggctgaaatatgaatgccggttgtttatggatg

aatggctggcattctttcacaacaaggagtcgttatgaaaaaaataacagggattatt

ttattgcttcttgcagtcattattctgtctgcatgtcaggcaaactatatccgggatg

ttcagggcgggaccgtatctccgtcatcaacagctgaagtgaccggattagcaacgca

gtaacccgaaatcctctttgacaaaaacaaagcgtgtcaggctGCGGCCGCCCATTGC

TGTGGAAGCTGCCTGCACTAATGTTCCGGCGTTATTTCTTGATGTCTCTGACCAGACA

CCCATCAACAGTATTATTTTCTCCCATGAAGACGGTACGCGACTGGGCGTGGAGCATC

TGGTCGCATTGGGTCACCAGCAAATCGCGCTGTTAGCGGGCCCATTAAGTTCTGTCTC

GGCGCGTCTGCGTCTGGCTGGCTGGCATAAATATCTCACTCGCAATCAAATTCAGCCG

ATAGCGGAACGGGAAGGCGACTGGAGTGCCATGTCCGGTTTTCAACAAACCATGCAAA

TGCTGAATGAGGGCATCGTTCCCACTGCGATGCTGGTTGCCAACGATCAGATGGCGCT

GGGCGCAATGCGCGCCATTACCGAGTCCGGGCTGCGCGTTGGTGCGGATATCTCGGTA

GTGGGATACGACGATACCGAAGACAGCTCATGTTATATCCCGCCGTTAACCACCATCA

AACAGGATTTTCGCCTGCTGGGGCAAACCAGCGTGGACCGCTTGCTGCAACTCTCTCA

GGGCCAGGCGGTGAAGGGCAATCAGCTGTTGCCCGTCTCACTGGTGAAAAGAAAAACC

ACCCTGGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGC

AGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATG

TGAGTTAGCGCGAATTGATCTG

The plasmid may further consist of an adjuvant peptide cloned in-frame into the XhoI and SpeI sites, such as the P28 peptide [122][123], SEQ ID NO 004, or a truncated p28 peptide. [124]

SEQ ID NO. 007

GKQLYNVEATSYA

An example of an alternative peptide adjuvant is a peptide, artificial sequence, containing P28 dimer, separated by a portion of the Vibrio vulnificus flagellin with flexible linkers. [119][125][126]

SEQ ID NO. 008

KFLTTAKDKNRWEDPGKQLYNVEATSYAGGGGSGGGGSGGGGSaqt

aegamnettnilqrmrdislqsangsnskservaiqeeitalndel

nGGGGSGGGGSGGGGSKFLTTAKDKNRWEDPGKQLYNVEATSYA

Example 2

Colicin E3-CA38 Genbank KM287568. [127]

Colicin E3, E3, E8 immunity

SEQ ID NO. 009

catatgcccgctctgcgttttctaagtgttatccctcctgatttctaaaaaattttccac

ctgaacTTGACagaaaaaacgatgacgagtactttttgatctgtacataaacccagtggt

tttatgtacagtattaatcgtgtaatcaattgttttaacgcttaaaagagggaatttttat

gagcggtggcgatggacgcggccataacacgggcgcgcatagcacaagtggtaacatta

atggtggcccgaccgggcttggtgtaggtggtggtgcttctgatggctccggatggagtt

cggaaaataacccgtggggtggtggttccggtagcggcattcactggggtggtggttccg

gtcatggtaatggcggggggaatggtaattccggtggtggttcgggaacaggcggtaatc

tgtcagcagtagctgcgccagtggcatttggttttccggcactttccactccaggagctg

gcggtctggcggtcagtatttcagcgggagcattatcggcagctattgctgatattatgg

ctgccctgaaaggaccgtttaaatttggtctttggggggtggctttatatggtgtattgc

catcacaaatagcgaaagatgaccccaatatgatgtcaaagattgtgacgtcattacccg

cagatgatattactgaatcacctgtcagttcattacctctcgataaggcaacagtaaacg

taaatgttcgtgttgttgatgatgtaaaagacgagcgacagaatatttcggttgtttcag

gtgttccgatgagtgttccggtggttgatgcaaaacctaccgaacgtccgggtgtttttac

ggcatcaattccaggtgcacctgttctgaatatttcagttaataacagtacgccagcag

tacagacattaagcccaggtgttacaaataatactgataaggatgttcgcccggcaggat

ttactcagggtggtaataccagggatgcagttattcgattcccgaaggacagcggtcata

atgccgtatatgtttcagtgagtgatgttcttagccctgaccaggtaaaacaacgtcaag

atgaagaaaatcgccgtcagcaggaatgggatgctacgcatccggttgaagcggctgagc

gaaattatgaacgcgcgcgtgcagagctgaatcaggcaaatgaagatgttgccagaaatc

aggagcgacaggctaaagctgttcaggtttataattcgcgtaaaagcgaacttgatgcag

cgaataaaactcttgctgatgcaatagctgaaataaaacaatttaatcgatttgcccatg

acccaatggctggcggtcacagaatgtggcaaatggccgggcttaaagcccagcgggcgc

agacggatgtaaataataagcaggctgcatttgatgctgctgcaaaagagaagtcagatg

ctgatgctgcattgagttctgctatggaaagcaggaagaagaaagaagataagaaaagga

gtgctgaaaataatttaaacgatgaaaagaataagcccagaaaaggttttaaagattacg

ggcatgattatcatccagctccgaaaactgagaatattaaagggcttggtgatcttaagc

ctgggataccaaaaacaccaaagcagaatggtggtggaaaacgcaagcgctggactggag

ataaagggcgtaagatttatgagtgggattctcagcatggtgagcttgaggggtatcgtg

ccagtgatggtcagcatcttggctcatttgaccctaaaacaggcaatcagttgaaaggtc

cagatccgaaacgaaatatcaagaaatatctttgagaggaagttATGGGACTTAAATTGG

ATTTAACTTGGTTTGATAAAAGTACAGAAGATTTTAAGGGTGAGGAGTATTCAAAAGATT

TTGGAGATGACGGTTCAGTTATGGAAAGTCTAGGTGTGCCTTTTAAGGATAATGTTAATA

ACGGTTGCTTTGATGTTATAGCTGAATGGGTACCTTTGCTACAACCATACTTTAATCATC

AAATTGATATTTCCGATAATGAGTATTTTGTTTCGTTTGATTATCGTGATGGTGATTGGT

GAGCGGCCGCCCATTGCTGTGG

Colicin E3, E3, E8 immunity+lysis

SEQ ID NO. 009

cccgctctgcgttttctaagtgttatccctcctgatttctaaaaaattttccacctgaac

TTGACagaaaaaacgatgacgagtactttttgatctgtacataaacccagtggttttatg

tacagtattaatcgtgtaatcaattgttttaacgcttaaaagagggaatttttatgagcg

gtggcgatggacgcggccataacacgggcgcgcatagcacaagtggtaacattaatggtg

gcccgaccgggcttggtgtaggtggtggtgcttctgatggctccggatggagttcggaaa

ataacccgtggggtggtggttccggtagcggcattcactggggtggtggttccggtcatg

gtaatggcggggggaatggtaattccggtggtggttcgggaacaggcggtaatctgtcag

cagtagctgcgccagtggcatttggttttccggcactttccactccaggagctggcggtc

tggcggtcagtatttcagcgggagcattatcggcagctattgctgatattatggctgccc

tgaaaggaccgtttaaatttggtctttggggggtggctttatatggtgtattgccatcac

aaatagcgaaagatgaccccaatatgatgtcaaagattgtgacgtcattacccgcagatg

atattactgaatcacctgtcagttcattacctctcgataaggcaacagtaaacgtaaatg

ttcgtgttgttgatgatgtaaaagacgagcgacagaatatttcggttgtttcaggtgttc

cgatgagtgttccggtggttgatgcaaaacctaccgaacgtccgggtgtttttacggcat

caattccaggtgcacctgttctgaatatttcagttaataacagtacgccagcagtacaga

cattaagcccaggtgttacaaataatactgataaggatgttcgcccggcaggatttactc

agggtggtaataccagggatgcagttattcgattcccgaaggacagcggtcataatgccg

tatatgtttcagtgagtgatgttcttagccctgaccaggtaaaacaacgtcaagatgaag

aaaatcgccgtcagcaggaatgggatgctacgcatccggttgaagcggctgagcgaaatt

atgaacgcgcgcgtgcagagctgaatcaggcaaatgaagatgttgccagaaatcaggagc

gacaggctaaagctgttcaggtttataattcgcgtaaaagcgaacttgatgcagcgaata

aaactcttgctgatgcaatagctgaaataaaacaatttaatcgatttgcccatgacccaa

tggctggcggtcacagaatgtggcaaatggccgggcttaaagcccagcgggcgcagacgg

atgtaaataataagcaggctgcatttgatgctgctgcaaaagagaagtcagatgctgatg

ctgcattgagttctgctatggaaagcaggaagaagaaagaagataagaaaaggagtgctg

aaaataatttaaacgatgaaaagaataagcccagaaaaggttttaaagattacgggcatg

attatcatccagctccgaaaactgagaatattaaagggcttggtgatcttaagcctggga

taccaaaaacaccaaagcagaatggtggtggaaaacgcaagcgctggactggagataaag

ggcgtaagatttatgagtgggattctcagcatggtgagcttgaggggtatcgtgccagtg

atggtcagcatcttggctcatttgaccctaaaacaggcaatcagttgaaaggtccagatc

cgaaacgaaatatcaagaaatatctttgagaggaagttatgggacttaaattggatttaa

cttggtttgataaaagtacagaagattttaagggtgaggagtattcaaaagattttggag

atgacggttcagttatggaaagtctaggtgtgccttttaaggataatgttaataacggtt

gctttgatgttatagctgaatgggtacctttgctacaaccatactttaatcatcaaattg

atatttccgataatgagtattttgtttcgtttgatt

atcgTGATG
G
TGATTG
G
TGA

tcaa

atattatcagggatgagttgatatacgggcttctagtgttcatggatgaacgctggagcc

tccaaatgtagaaatgttatattttttattgagttcttggttataattgctccgcaatga

tttaaataagcattatttaaaacattctcaggagaggtgaaggtggagctaaaaaaaagt

attggtgattacactgaaaccgaattcaaaaaatttattgaagacatcatcaattgtgaa

ggtgatgaaaaaaaacaggatgataacctcgagtattttataaatgttactgagcatcct

agtggttctgatctgatttattacccagaaggtaataatgatggtagccctgaaggtgtt

attaaagagattaaagaatggcgagccgctaacggtaagtcaggatttaaacagggctga

aatatgaatgccggttgtttatggatgaatggctggcattctttcacaacaaggagtcgt

tatgaaaaaaataacagggattattttattgcttcttgcagtcattattctgtctgcatg

tcaggcaaactatatccgggatgttcagggcgggaccgtatctccgtcatcaacagctga

agtgaccggattagcaacgcagtaacccgaaatcctctttgacaa

aaacaaagcgtgtca

ggct

Wuhan seafood market pneumonia virus isolate Wuhan-Hu-1, complete genome

NCBI Reference Sequence: NC_045512.2 IDC-27DNA

SEQ ID NO. 010

MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLH

STQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKS

NIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHK

NNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKN

IDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALH

RSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALD

PLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFN

ATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCF

TNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNL

DSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYF

PLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCV

NFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDIT

PCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYS

TGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARS

VASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTS

VDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQ

VKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGF

IKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTI

TSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAI

GKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDI

LSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKM

SECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTA

PAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCD

VVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASV

VNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLI

AIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

Wuhan spike protein Receptor Binding Domain (RBD) with 4 additional amino acids

SEQ ID NO. 011

NITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF

KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYK

LPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTE

IYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELL

HAPATVCGPKP

Wang et al., 2004 (Contribution of C3d-P28 repeats to enhancement of immune responses against HBV-preS2/S induced by gene immunization, World J Gastroenterol 10: 2070-2077.

A peptide, artificial sequence, containing P28 dimer, separated by a portion of the Vibrio vulnificus flagellin with flexible linkers. [119][120][121] A

SEQ ID NO. 012

KFLTTAKDKNRWEDPGKQLYNVEATSYAGGGGSGGGGSGGGGSa

qtaegamnettnilqrmrdlslqsangsnskservaiqeeital

ndelnGGGGSGGGGSGGGGSKFLTTAKDKNRWEDPGKQLYNVEA

TSYA

Example 3

A yebF fusion with 38 amino acids of the RBD, expressed by an attenuated Salmonella VNP20009. An expression plasmid, pTrc99a, with a YebF, containing an in-frame fusion with a portion of the RBD consisting of 38 amino acids, from a cysteine to a cysteine.

SEQ ID NO. 013

atggctaaaaaaagaggggcgtttttagggctgttgttggtttctgcc

tgcgcatcagttttcgctgccaataatgaaaccagcaagtcggtcact

ttcccaaagtgtgaagatctggatgctgccggaattgccgcgagcgta

aaacgtgattatcaacaaaatcgcgtggcgcgttgggcagatgatcaa

aaaattgtcggtcaggccgatcccgtggcttgggtcagtttgcaggac

attcagggtaaagatgataaatggtcagtaccgctaaccgtgcgtggt

aaaagtgccgatattcattaccaggtcagcgtggactgcaaagcggga

atggcggaatatcagcggcgtctcgagGGTactagtGGCGGTGGTGGC

AGTtgcTATTTTCCACTGCAGTCTTATGGCTTTCAGCCGACTAACGGT

GTGGGTTACCAACCGTACCGTGTGGTTGTACTGTCTTTCGAGCTGCTG

CATGCCCCGGCAACCGTATGCtaatctaga

The plasmid may further consist of an adjuvant peptide cloned in-frame into the XhoI and SpeI sites. The plasmid may further comprise a colicin expression operon, such as that consisting of colicin E3, E3 immunity, E8 immunity, and E3 lysis protein. The complete sequence of a plasmid is containing a YebF with in-frame fusions of a truncated p28 (p13), a 38 amino acid portion of the spike protein RBD, with co-expression of E3, E3 immunity, E8 immunity, and E3 lysis protein.

SEQ ID NO. 014

GTTTGACAGCTTATCATCGACTGCACGGTGCACCAATGCTTCTGGCGTC

AGGCAGCCATCGGAAGCTGTGGTATGGCTGTGCAGGTCGTAAATCACTG

CATAATTCGTGTCGCTCAAGGCGCACTCCCGTTCTGGATAATGTTTTTT

GCGCCGACATCATAACGGTTCTGGCAAATATTCTGAAATGAGCTGTTGA

CAATTAATCATCCGGCTCGTATAATGTGTGGAATTGTGAGCGGATAACA

ATTTCACACAGGAAACAGACCatggctaaaaaaagaggggcgtttttag

ggctgttgttggtttctgcctgcgcatcagttttcgctgccaataatga

aaccagcaagtcggtcactttcccaaagtgtgaagatctggatgctgcc

ggaattgccgcgagcgtaaaacgtgattatcaacaaaatcgcgtggcgc

gttgggcagatgatcaaaaaattgtcggtcaggccgatcccgtggcttg

ggtcagtttgcaggacattcagggtaaagatgataaatggtcagtaccg

ctaaccgtgcgtggtaaaagtgccgatattcattaccaggtcagcgtgg

actgcaaagcgggaatggcggaatatcagcggcgtctcgagGGCGGTGG

TGGCAGTGGAAAACAATTATACAATGTGGAAGCAACTTCGTACGCAGGC

GGCGGTGGTAGCGGCGGCGGCGGAAGCGGCGGTGGCGGTTCTGGCAAGC

AACTCTACAATGTCGAGGCCACTTCATACGGCGGTGGTGGCAGTactag

tGGCGGTGGTGGCAGTtgcTATTTTCCACTGCAGTCTTATGGCTTTCAG

CCGACTAACGGTGTGGGTTACCAACCGTACCGTGTGGTTGTACTGTCTT

TCGAGCTGCTGCATGCCCCGGCAACCGTATGCtaatctagaGTCGACCT

GCAGGCATGCAAGCTTGGCTGTTTTGGCGGATGAGAGAAGATTTTCAGC

CTGATACAGATTAAATCAGAACGCAGAAGCGGTCTGATAAAACAGAATT

TGCCTGGCGGCAGTAGCGCGGTGGTCCCACCTGACCCCATGCCGAACTC

AGAAGTGAAACGCCGTAGCGCCGATGGTAGTGTGGGGTCTCCCCATGCG

AGAGTAGGGAACTGCCAGGCATCAAATAAAACGAAAGGCTCAGTCGAAA

GACTGGGCCTTTCGTTTTATCTGTTGTTTGTCGGTGAACGCTCTCCTGA

GTAGGACAAATCCGCCGGGAGCGGATTTGAACGTTGCGAAGCAACGGCC

CGGAGGGTGGCGGGCAGGACGCCCGCCATAAACTGCCAGGCATCAAATT

AAGCAGAAGGCCATCCTGACGGATGGCCTTTTTGCGTTTCTACAAACTC

TTTTTGTTTATTTTTCTAAATACATTCAAATATGTATCCGCTCATGAGA

CAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGA

GTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTG

CCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCT

GAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACA

GCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGAT

GAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTGTTGAC

GCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACT

TGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGAC

AGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCG

GCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTT

TTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACC

GGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCT

ACAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTA

CTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGT

TGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCT

GATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCAC

TGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGG

GAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGT

GCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATA

TACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGT

GAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTT

TCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTT

GAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACC

ACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTT

TTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCC

TTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACC

GCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGT

GGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGG

ATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAG

CTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTA

TGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGG

TAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGG

AAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTT

GAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAA

ACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTT

TGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGT

ATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCG

AGCGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCTGATGCGGTA

TTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGCATATGcccgctc

tgcgttttctaagtgttatccctcctgatttctaaaaaattttccacct

gaacTTGACagaaaaaacgatgacgagtactttttgatctgtacataaa

cccagtggrntatgtacagtattaatcgtgtaatcaattgttttaacgc

ttaaaagagggaatttttatgagcggtggcgatggacgcggccataaca

cgggcgcgcatagcacaagtggtaacattaatggtggcccgaccgggct

tggtgtaggtggtggtgcttctgatggctccggatggagttcggaaaat

aacccgtggggtggtggttccggtagcggcattcactggggtggtggtt

ccggtcatggtaatggcggggggaatggtaattccggtggtggttcggg

aacaggcggtaatctgtcagcagtagctgcgccagtggcatttggtttt

ccggcactttccactccaggagctggcggtctggcggtcagtatttcag

cgggagcattatcggcagctattgctgatattatggctgccctgaaagg

accgtttaaatttggtctttggggggtggctttatatggtgtattgcca

tcacaaatagcgaaagatgaccccaatatgatgtcaaagattgtgacgt

cattacccgcagatgatattactgaatcacctgtcagttcattacctct

cgataaggcaacagtaaacgtaaatgttcgtgttgttgatgatgtaaaa

gacgagcgacagaatatttcggttgtttcaggtgttccgatgagtgttc

cggtggttgatgcaaaacctaccgaacgtccgggtgtttttacggcatc

aattccaggtgcacctgttctgaatatttcagttaataacagtacgcca

gcagtacagacattaagcccaggtgttacaaataatactgataaggatg

ttcgcccggcaggatttactcagggtggtaataccagggatgcagttat

tcgattcccgaaggacagcggtcataatgccgtatatgtttcagtgagt

gatgttcttagccctgaccaggtaaaacaacgtcaagatgaagaaaatc

gccgtcagcaggaatgggatgctacgcatccggttgaagcggctgagcg

aaattatgaacgcgcgcgtgcagagctgaatcaggcaaatgaagatgtt

gccagaaatcaggagcgacaggctaaagctgttcaggtttataattcgc

gtaaaagcgaacttgatgcagcgaataaaactcttgctgatgcaatagc

tgaaataaaacaatttaatcgatttgcccatgacccaatggctggcggt

cacagaatgtggcaaatggccgggcttaaagcccagcgggcgcagacgg

atgtaaataataagcaggctgcatttgatgctgctgcaaaagagaagtc

agatgctgatgctgcattgagttctgctatggaaagcaggaagaagaaa

gaagataagaaaaggagtgctgaaaataatttaaacgatgaaaagaata

agcccagaaaaggttttaaagattacgggcatgattatcatccagctcc

gaaaactgagaatattaaagggcttggtgatcttaagcctgggatacca

aaaacaccaaagcagaatggtggtggaaaacgcaagcgctggactggag

ataaagggcgtaagatttatgagtgggattctcagcatggtgagcttga

ggggtatcgtgccagtgatggtcagcatcttggctcatttgaccctaaa

acaggcaatcagttgaaaggtccagatccgaaacgaaatatcaagaaat

atctttgagaggaagttatgggacttaaattggatttaacttggtttga

taaaagtacagaagattttaagggtgaggagtattcaaaagattttgga

gatgacggttcagttatggaaagtctaggtgtgccttttaaggataatg

ttaataacggttgctttgatgttatagctgaatgggtacctttgctaca

accatactttaatcatcaaattgatatttccgataatgagtattttgtt

tcgtttgattatcgTGATGGTGATTGGTGAtcaaatattatcagggatg

agttgatatacgggcttctagtgttcatggatgaacgctggagcctcca

aatgtagaaatgttatattttttattgagttcttggttataattgctcc

gcaatgatttaaataagcattatttaaaacattctcaggagaggtgaag

gtggagctaaaaaaaagtattggtgattacactgaaaccgaattcaaaa

aatttattgaagacatcatcaattgtgaaggtgatgaaaaaaaacagga

tgataacctcgagtattttataaatgttactgagcatcctagtggttct

gatctgatttattacccagaaggtaataatgatggtagccctgaaggtg

ttattaaagagattaaagaatggcgagccgctaacggtaagtcaggatt

taaacagggctgaaatatgaatgccggttgtttatggatgaatggctgg

cattctttcacaacaaggagtcgttatgaaaaaaataacagggattatt

ttattgcttcttgcagtcattattctgtctgcatgtcaggcaaactata

tccgggatgttcagggcgggaccgtatctccgtcatcaacagctgaagt

gaccggattagcaacgcagtaacccgaaatcctctttgacaaaaacaaa

gcgtgtcaggctGCGGCCGCCCATTGCTGIGGAAGCTGCCTGCACTAAT

GTTCCGGCGTTATTTCTTGATGTCTCTGACCAGACACCCATCAACAGTA

TTATTTTCTCCCATGAAGACGGTACGCGACTGGGCGTGGAGCATCTGGT

CGCATTGGGTCACCAGCAAATCGCGCTGTTAGCGGGCCCATTAAGTTCT

GTCTCGGCGCGTCTGCGTCTGGCTGGCTGGCATAAATATCTCACTCGCA

ATCAAATTCAGCCGATAGCGGAACGGGAAGGCGACTGGAGTGCCATGTC

CGGTTTTCAACAAACCATGCAAATGCTGAATGAGGGCATCGTTCCCACT

GCGATGCTGGTTGCCAACGATCAGATGGCGCTGGGCGCAATGCGCGCCA

TTACCGAGTCCGGGCTGCGCGTTGGTGCGGATATCTCGGTAGTGGGATA

CGACGATACCGAAGACAGCTCATGTTATATCCCGCCGTTAACCACCATC

AAACAGGATTTTCGCCTGCTGGGGCAAACCAGCGTGGACCGCTTGCTGC

AACTCTCTCAGGGCCAGGCGGTGAAGGGCAATCAGCTGTTGCCCGTCTC

ACTGGTGAAAAGAAAAACCACCCTGGCGCCCAATACGCAAACCGCCTCT

CCCCGCGCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCC

GACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCGCG

AATTGATCTG

The description of embodiments of the disclosure is not intended to be exhaustive or to limit the disclosure to the precise form disclosed. While specific embodiments of, and examples for, the disclosure are described herein for illustrative purposes, various equivalent modifications are possible within the scope of the disclosure, as those skilled in the relevant art will recognize. For example, while method steps or functions are presented in a given order, alternative embodiments may perform functions in a different order, or functions may be performed substantially concurrently. The teachings of the disclosure provided herein can be applied to other procedures or methods as appropriate. The various embodiments described herein can be combined to provide further embodiments. Aspects of the disclosure can be modified, if necessary, to employ the compositions, functions and concepts of the above references and application to provide yet further embodiments of the disclosure. Moreover, due to biological functional equivalency considerations, some changes can be made in protein structure without affecting the biological or chemical action in kind or amount. These and other changes can be made to the disclosure in light of the detailed description. All such modifications are intended to be included within the scope of the appended claims.

Specific elements of any of the foregoing embodiments can be combined or substituted for elements in other embodiments. Furthermore, while advantages associated with certain embodiments of the disclosure have been described in the context of these embodiments, other embodiments may also exhibit such advantages, and not all embodiments need necessarily exhibit such advantages to fall within the scope of the disclosure.

The technology described herein is further illustrated by the following examples which in no way should be construed as being further limiting.

REFERENCES

Each of the references cited herein is expressly incorporated herein by reference in its entirety.

1. Guan W J, Ni Z Y, Hu Y, Liang W H, Ou C Q, He J X, et al. (April 2020). “Clinical Characteristics of Coronavirus Disease 2019 in China”. The New England Journal of Medicine. Massachusetts Medical Society. 382 (18): 1708-1720. doi:10.1056/nejmoa2002032. PMC 7092819. PMID 32109013.
2. Wei X S, Wang X, Niu Y R, Ye L L, Peng W B, Wang Z H, et al. (26 Feb. 2020). “Clinical Characteristics of SARS-CoV-2 Infected Pneumonia with Diarrhea”. doi:10.2139/ssrn.3546120.
3. Huang C, Wang Y, Li X, Ren L, Zhao J, Hu Y, et al. (February 2020). “Clinical features of patients infected with 2019 novel coronavirus in Wuhan, China”. Lancet. 395 (10223): 497-506. doi:10.1016/S0140-6736(20) 30183-5. PMC 7159299. PMID 31986264.
4. Lai C C, Shih T P, Ko W C, Tang H J, Hsueh P R (March 2020). “Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) and coronavirus disease-2019 (COVID-19): The epidemic and the challenges”. International Journal of Antimicrobial Agents. 55 (3): 105924. doi:10.1016/j.ijantimicag.2020.105924. PMC 7127800. PMID 32081636.
5. To K K, Tsang O T, Chik-Yan Yip C, Chan K H, Wu T C, Chan J M, et al. (February 2020). “Consistent detection of 2019 novel coronavirus in saliva”. Clinical Infectious Diseases. Oxford University Press. doi:10.1093/cid/ciaa149. PMC 7108139. PMID 32047895.
6. Zhu N, Zhang D, Wang W, Li X, Yang B, Song J, et al. (February 2020). “A Novel Coronavirus from Patients with Pneumonia in China, 2019”. The New England Journal of Medicine. 382 (8): 727-733. doi:10.1056/NEJMoa2001017. PMC 7092803. PMID 31978945.
7. Cyranoski D (March 2020). “Mystery deepens over animal source of coronavirus”. Nature. 579 (7797): 18-19. Bibcode:2020Natur.579 . . . 18C. doi:10.1038/d41586-020-00548-w. PMID 32127703.
8. Letko M, Marzi A, Munster V (April 2020). “Functional assessment of cell entry and receptor usage for SARS-CoV-2 and other lineage B betacoronaviruses”. Nature Microbiology. 5 (4): 562-569. doi:10.1038/s41564-020-0688-y. PMC 7095430. PMID 32094589.
9. Zhang H, Penninger J M, Li Y, Zhong N, Slutsky A S (April 2020). “Angiotensin-converting enzyme 2 (ACE2) as a SARS-CoV-2 receptor: molecular mechanisms and potential therapeutic target”. Intensive Care Medicine. 46 (4): 586-590. doi:10.1007/s00134-020-05985-9. PMC 7079879. PMID 32125455.
10. Xu H, Zhong L, Deng J, Peng J, Dan H, Zeng X, et al. (February 2020). “High expression of ACE2 receptor of 2019-nCoV on the epithelial cells of oral mucosa”. International Journal of Oral Science. 12 (1): 8. doi:10.1038/s41368-020-0074-x. PMC 7039956. PMID 32094336.
11. Gurwitz D (March 2020). “Angiotensin receptor blockers as tentative SARS-CoV-2 therapeutics”. Drug Development Research. doi:10.1002/ddr.21656. PMID 32129518.
12. Gu J, Han B, Wang J (May 2020). “COVID-19: Gastrointestinal Manifestations and Potential Fecal-Oral Transmission”. Gastroenterology. 158 (6): 1518-1519. doi:10.1053/j.gastro.2020.02.054. PMC 7130192. PMID 32142785.
13. Hamming I, Timens W, Bulthuis M L, Lely A T, Navis G, van Goor H (June 2004). “Tissue distribution of ACE2 protein, the functional receptor for SARS coronavirus. A first step in understanding SARS pathogenesis”. The Journal of Pathology. 203 (2): 631-7. doi:10.1002/path.1570. PMC 7167720. PMID 15141377.
14. Zheng Y Y, Ma Y T, Zhang J Y, Xie X (May 2020). “COVID-19 and the cardiovascular system”. Nature Reviews. Cardiology. 17(5): 259-260. doi:10.1038/s41569-020-0360-5. PMC 7095524. PMID 32139904.
15. Turner A J, Hiscox J A, Hooper N M (June 2004). “ACE2: from vasopeptidase to SARS virus receptor”. Trends in Pharmacological Sciences. 25 (6): 291-4. doi:10.1016/j.tips.2004.04.001. PMC 7119032. PMID 15165741.
16. Zhang C, Wu Z, Li J W, Zhao H, Wang G Q (March 2020). “The cytokine release syndrome (CRS) of severe COVID-19 and Interleukin-6 receptor (IL-6R) antagonist Tocilizumab may be the key to reduce the mortality”. International Journal of Antimicrobial Agents: 105954. doi:10.1016/j.ijantimicag.2020.105954. PMC 7118634. PMID 32234467.
17. Zhou Y, Fu B, Zheng X, Wang D, Zhao C, Qi Y, et al. (2020). “Aberrant pathogenic GM-CSF+ T cells and inflammatory CD14+CD16+ monocytes in severe pulmonary syndrome patients of a new coronavirus”. bioRxiv Pre-print: 2020.02.12.945576. doi:10.1101/2020.02.12.945576.
18. “BSI open letter to Government on SARS-CoV-2 outbreak response”. immunology.org. British Society for Immunology. Archived from the original on 14 Mar. 2020. Retrieved 15 Mar. 2020.
19. Schraer, Rachel (25 Apr. 2020). “Coronavirus: Immunity passports ‘could increase virus spread’”. Retrieved 26 Apr. 2020.
20. “Can you get coronavirus twice or does it cause immunity?”. The Independent. 13 Mar. 2020. Archived from the original on 14 Mar. 2020. Retrieved 15 Mar. 2020.
21. Politi D (11 Apr. 2020). “WHO Investigating Reports of Coronavirus Patients Testing Positive Again After Recovery”. Slate. Retrieved 11 Apr. 2020.
22. “They survived the coronavirus. Then they tested positive again. Why?”. Los Angeles Times. 13 Mar. 2020. Archived from the original on 14 Mar. 2020. Retrieved 15 Mar. 2020.
23. “14% of Recovered Covid-19 Patients in Guangdong Tested Positive Again”. caixinglobal.com. Caixin Global. Archived from the original on 3 Mar. 2020. Retrieved 15 Mar. 2020.
24. Omer S B, Malani P, Del Rio C (April 2020). “The COVID-19 Pandemic in the US: A Clinical Update”. Jama. doi:10.1001/jama.2020.5788. PMID 32250388.
25. Parry R L (30 Apr. 2020), “Coronavirus patients can't relapse, South Korean scientists believe”, The Times
26. “What if immunity to covid-19 doesn't last?”. MIT Technology Review. Retrieved 1 May 2020.
27. “Direct observation of repeated infections with endemic coronaviruses” (PDF). Columbia University in the City of New York. Department of Environmental Health Sciences, Mailman School of Public Health, Columbia University. 15 Apr. 2020. Retrieved 2 May 2020.
28. Chen W H, Strych U, Hotez P J, Bottazzi M E (March 2020). “The SARS-CoV-2 Vaccine Pipeline: an Overview”. Current Tropical Medicine Reports: 1-4. doi:10.1007/s40475-020-00201-6. PMC 7094941. PMID 32219057.
29. Peeples L (April 2020). “News Feature: Avoiding pitfalls in the pursuit of a COVID-19 vaccine”. Proceedings of the National Academy of Sciences of the United States of America. Proceedings of the National Academy of Sciences. 117 (15): 8218-8221. doi:10.1073/pnas.2005456117. PMC 7165470. PMID 32229574.
30. Yao X, Ye F, Zhang M, Cui C, Huang B, Niu P, et al. (March 2020). “In Vitro Antiviral Activity and Projection of Optimized Dosing Design of Hydroxychloroquine for the Treatment of Severe Acute Respiratory Syndrome Coronavirus 2 (SARS-CoV-2)”. Clinical Infectious Diseases. doi:10.1093/cid/ciaa237. PMC 7108130. PMID 32150618.
31. Liu R, Miller J (3 Mar. 2020). “China approves use of Roche drug in battle against coronavirus complications”. Reuters. Archived from the original on 12 Mar. 2020. Retrieved 14 Mar. 2020.
32. “Effective Treatment of Severe COVID-19 Patients with Tocilizumab”. ChinaXiv.org. 5 Mar. 2020. doi:10.12074/202003.00026 (inactive 26 Apr. 2020). Archived from the original on 19 Mar. 2020. Retrieved 14 Mar. 2020.
33. Ovadia D, Agenzia Z. “COVID-19—Italy launches an independent trial on tocilizumab”. Univadis from Medscape. Aptus Health. Retrieved 22 Apr. 2020.
34. “Tocilizumab in COVID-19 Pneumonia (TOCIVID-19) (TOCIVID-19)”. www.clinicaltrials.gov. National Library of Medicine. Retrieved 22 Apr. 2020.
35. “How doctors can potentially significantly reduce the number of deaths from Covid-19”. Vox. 12 Mar. 2020. Archived from the original on 19 Mar. 2020. Retrieved 14 Mar. 2020.
36. Ruan Q, Yang K, Wang W, Jiang L, Song J (March 2020). “Clinical predictors of mortality due to COVID-19 based on an analysis of data of 150 patients from Wuhan, China”. Intensive Care Medicine. doi:10.1007/s00134-020-05991-x. PMC 7080116. PMID 32125452.
37. Mehta P, McAuley D F, Brown M, Sanchez E, Tattersall R S, Manson J J (March 2020). “COVID-19: consider cytokine storm syndromes and immunosuppression”. Lancet. 395 (10229): 1033-1034. doi:10.1016/S0140-6736(20) 30628-0. PMID 32192578.
38. Slater H (26 Mar. 2020). “FDA Approves Phase III Clinical Trial of Tocilizumab for COVID-19 Pneumonia”. www.cancernetwork.com. Cancer Network. Retrieved 22 Apr. 2020.
39. Sterner R M, Sakemura R, Cox M J, Yang N, Khadka R H, Forsman C L, et al. (February 2019). “GM-CSF inhibition reduces cytokine release syndrome and neuroinflammation but enhances CAR-T cell function in xenografts”. Blood. 133 (7): 697-709. doi:10.1182/blood-2018-10-881722. PMC 6376281. PMID 30463995.
40. “Northwell Health Initiates Clinical Trials of 2 COVID-19 Drugs”. 21 Mar. 2020. Archived from the original on 23 Mar. 2020. Retrieved 23 Mar. 2020.
41. Casadevall A, Pirofski L A (April 2020). “The convalescent sera option for containing COVID-19”. The Journal of Clinical Investigation. 130 (4): 1545-1548. doi:10.1172/JC1138003. PMC 7108922. PMID 32167489.
42. Pearce K (13 Mar. 2020). “Antibodies from COVID-19 survivors could be used to treat patients, protect those at risk: Infusions of antibody-laden blood have been used with reported success in prior outbreaks, including the SARS epidemic and the 1918 flu pandemic”. The Hub at Johns Hopkins University. Archived from the original on 14 Mar. 2020. Retrieved 14 Mar. 2020.
42. Wu F, Zhao S, Yu B, Chen Y M, Wang W, Song Z G, et al. A new coronavirus associated with human respiratory disease in China. Nature [Preprint]. 2020 [cited 2020 Feb. 16]: [19 p.]. Available from: doi.org/10.1038/s41586-020-2008-3.
43. Lu R, Zhao X, Li J, Niu P, Yang B, Wu H, et al. Genomic characterisation and epidemiology of 2019 novel coronavirus: implications for virus origins and receptor binding. Lancet. 2020; 395:565-74.
44. Hoffmann M K-W H, Krüger N, Müller M, Drosten C, Pöhlmann S. The novel coronavirus 2019 (2019-nCoV) uses the SARS-coronavirus receptor ACE2 and the cellular protease TMPRSS2 for entry into target cells. bioRxiv [Preprint]. 2020 [cited 2020 Feb. 16]: [23 p.]. Available from: www.biorxiv.org/content/10.1101/2020.01.31.929042v1
45. Zhou P, Yang X L, Wang X G, Hu B, Zhang L, Zhang W, et al. A pneumonia outbreak associated with a new coronavirus of probable bat origin. Nature [Preprint]. 2020 [cited 2020 Feb. 15]: [15 p.]. Available from: doi. org/10.1038/s41586-020-2012-7
46. Huang C, Wang Y, Li X, Ren L, Zhao J, Hu Y, et al. Clinical features of patients infected with 2019 novel coronavirus in Wuhan, China. Lancet. 2020; 395:497-506.
47. Mahallawi W H, Khabour O F, Zhang Q, Makhdoum H M, Suliman B A. MERS-CoV infection in humans is associated with a pro-inflammatory Th1 and Th17 cytokine profile. Cytokine. 2018; 104:8-13.
48. Wong C K, Lam C W, Wu A K, Ip W K, Lee N L, Chan I H, et al. Plasma inflammatory cytokines and chemokines in severe acute respiratory syndrome. Clin Exp Immunol. 2004; 136:95-103.
49. Perlman S, Dandekar A A. Immunopathogenesis of coronavirus infections: implications for SARS. Nat Rev Immunol. 2005; 5(12):917-27.
50. Zhu N, Zhang D, Wang W, Li X, Yang B, Song J, et al. A Novel Coronavirus from Patients with Pneumonia in China, 2019. N Engl J Med. 2020; 382:727-33.
51. de Wit E, van Doremalen N, Falzarano D, Munster V J. SARS and MERS: recent insights into emerging coronaviruses. Nat Rev Microbiol. 2016; 14: 523-34.
52. Kindler E, Thiel V, Weber F. Interaction of SARS and MERS Coronaviruses with the Antiviral Interferon Response. Adv Virus Res. 2016; 96:219-43.
53. Perlman S, Dandekar A A. Immunopathogenesis of coronavirus infections: implications for SARS. Nat Rev Immunol. 2005; 5(12):917-27.
54. Zumla A, Hui D S, Perlman S. Middle East respiratory syndrome. Lancet. 2015; 386:995-1007.
55. Channappanavar R, Perlman S. Pathogenic human coronavirus infections: causes and consequences of cytokine storm and immunopathology. Semin Immunopathol. 2017; 39:529-39.
56. Liu W J, Zhao M, Liu K, Xu K, Wong G, Tan W, et al. T-cell immunity of SARS-CoV: Implications for vaccine development against MERS-CoV. Antiviral Res. 2017; 137:82-92.
57. Liu W, Fontanet A, Zhang P H, Zhan L, Xin Z T, Baril L, et al. Two-year prospective study of the humoral immune response of patients with severe acute respiratory syndrome. J Infect Dis. 2006; 193:792-5.
58. Li CK, Wu H, Yan H, Ma S, Wang L, Zhang M, et al. T cell responses to whole SARS coronavirus in humans. J Immunol. 2008; 181:5490-500.
59. Shin H S, Kim Y, Kim G, Lee J Y, Jeong I, Joh J S, et al. Immune Responses to Middle East Respiratory Syndrome Coronavirus During the Acute and Convalescent Phases of Human Infection. Clin Infect Dis. 2019; 68: 984-92.
60. Zhao J, Zhao J, Mangalam A K, Channappanavar R, Fett C, Meyerholz D K, et al. Airway Memory CD4(+) T Cells Mediate Protective Immunity against Emerging Respiratory Coronaviruses. Immunity. 2016; 44:1379-91.
61. Shokri S, Mahmoudvand S, Taherkhani R, Farshadpour F. Modulation of the immune response by Middle East respiratory syndrome coronavirus. J Cell Physiol. 2019; 234:2143-51.
62. Kikkert M. Innate Immune Evasion by Human Respiratory RNA Viruses. J Innate Immun. 2020; 12:4-20.
63. Faure E, Poissy J, Goffard A, Fournier C, Kipnis E, Titecat M, et al. Distinct immune response in two MERS-CoV-infected patients: can we go from bench to bedside? PLoS One. 2014; 9:e88716.
64. Al-Amri S S, Abbas A T, Siddiq L A, Alghamdi A, Sanki M A, Al-Muhanna M K, et al. Immunogenicity of Candidate MERS-CoV DNA Vaccines Based on the Spike Protein. Sci Rep. 2017; 7:44875.
65. Du L, He Y, Zhou Y, Liu S, Zheng B J, Jiang S. The spike protein of SARS-CoV—a target for vaccine and therapeutic development. Nat Rev Microbiol. 2009; 7:226-36.
66. Du L, Zhao G, He Y, Guo Y, Zheng B J, Jiang S, et al. Receptor-binding domain of SARS-CoV spike protein induces long-term protective immunity in an animal model. Vaccine. 2007; 25:2832-8.
67. Tebas P, Roberts C C, Muthumani K, Reuschel E L, Kudchodkar S B, Zaidi F I, et al. Safety and Immunogenicity of an Anti-Zika Virus DNA Vaccine Preliminary Report. N Engl J Med [Preprint]. 2017[cited 2020 Feb. 10]:[16 p.]. Available from: doi.org/10.1056/NEJMoa1708120
68. Pardi N, Hogan M J, Porter F W, Weissman D. mRNA vaccines a new era in vaccinology. Nat Rev Drug Discov. 2018; 17:261-79.
69. Maruggi G, Zhang C, Li J, Ulmer J B, Yu D. mRNA as a Transformative Technology for Vaccine Development to Control Infectious Diseases. Mol Ther. 2019; 27:757-72.
70. Zhou, P.; Yang, X.-L.; Wang, X.-G.; Hu, B.; Zhang, L.; Zhang, W.; Si, H.-R.; Zhu, Y.; Li, B.; Huang, C.-L.; et al. A pneumonia outbreak associated with a new coronavirus of probable bat origin. Nature 2020.
71. Lu, R.; Zhao, X.; Li, J.; Niu, P.; Yang, B.; Wu, H.; Wang, W.; Song, H.; Huang,
B.; Zhu, N.; et al. Genomic characterisation and epidemiology of 2019 novel coronavirus: Implications for virus origins and receptor binding. Lancet 2020, 6736, 1-10.
72. Letko, M.; Munster, V. Functional assessment of cell entry and receptor usage for lineage B β-coronaviruses, including 2019-nCoV. bioRxiv 2020, 2020.01.22.915660.
73. Hoffmann, M.; Kleine-Weber, H.; Kruger, N.; Muller, M.; Drosten, C.; Pohlmann, S. The novel coronavirus 2019 (2019-nCoV) uses the SARS-coronavirus receptor ACE2 and the cellular protease TMPRSS2 for entry into target cells. bioRxiv 2020, 2020.01.31.929042.
74. Yang, Z.-Y.; Kong, W.-P.; Huang, Y.; Roberts, A.; Murphy, B. R.; Subbarao, K.; Nabel, G. J. A DNA vaccine induces SARS coronavirus neutralization and protective immunity in mice. Nature 2004, 428, 561-564.
75. Deming, D.; Sheahan, T.; Heise, M.; Yount, B.; Davis, N.; Sims, A.; Suthar, M.; Harkema, J.; Whitmore, A.; Pickles, R.; et al. Vaccine efficacy in senescent mice challenged with recombinant SARS-CoV bearing epidemic and zoonotic spike variants. PLoS Med. 2006, 3, e525.
76. Graham, R. L.; Becker, M. M.; Eckerle, L. D.; Bolles, M.; Denison, M. R.; Baric, R. S. A live, impaired-fidelity coronavirus vaccine protects in an aged, immunocompromised mouse model of lethal disease. Nat. Med. 2012, 18, 1820-1826.
77. Lin, Y.; Shen, X.; Yang, R. F.; Li, Y. X.; Ji, Y. Y.; He, Y. Y.; De Shi, M.; Lu, W.; Shi, T. L.; Wang, J.; et al. Identification of an epitope of SARS-coronavirus nucleocapsid protein. Cell Res. 2003, 13, 141-145.
78. Wang, J.; Wen, J.; Li, J.; Yin, J.; Zhu, Q.; Wang, H.; Yang, Y.; Qin, E.; You, B.; Li, W.; et al. Assessment of immunoreactive synthetic peptides from the structural proteins of severe acute respiratory syndrome coronavirus. Clin. Chem. 2003, 49, 1989-1996.
79. Liu, X.; Shi, Y.; Li, P.; Li, L.; Yi, Y.; Ma, Q.; Cao, C. Profile of antibodies to the nucleocapsid protein of the severe acute respiratory syndrome (SARS)-associated coronavirus in probable SARS patients. Clin. Vaccine Immunol. 2004, 11, 227-228.
80. Tang, F.; Quan, Y.; Xin, Z.-T.; Wrammert, J.; Ma, M.-J.; Lv, H.; Wang, T.-B.; Yang, H.; Richardus, J. H.; Liu, W.; et al. Lack of peripheral memory B cell responses in recovered patients with severe acute respiratory syndrome: A six-year follow-up study. J. Immunol. 2011, 186, 7264-7268.
81. Peng, H.; Yang, L.-T.; Wang, L.-Y.; Li, J.; Huang, J.; Lu, Z.-Q.; Koup, R. A.; Bailer, R. T.; Wu, C.-Y. Long-lived memory T lymphocyte responses against SARS coronavirus nucleocapsid protein in SARS-recovered patients. Virology 2006, 351, 466-475.
82. Fan, Y.-Y.; Huang, Z.-T.; Li, L.; Wu, M.-H.; Yu, T.; Koup, R. A.; Bailer, R. T.; Wu, C.-Y. Characterization of SARS-CoV-specific memory T cells from recovered individuals 4 years after infection. Arch. Virol. 2009, 154, 1093-1099.
83. Prompetchara, Eakachai, Chutitorn Ketloy, and Tanapat Palaga. “Immune responses in COVID-19 and potential vaccines: Lessons learned from SARS and MERS epidemic.” Asian Pac J Allergy Immunol 38, no. 1 (2020): 1-9.
84. Ahmed, Syed Faraz, Ahmed A. Quadeer, and Matthew R. McKay. “Preliminary identification of potential vaccine targets for the COVID-19 coronavirus (SARS-CoV-2) based on SARS-CoV immunological studies.” Viruses 12, no. 3 (2020): 254.
85. Ibarra J A, Steele-Mortimer O. 2009. Salmonella—the ultimate insider. Salmonella virulence factors that modulate intracellular survival. Cell Microbiol 11:1579-1586.
86. Haraga A, Ohlson M B, Miller S I. Salmonellae interplay with host cells. Nature reviews Microbiology. 2008; 6(1):53-66. 10.1038/nrmicrol788
87. Gerlach R G, Hensel M. Salmonella pathogenicity islands in host specificity, host pathogen-interactions and antibiotics resistance of Salmonella enterica. Berliner und Munchener tierarztliche Wochenschrift. 2007; 120(7-8):317-27.
88. Lee A K, Detweiler C S, Falkow S. OmpR regulates the two-component system SsrA-ssrB in Salmonella pathogenicity island 2. Journal of bacteriology. 2000; 182(3):771-81. 10.1128/jb.182.3.771-781.2000
89. Panthel K, Meinel K M, Sevil Domenech V E, Trulzsch K, Russmann H. Salmonella type III-mediated heterologous antigen delivery: a versatile oral vaccination strategy to induce cellular immunity against infectious agents and tumors. International journal of medical microbiology: IJMM. 2008; 298(1-2):99-103. 10.1016/j.ijmm.2007.07.002
90. Xiong G, Husseiny M I, Song L, Erdreich-Epstein A, Shackleford G M, Seeger R C, et al. Novel cancer vaccine based on genes of Salmonella pathogenicity island 2. International journal of cancer. 2010; 126(11):2622-34. 10.1002/ijc.24957
91. Galen J E, Buskirk A D, Tennant S M, Pasetti M F, “Live Attenuated Human Salmonella Vaccine Candidates: Tracking the Pathogen in Natural Infection and Stimulation of Host Immunity”, EcoSal Plus. 2016 November; 7(1). doi: 10.1128/ecosalplus.ESP-0010-2016.
92. Clark-Curtiss J E, Curtiss R. 2018. Salmonella Vaccines: Conduits for Protective Antigens. Journal of immunology (Baltimore, Md.: 1950) 200:39-48
93. Galen J E, Buskirk A D, Tennant S M, Pasetti M F. 2016. Live Attenuated Human Salmonella Vaccine Candidates: Tracking the Pathogen in Natural Infection and Stimulation of Host Immunity. EcoSal Plus 7
94. Clairmont C, Lee K C, Pike J, Ittensohn M, Low K B, Pawelek J, Bermudes D, Brecher S M, Margitich D, Turnier J, Li Z, Luo X, King I, Zheng L M. 2000. Biodistribution and genetic stability of the novel antitumor agent VNP20009, a genetically modified strain of Salmonella typhimurium. The Journal of infectious diseases 181:1996-2002.
95. Bolhassani, Azam, and Farnaz Zahedifard. “Therapeutic live vaccines as a potential anticancer strategy.” International journal of cancer 131, no. 8 (2012): 1733-1743.
96. Medina, Eva, and Carlos Alberto Guzmin. “Use of live bacterial vaccine vectors for antigen delivery: potential and limitations.” Vaccine 19, no. 13-14 (2001): 1573-1580.
97. Seegers, Jos F M L. “Lactobacilli as live vaccine delivery vectors: progress and prospects.” Trends in biotechnology 20, no. 12 (2002): 508-515.
98. Shams, Homayoun. “Recent developments in veterinary vaccinology.” The veterinary journal 170, no. 3 (2005): 289-299; Kang, Ho Young, Jay Srinivasan, and Roy Curtiss. “Immune responses to recombinant pneumococcal PspA antigen delivered by live attenuated Salmonella enterica serovar Typhimurium vaccine.” Infection and immunity 70, no. 4 (2002): 1739-1749.
99. Cardenas, Lucia, and J. D. Clements. “Oral immunization using live attenuated Salmonella spp. as carriers of foreign antigens.” Clinical microbiology reviews 5, no. 3 (1992): 328-342.
100. Buckley, Anthony M., Jinhong Wang, Debra L. Hudson, Andrew J. Grant, Michael A. Jones, Duncan J. Maskell, and Mark P. Stevens. “Evaluation of live-attenuated Salmonella vaccines expressing Campylobacter antigens for control of C. jejuni in poultry.” Vaccine 28, no. 4 (2010): 1094-1105.
101. Dougan, G., C. E. Hormaeche, and D. J. Maskell. “Live oral Salmonella vaccines: potential use of attenuated strains as carriers of heterologous antigens to the immune system.” Parasite immunology 9, no. 2 (1987): 151-160.
102. Mastroeni, Pietro, Bernardo Villarreal-Ramos, and Carlos E. Hormaeche. “Role of T cells, TNFα and IFNγ in recall of immunity to oral challenge with virulent salmonellae in mice vaccinated with live attenuated aro-salmonella vaccines.” Microbial pathogenesis 13, no. 6 (1992): 477-491
103. Galen, James E., Oscar G. Gomez-Duarte, Genevieve A. Losonsky, Jane L. Halpern, Carol S. Lauderbaugh, Shevon Kaintuck, Mardi K. Reymann, and Myron M. Levine. “A murine model of intranasal immunization to assess the immunogenicity of attenuated Salmonella typhi live vector vaccines in stimulating serum antibody responses to expressed foreign antigens.” Vaccine 15, no. 6-7 (1997): 700-708.
104. Shahabi, Vafa, Paulo C. Maciag, Sandra Rivera, and Anu Wallecha. “Live, attenuated strains of Listeria and Salmonella as vaccine vectors in cancer treatment.” Bioengineered bugs 1, no. 4 (2010): 237-245.
105. Fraillery, Dominique, David Baud, Susana Yuk-Ying Pang, John Schiller, Martine Bobst, Nathalie Zosso, Frangoise Ponci, and Denise Nardelli-Haefliger. “Salmonella enterica serovar Typhi Ty21a expressing human papillomavirus type 16 L1 as a potential live vaccine against cervical cancer and typhoid fever.” Clin. Vaccine Immunol. 14, no. 10 (2007): 1285-1295.
106. Paterson, Yvonne, Patrick D. Guirnalda, and Laurence M. Wood. “Listeria and Salmonella bacterial vectors of tumor-associated antigens for cancer immunotherapy.” In Seminars in immunology, vol. 22, no. 3, pp. 183-189. Academic Press, 2010.
107. Wieckowski, Sébastien, Lilli Podola, Marco Springer, Iris Kobl, Zina Koob, Caroline Mignard, Amine Adda Berkane et al. “Immunogenicity and antitumor efficacy of live attenuated Salmonella typhimurium-based oral T-cell vaccines VXMO1m, VXM04m and VXM06m.” (2017): 4558-4558.
108. Wieckowski, Sébastien, Lilli Podola, Marco Springer, Iris Kobl, Zina Koob, Caroline Mignard, Alan Broadmeadow et al. “Non-clinical safety, immunogenicity and antitumor efficacy of live attenuated Salmonella Typhimurium-based oral T-cell vaccines VXMOlm, VXM04m and VXM06m.” In Molecular Therapy, vol. 25, no. 5, pp. 360-360. 50 Hampshire St, Floor 5, Cambridge, Mass. 02139 USA: Cell Press, 2017.
109. Wieckowski, Sébastien, Lilli Podola, Heiko Smetak, Anne-Lucie Nugues, Philippe Slos, Amine Adda Berkane, Ming Wei et al. “Modulating T cell immunity in tumors by targeting PD-L1 and neoantigens using a live attenuated oral Salmonella platform.” (2018): 733-733
110. Vendrell, Alejandrina, Claudia Mongini, María José Gravisaco, Andrea Canellada, Agustina Inés Tesone, Juan Carlos Goin, and Claudia Inés Waldner. “An oral salmonella-based vaccine inhibits liver metastases by promoting tumor-specific T-cell-mediated immunity in celiac and portal lymph nodes: a preclinical study.” Frontiers in Immunology 7 (2016): 72.)
111. Xiong G, Husseiny M I, Song L, Erdreich-Epstein A, Shackleford G M, Seeger R C, et al. Novel cancer vaccine based on genes of Salmonella pathogenicity island 2. International journal of cancer. 2010; 126(11):2622-34.
112. Toso J F, Gill V J, Hwu P, Marincola F M, Restifo N P, Schwartzentruber D J, Sherry R M, Topalian S L, Yang J C, Stock F, Freezer L J, Morton K E, Seipp C, Haworth L, Mavroukakis S, White D, MacDonald S, Mao J, Sznol M, Rosenberg S A. 2002. Phase I study of the intravenous administration of attenuated Salmonella typhimurium to patients with metastatic melanoma. Journal of clinical oncology: official journal of the American Society of Clinical Oncology 20:142-152.
113. Cascales, Eric, Susan K. Buchanan, Denis Duch6, Colin Kleanthous, Roland Lloubes, Kathleen Postle, Margaret Riley, Stephen Slatin, and Daniele Cavard. “Colicin biology.” Microbiol. Mol. Biol. Rev. 71, no. 1 (2007): 158-229.
114. Feldgarden M, Riley M A (1999). “The phenotypic and fitness effects of colicin resistance in Escherichia coli K-12”. Evolution. 53 (4): 1019-27. doi:10.2307/2640807. JSTOR 2640807.
115. Kang C, Postle K, Chen G, Park H, Youn B, Hilsenbeck J L (2004). “Crystal structure of the cytotoxic bacterial protein colicin B at 2.5 A resolution”. Mol. Microbiol. 51 (3): 711-20. doi:10.1111/j.1365-2958.2003.03884.x. PMID 14731273.
116. Cramer W A, Zakharov S D, Antonenko Y N, Kotova E A (2004). “On the role of lipid in colicin pore formation”. Biochim. Biophys. Acta. 1666 (1): 239-49. doi:10.1016/j.bbamem.2004.07.001. PMID 15519318.
117. Cao Z, Klebba P E (2002). “Mechanisms of colicin binding and transport through outer membrane porins”. Biochimie. 84 (5-6): 399-412. doi:10.1016/S0300-9084(02)01455-4. PMID 12423783.
118. van den Elzen P J, Veltkamp E, Nijkamp H J, Walters H H (1983). “Molecular structure and function of the bacteriocin gene and bacteriocin protein of plasmid Clo DF13”. Nucleic Acids Res. 11 (8): 2465-2477. doi:10.1093/nar/11.8.2465. PMC 325896. PMID 6344017.
119. Song et al., A conserved TLR5 binding and activation hot spot on flagellin, Scientific Reports 7, Article number: 40878 (2017).
120. Lei et al., Application of built-in adjuvants for epitope-based vaccines. PeerJ 2019 Jan. 14; 6:e6185. doi: 10.7717/peerj.6185 (2018).
121. Mizel and Bates, Flagellin as an adjuvant: Cellular Mechanisms and Potential, J Immunol. 2010 Nov. 15; 185(10): 5677-5682. doi:10.4049/jimmunol.1002156.
122. Servis and Lambris, C3 synthetic peptides support growth of human Cr2-positive lymphoblastoid B cells. J Immunol 142: 2207-2212 (1989).
123. Wang et al., Contribution of C3d-P28 repeats to enhancement of immune responses against HBV-preS2/S induced by gene immunization, World J Gastroenterol 10: 2070-2077 (2004).
124. de Groot et al. 2015 Immunol Cell Biol 93: 189-197. doi:10.1038/icb.2014.89.
125. Lei et al., Application of built-in adjuvants for epitope-based vaccines. PeerJ 2019 Jan. 14; 6:e6185. doi: 10.7717/peerj.6185 (2018).
126. Mizel and Bates, Flagellin as an adjuvant: Cellular Mechanisms and Potential, J Immunol. 2010 Nov. 15; 185(10): 5677-5682. doi:10.4049/jimmunol.1002156 (2010).
127. Morales et al., Accumulation of single-stranded DNA in Escherichia coli carrying the colicin plasmid pColE3-CA3, Plasmid 77: 7-16 (2014).
128. Quintero et al., 2018, Co-expression of a chimeric protease inhibitor secreted by a tumor-targeted Salmonella protects therapeutic proteins from proteolytic degradation, J Microbiol Biotechnol 2018 Dec. 28; 28(12):2079-2094. doi: 10.4014/jmb.1807.08036.
129. Amdekar, Sarika, Deepak Dwivedi, Purabi Roy, Sapna Kushwah, and Vinod Singh. “Probiotics: multifarious oral vaccine against infectious traumas.” FEMS Immunology & Medical Microbiology 58, no. 3 (2010): 299-306.
130. Arnold, Heinz, Dirk Burann, Melanie Felies, Britta Gewecke, Meike Sörensen, J. Engelbert Gessner, Joachim Freihorst, Bernd Ulrich Von Specht, and Ulrich Baumann. “Enhanced immunogenicity in the murine airway mucosa with an attenuated Salmonella live vaccine expressing OprF-OprI from Pseudomonas aeruginosa.” Infection and immunity 72, no. 11 (2004): 6546-6553.
131. Baud, David, Françoise Ponci, Martine Bobst, Pierre De Grandi, and Denise Nardelli-Haefliger. “Improved efficiency of a Salmonella-based vaccine against human papillomavirus type 16 virus-like particles achieved by using a codon-optimized version of L1.” Journal of virology 78, no. 23 (2004): 12901-12909.
132. Bermúdez-Humarán, Luis G. “Lactococcus lactis as a live vector for mucosal delivery of therapeutic proteins.” Human vaccines 5, no. 4 (2009): 264-267.
133. Blisnick, Thierry, Patrick Ave, Michel Huerre, Elisabeth Carniel, and Christian E. Demeure. “Oral vaccination against bubonic plague using a live avirulent Yersinia pseudotuberculosis strain.” Infection and immunity 76, no. 8 (2008): 3808-3816.
134. Bolhassani, Azam, and Farnaz Zahedifard. “Therapeutic live vaccines as a potential anticancer strategy.” International journal of cancer 131, no. 8 (2012): 1733-1743.
135. Branger, Christine G., Roy Curtiss III, Robert D. Perry, and Jacqueline D. Fetherston. “Oral vaccination with different antigens from Yersinia pestis KIM delivered by live attenuated Salmonella typhimurium elicits a protective immune response against plague.” In The Genus Yersinia, pp. 387-399. Springer, New York, N.Y., 2007.
136. Bruhn, Kevin W., Noah Craft, and Jeff F. Miller. “Listeria as a vaccine vector.” Microbes and infection 9, no. 10 (2007): 1226-1235.
137. Bumann, Dirk. “In vivo visualization of bacterial colonization, antigen expression, and specific T-cell induction following oral administration of live recombinant Salmonella enterica serovar Typhimurium.” Infection and immunity 69, no. 7 (2001): 4618-4626.
138. Cardenas, Lucia, and J. D. Clements. “Oral immunization using live attenuated Salmonella spp. as carriers of foreign antigens.” Clinical microbiology reviews 5, no. 3 (1992): 328-342.
139. Chabalgoity, José A., Gordon Dougan, Pietro Mastroeni, and Richard J. Aspinall. “Live bacteria as the basis for immunotherapies against cancer.” Expert review of vaccines1, no. 4 (2002): 495-505.
140. Cheminay, Cédric, Annette Möhlenbrink, and Michael Hensel. “Intracellular Salmonella inhibit antigen presentation by dendritic cells.” The Journal of Immunology 174, no. 5 (2005):2892-2899.
141. Chen G, Dai Y, Chen J, Wang X, Tang B, Zhu Y, et al. Oral delivery of the Sj23LHD-GST antigen by Salmonella typhimurium type III secretion system protects against Schistosoma japonicum infection in mice. PLoS neglected tropical diseases. 2011; 5(9):e1313.
142. Chen, Inês, Theresa M. Finn, Liu Yanqing, Qi Guoming, Rino Rappuoli, and Mariagrazia Pizza. “A Recombinant Live Attenuated Strain of Vibrio cholerae Induces Immunity against Tetanus Toxin and Bordetella pertussis Tracheal Colonization Factor.” Infection and immunity 66, no. 4 (1998): 1648-1653.
143. Clairmont C, Lee K C, Pike J, Ittensohn M, Low K B, Pawelek J, Bermudes D, Brecher S M, Margitich D, Turnier J, Li Z, Luo X, King I, Zheng L M. 2000. Biodistribution and genetic stability of the novel antitumor agent VNP20009, a genetically modified strain of Salmonella typhimurium. The Journal of infectious diseases 181:1996-2002.
144. Clark-Curtiss, J. E. & Curtiss, R. Salmonella Vaccines: Conduits for Protective Antigens. Journal of immunology (Baltimore, Md.: 1950) 200, 39-48, doi:10.4049/jimmunol.1600608 (2018).
145. Cote-Sierra, Javier, Erik Jongert, Amin Bredan, Dinesh C. Gautam, M. Parkhouse, Pierre Cornelis, Patrick De Baetselier, and Hilde Revets. “A new membrane-bound OprI lipoprotein expression vector: high production of heterologous fusion proteins in Gram (−) bacteria and the implications for oral vaccination.” Gene 221, no. 1 (1998): 25-34.
146. Cuburu N, Kim R, Guittard G C, Thompson C D, Day P M, Hamm D E, et al. A Prime-Pull-Amplify Vaccination Strategy To Maximize Induction of Circulating and Genital-Resident Intraepithelial CD8(+) Memory T Cells. Journal of immunology (Baltimore, Md.: 1950). 2019; 202(4):1250-64.
147. Darji, Ayub, Carlos A. Guzmán, Birgit Gerstel, Petra Wachholz, Kenneth N. Timmis, Jürgen Wehland, Trinad Chakraborty, and Siegfried Weiss. “Oral somatic transgene vaccination using attenuated S. typhimurium.” Cell 91, no. 6 (1997): 765-775.
148. Del Rio, Beatriz, Raymond J. Dattwyler, Miguel Aroso, Vera Neves, Luciana Meirelles, Jos F M L Seegers, and Maria Gomes-Solecki. “Oral immunization with recombinant Lactobacillus plantarum induces a protective immune response in mice with Lyme disease.” Clinical and Vaccine Immunology 15, no. 9 (2008): 1429-1435.
149. Detmer, Ann, and Jacob Glenting. “Live bacterial vaccines-a review and identification of potential hazards.” Microbial cell factories 5, no. 1 (2006): 23.
150. Du, Aifang, and Suhua Wang. “Efficacy of a DNA vaccine delivered in attenuated Salmonella typhimurium against Eimeria tenella infection in chickens.” International Journal for Parasitology 35, no. 7 (2005): 777-785.
151. Du, Lanying, Guangyu Zhao, Yuxian He, Yan Guo, Bo-Jian Zheng, Shibo Jiang, and Yusen Zhou. “Receptor-binding domain of SARS-CoV spike protein induces long-term protective immunity in an animal model.” Vaccine 25, no. 15 (2007): 2832-2838.
152. Faber, Milosz, Elaine W. Lamirande, Anjeanette Roberts, Amy B. Rice, Hilary Koprowski, Bernhard Dietzschold, and Matthias J. Schnell. “A single immunization with a rhabdovirus-based vector expressing severe acute respiratory syndrome coronavirus (SARS-CoV) S protein results in the production of high levels of SARS-CoV-neutralizing antibodies.” The Journal of general virology 86, no. Pt 5 (2005): 1435-1440.
153. Fayolle, C., D. O'Callaghan, P. Martineau, A. Charbit, J. M. Clément, M. Hofnung, and C. Leclerc. “Genetic control of antibody responses induced against an antigen delivered by recombinant attenuated Salmonella typhimurium.” Infection and immunity 62, no. 10(1994):4310-4319.
154. Gahan, Michelle E., Diane E. Webster, Steven L. Wesselingh, and Richard A. Strugnell. “Impact of plasmid stability on oral DNA delivery by Salmonella enterica serovar Typhimurium.” Vaccine 25, no. 8 (2007): 1476-1483.
155. Galen J E, Buskirk A D, Tennant S M, Pasetti M F. Live Attenuated Human Salmonella Vaccine Candidates: Tracking the Pathogen in Natural Infection and Stimulation of Host Immunity. EcoSal Plus. 2016; 7(1).
156. Galen, J. E., Buskirk, A. D., Tennant, S. M. & Pasetti, M. F. Live Attenuated Human Salmonella Vaccine Candidates: Tracking the Pathogen in Natural Infection and Stimulation of Host Immunity. EcoSal Plus 7, doi:10.1128/ecosalplus.ESP-0010-2016 (2016).
157. Garmory, Helen S., Sophie E C Leary, Kate F. Griffin, E. Diane Williamson, Katherine A. Brown, and Richard W. Titball. “The use of live attenuated bacteria as a delivery system for heterologous antigens.” Journal of drug targeting 11, no. 8-10 (2003): 471-479.
158. Gentschev, Ivaylo, Simone Spreng, Heike Sieber, Jose Ures, Fabian Mollet, Andre Collioud, Jon Pearman et al. “Vivotif®-a ‘magic shield’ for protection against typhoid fever and delivery of heterologous antigens.” Chemotherapy 53, no. 3 (2007): 177-180.
159. Georgiou, George, Christos Stathopoulos, Patrick S. Daugherty, Amiya R. Nayak, Brent L. Iverson, and Roy Curtiss III. “Display of heterologous proteins on the surface of microorganisms: from the screening of combinatorial libraries to live recombinant vaccines.” Nature biotechnology 15, no. 1 (1997): 29-34.
160. Gerlach, Roman G., and Michael H-ensel. “Salmonella pathogenicity islands in host specificity, host pathogen-interactions and antibiotics resistance of Salmonella enterica.” Berliner und Munchener tierarztliche Wochenschrift 120, no. 7/8 (2007): 317-327.
161. Glenting J, Wessels S. Ensuring safety of DNA vaccines. Microbial cell factories. 2005; 4:26.
162. Grangette, Corinne, Heide Müller-Alouf, Denise Goudercourt, Marie-Claude Geoffroy, Mireille Turneer, and Annick Mercenier. “Mucosal immune responses and protection against tetanus toxin after intranasal immunization with recombinant Lactobacillus plantarum.” Infection and immunity69, no. 3 (2001): 1547-1553.
163. Grangette, Corinne, Heide Müller-Alouf, Marie-Claude Geoffroy, Denise Goudercourt, Mireille Turneer, and Annick Mercenier. “Protection against tetanus toxin after intragastric administration of two recombinant lactic acid bacteria: impact of strain viability and in vivo persistence.” Vaccine 20, no. 27-28 (2002): 3304-3309.
164. Grifoni, Alba, John Sidney, Yun Zhang, Richard H. Scheuermann, Bjoern Peters, and Alessandro Sette. “A sequence homology and bioinformatic approach can predict candidate targets for immune responses to SARS-CoV-2.” Cell host & microbe (2020).
165. Guo, Shanguang, Weiwei Yan, Sean P. McDonough, Nengfeng Lin, Katherine J. Wu, Hongxuan He, Hua Xiang, Maosheng Yang, Maira Aparecida S. Moreira, and Yung-Fu Chang. “The recombinant Lactococcus lactis oral vaccine induces protection against C. difficile spore challenge in a mouse model.” Vaccine 33, no. 13 (2015): 1586-1595, doi:10.1016/j.vaccine.2015.02.006.
166. Guzman, Carlos A., Stefan Borsutzky, Monika Griot-Wenk, Ian C. Metcalfe, Jon Pearman, Andre Collioud, Didier Favre, and Guido Dietrich. “Vaccines against typhoid fever.” Vaccine 24, no. 18 (2006): 3804-3811.
167. Hahn, Heinz P., and Bernd-Ulrich von Specht. “Secretory delivery of recombinant proteins in attenuated Salmonella strains: potential and limitations of Type I protein transporters.” FEMS Immunology & Medical Microbiology 37, no. 2-3 (2003): 87-98.
168. Hansson, Marianne, and Stefan Sta. “Design and production of recombinant subunit vaccines.” Biotechnology and applied biochemistry 32, no. 2 (2000): 95-107.
169. Haraga A, Ohlson M B, Miller S I. Salmonellae interplay with host cells. Nature reviews Microbiology. 2008; 6(1):53-66.
170. Harrison, J. A., B. Villarreal-Ramos, P. Mastroeni, R. Demarco de Hormaeche, and C. E. Hormaeche. “Correlates of protection induced by live Aro-Salmonella typhimurium vaccines in the murine typhoid model.” Immunology 90, no. 4 (1997): 618-625.
171. Haselbeck, A. H. et al. Current perspectives on invasive nontyphoidal Salmonella disease. Curr. Opin. Infect Dis. 30, 498-503, doi:10.1097/QCO.0000000000000398 (2017).
172. Hayashi F, Smith K D, Ozinsky A, Hawn T R, Yi E C, Goodlett D R, et al. The innate immune response to bacterial flagellin is mediated by Toll-like receptor 5. Nature. 2001; 410(6832):1099-103.
173. He, Yuxian, Jingjing Li, Susanne Heck, Sara Lustigman, and Shibo Jiang. “Antigenic and immunogenic characterization of recombinant baculovirus-expressed severe acute respiratory syndrome coronavirus spike protein: implication for vaccine design.” Journal of virology 80, no. 12 (2006): 5757-5767.
174. Hindle Z, Chatfield S N, Phillimore J, Bentley M, Johnson J, Cosgrove C A, et al. Characterization of Salmonella enterica derivatives harboring defined aroC and Salmonella pathogenicity island 2 type III secretion system (ssaV) mutations by immunization of healthy volunteers. Infection and immunity. 2002; 70(7):3457-67.
175. Hohmann E L, Oletta C A, Loomis W P, Miller S I. Macrophage-inducible expression of a model antigen in Salmonella typhimurium enhances immunogenicity. Proceedings of the National Academy of Sciences of the United States of America. 1995; 92(7):2904-8.
176. Huang, Jen-Min, Michela Sali, Matthew W. Leckenby, David S. Radford, Hong A. Huynh, Giovanni Delogu, Rocky M. Cranenburgh, and Simon M. Cutting. “Oral delivery of a DNA vaccine against tuberculosis using operator-repressor titration in a Salmonella enterica vector.” Vaccine 28, no. 47 (2010): 7523-7528.
177. Husseiny, Mohamed I., and Michael Hensel. “Evaluation of an intracellular-activated promoter for the generation of live Salmonella recombinant vaccines.” Vaccine 23, no. 20 (2005): 2580-2590.
178. Jabbar, Ibtissam A., Germain J P Fernando, Nick Saunders, Anne Aldovini, Richard Young, Karen Malcolm, and Ian H. Frazer. “Immune responses induced by BCG recombinant for human papillomavirus Li and E7 proteins.” Vaccine 18, no. 22 (2000): 2444-2453.
179. Jensen, Eric R., Hao Shen, Felix O. Wettstein, Rafi Ahmed, and Jeff F. Miller. “Recombinant Listeria monocytogenes as a live vaccine vehicle and a probe for studying cell-mediated immunity.” Immunological reviews 158, no. 1 (1997): 147-157.
180. Jepson M A, Clark M A. The role of M cells in Salmonella infection. Microbes and infection. 2001; 3(14-15):1183-90.
181. Kapadia, Sagar U., John K. Rose, Elaine Lamirande, Leatrice Vogel, Kanta Subbarao, and Anjeanette Roberts. “Long-term protection from SARS coronavirus infection conferred by a single immunization with an attenuated VSV-based vaccine.” Virology 340, no. 2 (2005): 174-182.
182. Kardani, K., Bolhassani, A. & Vaccine, S.-S. Prime-boost vaccine strategy against viral infections: Mechanisms and benefits. Vaccine (2016).
183. Karsten, Verena, Sean I. Murray, Jeremy Pike, Kimberly Troy, Martina Ittensohn, Manvel Kondradzhyan, K. Brooks Low, and David Bermudes. “msbB deletion confers acute sensitivity to CO2 in Salmonella enterica serovar Typhinurium that can be suppressed by a loss-of-function mutation in zwf.” BMC microbiology 9, no. 1 (2009): 170.
184. Killeen, K., D. Spriggs, and J. Mekalanos. “Bacterial mucosal vaccines: Vibrio cholerae as a live attenuated vaccine/vector paradigm.” In Defense of Mucosal Surfaces: Pathogenesis, Immunity and Vaccines, pp. 237-254. Springer, Berlin, Heidelberg, 1999.
185. Kim, K. S., M. C. Jenkins, and HYUN S. Lillehoj. “Immunization of chickens with live Escherichia coli expressing Eimeria acervulina merozoite recombinant antigen induces partial protection against coccidiosis.” Infection and immunity 57, no. 8 (1989): 2434-2440.
186. Kotton, Camille N., and Elizabeth L. Hohmann. “Enteric pathogens as vaccine vectors for foreign antigen delivery.” Infection and immunity 72, no. 10 (2004): 5535-5547.
187. Kuipers, Kirsten, Maria H. Daleke-Schermerhorn, Wouter S P Jong, M. Corinne, Fred van Opzeeland, Elles Simonetti, Joen Luirink, and Marien I. de Jonge. “Salmonella outer membrane vesicles displaying high densities of pneumococcal antigen at the surface offer protection against colonization.” Vaccine 33, no. 17 (2015): 2022-2029.
188. Lau, Susanna K P, Patrick C Y Woo, Kenneth S M Li, Yi Huang, Hoi-Wah Tsoi, Beatrice H L Wong, Samson S Y Wong, Suet-Yi Leung, Kwok-Hung Chan, and Kwok-Yung Yuen. “Severe acute respiratory syndrome coronavirus-like virus in Chinese horseshoe bats.” Proceedings of the National Academy of Sciences 102, no. 39 (2005): 14040-14045.
189. Lee A K, Detweiler C S, Falkow S. OmpR regulates the two-component system SsrA-ssrB in Salmonella pathogenicity island 2. Journal of bacteriology. 2000; 182(3):771-81.
190. Lee, Jong-Soo, Kwang-Soon Shin, Jae-Gu Pan, and Chul-Joong Kim. “Surface-displayed viral antigens on Salmonella carrier vaccine.” Nature biotechnology 18, no. 6 (2000): 645.
191. Li, Long, Weihuan Fang, Jianrong Li, Li Fang, Yaowei Huang, and Lian Yu. “Oral DNA vaccination with the polyprotein gene of infectious bursal disease virus (IBDV) delivered by attenuated Salmonella elicits protective immune responses in chickens.” Vaccine 24,no.33-34(2006):5919-5927.
192. Li, Wendong, Zhengli Shi, Meng Yu, Wuze Ren, Craig Smith, Jonathan H. Epstein, Hanzhong Wang et al. “Bats are natural reservoirs of SARS-like coronaviruses.” Science 310, no. 5748 (2005): 676-679.
193. Liljeqvist, Sissela, and Stefan Ståhl. “Production of recombinant subunit vaccines: protein immunogens, live delivery systems and nucleic acid vaccines.” Journal of biotechnology 73, no. 1 (1999): 1-33.
194. Loessner, Holger, and Siegfried Weiss. “Bacteria-mediated DNA transfer in gene therapy and vaccination.” Expert opinion on biological therapy 4, no. 2 (2004): 157-168.
195. Loessner, Holger, Anne Endmann, Sara Leschner, Heike Bauer, Andrea Zelmer, Susanne zur Lage, Kathrin Westphal, and Siegfried Weiss. “Improving live attenuated bacterial carriers for vaccination and therapy.” International Journal of Medical Microbiology 298, no. 1-2 (2008):21-26.
196. Low, Kenneth Brooks, Martina Ittensohn, Xiang Luo, Li-Mou Zheng, Ivan King, John M. Pawelek, and David Bermudes. “Construction of VNP20009.” In Suicide Gene Therapy, pp. 47-59. Humana Press, 2004.
197. Luke, C. J. & review of vaccines, S.-K. Improving pandemic H5N1 influenza vaccines by combining different vaccine platforms. Expert review of vaccines, doi:10.1586/14760584.2014.922416 (2014).
198. Makvandi, Manoochehr, Ali Teimoori, Mehdi Parsa Nahad, Ali Khodadadi, and Milad Zandi. “Expression of Salmonella typhimurium and Escherichia coli flagellin protein and its functional characterization as an adjuvant.” Microbial pathogenesis 118 (2018): 87-90.
199. McSorley, Stephen J., Damo Xu, and FYs Liew. “Vaccine efficacy of Salmonella strains expressing glycoprotein 63 with different promoters.” Infection and immunity 65, no. 1 (1997): 171-178.
200. Metzger, Wolfram G., E. Mansouri, M. Kronawitter, Susanne Diescher, Meike Soerensen, Robert Hurwitz, Dirk Bumann, Toni Aebischer, B-U. Von Specht, and Thomas F. Meyer. “Impact of vector-priming on the immunogenicity of a live recombinant Salmonella enterica serovar typhi Ty21a vaccine expressing urease A and B from Helicobacter pylori in human volunteers.” Vaccine 22, no. 17-18 (2004): 2273-2277.
201. Mielcarek, Nathalie, Sylvie Alonso, and Camille Locht. “Nasal vaccination using live bacterial vectors.” Advanced drug delivery reviews 51, no. 1-3 (2001): 55-69.
202. Miller S I, Pulkkinen W S, Selsted M E, Mekalanos J J. Characterization of defensin resistance phenotypes associated with mutations in the phoP virulence regulon of Salmonella typhimurium. Infection and immunity. 1990; 58(11):3706-10.
203. Mohamadzadeh, Mansour, Tri Duong, Timothy Hoover, and Todd R. Klaenhammer. “Targeting mucosal dendritic cells with microbial antigens from probiotic lactic acid bacteria.” Expert review of vaccines 7, no. 2 (2008): 163-174.
204. Nagarajan, Arvindhan G., Sudhagar V. Balasundaram, Jessin Janice, Guruswamy Karnam, Sandeepa M. Eswarappa, and Dipshikha Chakravortty. “SopB of Salmonella enterica serovar Typhimurium is a potential DNA vaccine candidate in conjugation with live attenuated bacteria.” Vaccine 27, no. 21 (2009): 2804-2811.
205. Niedergang, Florence, Jean-Claude Sirard, Corinne Tallichet Blanc, and Jean-Pierre Kraehenbuhl. “Entry and survival of Salmonella typhimurium in dendritic cells and presentation of recombinant antigens do not require macrophage-specific virulence factors.” Proceedings of the National Academy of Sciences 97, no. 26 (2000): 14650-14655.
206. Oggioni, Marco R., Riccardo Manganelli, Mario Contorni, Massimo Tommasino, and Gianni Pozzi. “Immunization of mice by oral colonization with live recombinant commensal streptococci.” Vaccine 13, no. 8 (1995): 775-779.
207. Okan, Nihal A., Patricio Mena, Jorge L. Benach, James B. Bliska, and A. Wali Karzai. “The smpB-ssrA mutant of Yersinia pestis functions as a live attenuated vaccine to protect mice against pulmonary plague infection.” Infection and immunity 78, no. 3 (2010): 1284-1293.
208. Ou, Junxian, Zhonghua Zhou, Jing Zhang, Wendong Lan, Shan Zhao, Jianguo Wu, Donald Seto, Gong Zhang, and Qiwei Zhang. “RBD mutations from circulating SARS-CoV-2 strains enhance the structural stability and human ACE2 affinity of the spike protein.” bioRxiv (2020).
209. Ou, X., Liu, Y., Lei, X. et al. Characterization of spike glycoprotein of SARS-CoV-2 on virus entry and its immune cross-reactivity with SARS-CoV. Nat Commun 11, 1620 (2020). doi.org/10.1038/s41467-020-15562-9
210. Pace, John Lee, Richard Ives Walker, and Steven Michael Frey. “Methods for producing enhanced antigenic campylobacter bacteria and vaccines.” U.S. Pat. No. 5,679,564, issued Oct. 21, 1997.
211. Paglia, Paola, Ivano Arioli, Nicole Frahm, Trinad Chakraborty, Mario P. Colombo, and Carlos A. Guzmàn. “The defined attenuated Listeria monocytogenes Ampl2 mutant is an effective oral vaccine carrier to trigger a long-lasting immune response against a mouse fibrosarcoma.” European journal of immunology 27, no. 6 (1997): 1570-1575.
212. Panthel, K., Meinel, K. M., Sevil Domenech, V. E. E., Trülzsch, K. & Riissmann, H. Salmonella type III-mediated heterologous antigen delivery: a versatile oral vaccination strategy to induce cellular immunity against infectious agents and tumors. International journal of medical microbiology: IJMM 298, 99-103, doi:10.1016/j.ijmm.2007.07.002 (2008).
213. Pasetti, Marcela F., Myron M. Levine, and Marcelo B. Sztein. “Animal models paving the way for clinical trials of attenuated Salmonella enterica serovar Typhi live oral vaccines and live vectors.” Vaccine 21, no. 5-6 (2003): 401-418.
214. Paterson, Yvonne, Patrick D. Guirnalda, and Laurence M. Wood. “Listeria and Salmonella bacterial vectors of tumor-associated antigens for cancer immunotherapy.” In Seminars in immunology, vol. 22, no. 3, pp. 183-189. Academic Press, 2010.
215. Paterson, Yvonne. “Specific immunotherapy of cancer using a live recombinant bacterial vaccine vector.” U.S. Pat. No. 6,051,237, issued Apr. 18, 2000.
216. Patyar, S., R. Joshi, D S Prasad Byrav, A. Prakash, B. Medhi, and B. K. Das. “Bacteria in cancer therapy: a novel experimental strategy.” Journal of biomedical science 17, no. 1 (2010): 21.
217. Pawelek, John M., K. Brooks Low, and David Bermudes. “Tumor-targeted Salmonella as a novel anticancer vector.” Cancer research 57, no. 20 (1997): 4537-4544.
218. Poltorak A, He X, Smirnova I, Liu M Y, Van Huffel C, Du X, et al. Defective LPS signaling in C3H/HeJ and C57BL/10ScCr mice: mutations in Tlr4 gene. Science (New York, N.Y.). 1998; 282(5396):2085-8.
219. Prisco, A. & concepts, D. P. Memory immune response: a major challenge in vaccination. Biomolecular concepts (2012).
220. Qu, Daofeng, Suhua Wang, Weiming Cai, and Aifang Du. “Protective effect of a DNA vaccine delivered in attenuated Salmonella typhimurium against Toxoplasma gondii infection in mice.” Vaccine 26, no. 35 (2008): 4541-4548.
221. Reveneau, Nathalie, Marie-Claude Geoffroy, Camille Locht, Patrice Chagnaud, and Annick Mercenier. “Comparison of the immune responses induced by local immunizations with recombinant Lactobacillus plantarum producing tetanus toxin fragment C in different cellular locations.” Vaccine 20, no. 13-14 (2002): 1769-1777.
222. Robinson, Karen, Lisa M. Chamberlain, Karin M. Schofield, Jeremy M. Wells, and Richard W F Le Page. “Oral vaccination of mice against tetanus with recombinant Lactococcus lactis.” Nature biotechnology 15, no. 7 (1997): 653.
223. Rosenkranz, Claudia D., Damasia Chiara, Caroline Agorio, Adriana Baz, Marcela F. Pasetti, Fernanda Schreiber, Silvia Dematteis, Miguel Martinez, Marcelo B. Sztein, and Jose A. Chabalgoity. “Towards new immunotherapies: targeting recombinant cytokines to the immune system using live attenuated Salmonella.” Vaccine 21, no. 7-8 (2003): 798-801.
224. Ross, Bruce C., Larissa Czajkowski, Dianna Hocking, Mai Margetts, Elizabeth Webb, Linda Rothel, Michelle Patterson et al. “Identification of vaccine candidate antigens from a genomic analysis of Porphyromonas gingivalis.” Vaccine 19, no. 30 (2001): 4135-4142.
225. Rota P A, Khan A S, Durigon E, Yuran T, Villamarzo Y S, Bellini W J. 1995. Detection of measles virus RNA in urine specimens from vaccine recipients. J Clin Microbiol 33:2485-2488.
226. Ryan, Edward T., Joan R. Butterton, Rex Neal Smith, Patricia A. Carroll, Thomas I. Crean, and Stephen B. Calderwood. “Protective immunity against Clostridium difficile toxin A induced by oral immunization with a live, attenuated Vibrio cholerae vector strain.” Infection and immunity 65, no. 7 (1997): 2941-2949.
227. Santos, Renato L., Shuping Zhang, Renée M. Tsolis, Robert A. Kingsley, L. Garry Adams, and Andreas J. Bäumler. “Animal models of Salmonella infections: enteritis versus typhoid fever.” Microbes and Infection 3, no. 14-15 (2001): 1335-1344.
228. Sbrogio-Almeida, M. E., Tainá Mosca, L. M. Massis, I. A. Abrahamsohn, and L. C. S. Ferreira. “Host and bacterial factors affecting induction of immune responses to flagellin expressed by attenuated Salmonella vaccine strains.” Infection and immunity 72, no. 5 (2004): 2546-2555.
229. Schorr, Joachim, Bernhard Knapp, Erika Hundt, Hans A. Küpper, and Egon Amann. “Surface expression of malarial antigens in Salmonella typhimurium: induction of serum antibody response upon oral vaccination of mice.” Vaccine 9, no. 9 (1991): 675-681.
230. Seegers, Jos F M L. “Lactobacilli as live vaccine delivery vectors: progress and prospects.” Trends in biotechnology 20, no. 12 (2002): 508-515.
231. Shams, Homayoun, Fernando Poblete, Holger Rüssmann, Jorge E. Galán, and Ruben O. Donis. “Induction of specific CD8+ memory T cells and long lasting protection following immunization with Salmonella typhimurium expressing a lymphocytic choriomeningitis MHC class I-restricted epitope.” Vaccine 20, no. 3-4 (2001): 577-585.
232. Shen, Hao, Mark K. Slifka, Mehrdad Matloubian, Eric R. Jensen, Rafi Ahmed, and Jeff F. Miller. “Recombinant Listeria monocytogenes as a live vaccine vehicle for the induction of protective anti-viral cell-mediated immunity.” Proceedings of the National Academy of Sciences 92, no. 9 (1995): 3987-3991.
233. Silin, Dmytro S., Oksana V. Lyubomska, Vichai Jirathitikal, and Aldar S. Bourinbaiar. “Oral vaccination: where we are?.” Expert opinion on drug delivery 4, no. 4 (2007): 323-340.
234. Silva, Adilson José da, Teresa Cristina Zangirolami, Maria Teresa Marques Novo-Mansur, Roberto de Campos Giordano, and Elizabeth Angélica Leme Martins. “Live bacterial vaccine vectors: an overview.” Brazilian Journal of Microbiology 45, no. 4 (2014): 1117-1129.
235. Sjöstedt, A., G. Sandström, and A. Tärnvik. “Humoral and cell-mediated immunity in mice to a 17-kilodalton lipoprotein of Francisella tularensis expressed by Salmonella typhimurium.” Infection and immunity 60, no. 7 (1992): 2855-2862.
236. Spreng, Simone, Guido Dietrich, and Gerald Weidinger. “Rational design of Salmonella-based vaccination strategies.” Methods 38, no. 2 (2006): 133-143.
237. Srinivasan, Aparna, Joseph Foley, and Stephen J. McSorley. “Massive number of antigen-specific CD4 T cells during vaccination with live attenuated Salmonella causes interclonal competition.” The Journal of Immunology 172, no. 11 (2004): 6884-6893.
238. Ståhl, Stefan, and Mathias Uhlén. “Bacterial surface display: trends and progress.” Trends in biotechnology 15, no. 5 (1997): 185-192.
239. Stevenson, Gordon, and Paul A. Manning. “Galactose epimeraseless (GalE) mutant G30 of Salmonella typhimurium is a good potential live oral vaccine carrier for fimbrial antigens.” FEMS microbiology letters 28, no. 3 (1985): 317-321.
240. Stocker, Bruce A D, and Salete M C Newton. “Immune responses to epitopes inserted in Salmonella flagellin.” International reviews of immunology 11, no. 2 (1994): 167-178.
241. Stocker, Bruce A D. “Novel non-reverting Salmonella live vaccines.” U.S. Pat. No. 4,735,801, issued Apr. 5, 1988.
242. Strindelius, Lena, Malin Filler, and Ingvar Sjöholm. “Mucosal immunization with purified flagellin from Salmonella induces systemic and mucosal immune responses in C3H/HeJ mice.” Vaccine 22, no. 27-28 (2004): 3797-3808.
243. Su F, Patel G B, Hu S, Chen W. Induction of mucosal immunity through systemic immunization: Phantom or reality? Human vaccines & immunotherapeutics. 2016; 12(4):1070-9.
244. Sztein M B. Cell-mediated immunity and antibody responses elicited by attenuated Salmonella enterica Serovar Typhi strains used as live oral vaccines in humans. Clinical infectious diseases: an official publication of the Infectious Diseases Society of America. 2007; 45 Suppl 1:S15-9.
245. Takata, Tetsuo, Toshiro Shirakawa, Yoshiko Kawasaki, Shohiro Kinoshita, Akinobu Gotoh, Yasunobu Kano, and Masato Kawabata. “Genetically engineered Bifidobacterium animalis expressing the Salmonella flagellin gene for the mucosal immunization in a mouse model.” The Journal of Gene Medicine: A cross-disciplinary journal for research on the science of gene transfer and its clinical applications 8, no. 11 (2006): 1341-1346.
246. Thanh Le T, Andreadakis Z., A. Kumar, R. Gomez Roman, S. Tollefsen, M. Saville, and S. Mayhew. “The COVID-19 vaccine development landscape.” Nat Rev Drug Discov (2020): 10-10.
247. Thatte, Jayant, Satyajit Rath, and Vineeta Bal. “Immunization with live versus killed Salmonella typhimurium leads to the generation of an IFN-γ-dominant versus an IL-4-dominant immune response.” International immunology 5, no. 11 (1993): 1431-1436.
248. Tite, J. P., X. M. Gao, C. M. Hughes-Jenkins, M. Lipscombe, D. O'Callaghan, G. Dougan, and F. Y. Liew. “Anti-viral immunity induced by recombinant nucleoprotein of influenza A virus. III. Delivery of recombinant nucleoprotein to the immune system using attenuated Salmonella typhimurium as a live carrier.” Immunology 70, no. 4 (1990): 540.
249. Toussaint, Bertrand, Xavier Chauchet, Yan Wang, Benoit Polack, and Audrey Le Gouëllec. “Live-attenuated bacteria as a cancer vaccine vector.” Expert review of vaccines 12, no.10(2013):1139-1154.
250. Van Immerseel, Filip, U. Methner, I. Rychlik, B. Nagy, P. Velge, G. Martin, N. Foster, Richard Ducatelle, and Paul A. Barrow. “Vaccination and early protection against non-host-specific Salmonella serotypes in poultry: exploitation of innate immunity and microbial activity.” Epidemiology & Infection 133, no. 6 (2005): 959-978.
251. Wahid R, Pasetti M F, Maciel M, Jr., Simon J K, Tacket C O, Levine M M, et al. Oral priming with Salmonella Typhi vaccine strain CVD 909 followed by parenteral boost with the S. Typhi Vi capsular polysaccharide vaccine induces CD27+IgD-S. Typhi-specific IgA and IgG B memory cells in humans. Clinical immunology (Orlando, Fla.). 2011; 138(2):187-200.
252. Walker, Mark J., Manfred Rohde, Kenneth N. Timmis, and Carlos A. Guzman. “Specific lung mucosal and systemic immune responses after oral immunization of mice with Salmonella typhimurium aroA, Salmonella typhi Ty21a, and invasive Escherichia coli expressing recombinant pertussis toxin S1 subunit.” Infection and immunity 60, no. 10 (1992): 4260-4268.
253. Wang J Y, Harley R H, Galen J E. Novel methods for expression of foreign antigens in live vector vaccines. Human vaccines & immunotherapeutics. 2013; 9(7):1558-64.
254. Wang, Shifeng, Qingke Kong, and Roy Curtiss III. “New technologies in developing recombinant attenuated Salmonella vaccine vectors.” Microbial pathogenesis 58 (2013): 17-28.
255. Wang, Shifeng, Yuhua Li, Huoying Shi, Wei Sun, Kenneth L. Roland, and Roy Curtiss. “Comparison of a regulated delayed antigen synthesis system with in vivo-inducible promoters for antigen delivery by live attenuated Salmonella vaccines.” Infection and immunity 79,no.2(2011):937-949.
256. Wells, J. M., K. Robinson, L. M. Chamberlain, K. M. Schofield, and R. W. F. Le Page. “Lactic acid bacteria as vaccine delivery vehicles.” Antonie Van Leeuwenhoek 70, no. 2-4 (1996):317-330.
257. Winter, Kaitlin, Li Xing, Audrey Kassardjian, and Brian J. Ward. “Vaccination against Clostridium difficile by use of an attenuated Salmonella enterica serovar Typhimurium vector (YS1646) protects mice from lethal challenge.” Infection and immunity 87, no. 8 (2019): e00089-19.
258. Wu, Jane Y., Salete Newton, Amrit Judd, Bruce Stocker, and William S. Robinson. “Expression of immunogenic epitopes of hepatitis B surface antigen with hybrid flagellin proteins by a vaccine strain of Salmonella.” Proceedings of the National Academy of Sciences 86, no. 12 (1989): 4726-4730.
259. Wyszyńska, Agnieszka, Patrycja Kobierecka, Jacek Bardowski, and Elżbieta Katarzyna Jagusztyn-Krynicka. “Lactic acid bacteria-20 years exploring their potential as live vectors for mucosal vaccination.” Applied microbiology and biotechnology 99, no. 7 (2015): 2967-2977.
260. Xu, Fengfeng, Mei Hong, and Jeffrey B. Ulmer. “Immunogenicity of an HIV-1 gag DNA vaccine carried by attenuated Shigella.” Vaccine 21, no. 7-8 (2003): 644-648.
261. Xu, Yigang, and Yijing Li. “Induction of immune responses in mice after intragastric administration of Lactobacillus casei producing porcine parvovirus VP2 protein.” Applied and environmental microbiology 73, no. 21 (2007): 7041-7047.
262. Zegers, N. D., E. Kluter, H. van Der Stap, E. Van Dura, P. Van Dalen, M. Shaw, and L. Baillie. “Expression of the protective antigen of Bacillus anthracis by Lactobacillus casei: towards the development of an oral vaccine against anthrax.” Journal of applied microbiology 87, no. 2 (1999): 309-314.
263. Zhang, Ling, Lifang Gao, Lijuan Zhao, Baofeng Guo, Kun Ji, Yong Tian, Jinguo Wang et al. “Intratumoral delivery and suppression of prostate tumor growth by attenuated Salmonella enterica serovar typhimurium carrying plasmid-based small interfering RNAs.” Cancer research 67, no. 12 (2007): 5859-5864.
264. Zhao, Zhanqin, Yun Xue, Bin Wu, Xibiao Tang, Ruiming Hu, Yindi Xu, Aizhen Guo, and Huanchun Chen. “Subcutaneous vaccination with attenuated Salmonella enterica serovar Choleraesuis C500 expressing recombinant filamentous hemagglutinin and pertactin antigens protects mice against fatal infections with both S. enterica serovar Choleraesuis and Bordetella bronchiseptica.” Infection and immunity 76, no. 5 (2008): 2157-2163.
265. Zhou, Zhimin, Penny Post, Rick Chubet, Katherine Holtz, Clifton McPherson, Martin Petric, and Manon Cox. “A recombinant baculovirus-expressed S glycoprotein vaccine elicits high titers of SARS-associated coronavirus (SARS-CoV) neutralizing antibodies in mice.” Vaccine 24, no. 17 (2006): 3624-3631.

U.S. 20190017057; 20180271787; 20170157239; 20170051260; 20160222393; 20160028148; 20150017204; 20140220661; 20120142080; 20110223241; 20100136048; 20100135961; 20090169517; 20080124355; 20070009489; 20050255088; 20050249706; 20050052892; 20050036987; 20040219169; 20040042274; 20040037117; 20030170276; 20030113293; 20030109026; 20020026655; U.S. Pat. Nos. 10,286,051; 10,188,722; 10,141,626; 10,087,451; 9,878,023; 9,739,773; 9,737,592; 9,657,085; 9,616,114; 9,597,379; 9,593,339; 9,486,513; 9,421,252; 9,365,625; 9,315,817; 9,200,289; 9,200,251; 9,068,187; 8,956,859; 8,771,669; 8,647,642; 8,623,350; 8,524,220; 8,440,207; 8,241,623; 7,514,089; 7,452,531; 7,354,592; 7,211,843; 6,962,696; 6,934,176; 6,923,972; 6,863,894; 6,798,684; 6,685,935; 6,475,482; 6,447,784; 6,190,657; 6,080,849; 6,548,287, 20140256922; 20120108640; 20110318308; 20090215754; 20090169517; 20070298012; 20070110752; 20070004666; 20060115483; 20060104955; 20060089350; 20060025387; 20050267103; 20050249706; 20050112642; 20050009750; 20040229338; 20040219169; 20040058849; 20030143676; 20030113293; 20030031628; 20030022835; 20020151063; 20140220661; 20140212396; 20140186401; 20140178341; 20140155343; 20140093885; 20130330824; 20130295054; 20130209405; 20130130292; 20120164687; 20120142080; 20120128594; 20120093773; 20120020883; 20110275585; 20110111496; 20110111481; 20100239546; 20100189691; 20100136048; 20100135973; 20100135961; 20100092438; 20090300779; 20090180955; 20090175829; 20090123426; 20090053186; 20080311081; 20080124355; 20080038296; 20070110721; 20070104689; 20060083716; 20050026866; 20050008618; 20040202663; 20050255088; 20030109026; 20020026655; 20110223241; 20070009489; 20050036987; 20030170276; 20140148582; 20130345114; 20130287810; 20130164380; 20130164307; 20130078275; 20120225454; 20120177682; 20120148601; 20120144509; 20120083587; 20120021517; 20110274719; 20110268661; 20110165680; 20110091493; 20110027349; 20100172976; 20090317404; 20090220540; 20090123382; 20090117049; 20090117048; 20090117047; 20090068226; 20080249013; 20080206284; 20070202591; 20070191262; 20070134264; 20060127408; 20060057152; 20050118193; 20050069491; 20050064526; 20040234455; 20040202648; 20040054142; 20030170211; 20030059400; 20030036644; 20030009015; 20030008839; 20020176848; 20020102242; 20140205538; 20140112951; 20140086950; 20120244621; 20120189572; 20110104196; 20100233195; 20090208534; 20090136542; 20090028890; 20080260769; 20080187520; 20070031382; 20060140975; 20050214318; 20050214317; 20050112140; 20050112139; 20040266003; 20040115174; 20040009936; 20030153527; 20030125278; 20030045492; 8,828,681; 8,822,194; 8,784,836; 8,771,669; 8,734,779; 8,722,668; 8,715,641; 8,703,153; 8,685,939; 8,663,634; 8,647,642; 8,642,257; 8,623,350; 8,604,178; 8,591,862; 8,586,022; 8,568,707; 8,551,471; 8,524,220; 8,440,207; 8,357,486; 8,343,509; 8,323,959; 8,282,919; 8,241,623; 8,221,769; 8,198,430; 8,137,904; 8,066,987; 8,021,662; 8,008,283; 7,998,461; 7,955,600; 7,939,319; 7,915,218; 7,887,816; 7,842,290; 7,820,184; 7,803,531; 7,790,177; 7,786,288; 7,763,420; 7,754,221; 7,740,835; 7,736,898; 7,718,180; 7,700,104; 7,691,383; 7,687,474; 7,662,398; 7,611,883; 7,611,712; 7,588,771; 7,588,767; 7,514,089; 7,470,667; 7,452,531; 7,404,963; 7,393,525; 7,354,592; 7,344,710; 7,247,296; 7,195,757; 7,125,718; 7,084,105; 7,083,791; 7,015,027; 6,962,696; 6,923,972; 6,916,918; 6,863,894; 6,770,632; 6,685,935; 6,682,729; 6,506,550; 6,500,419; 6,475,482; 6,447,784; 6,207,648; 6,190,657; 6,150,170; 6,080,849; 6,030,624; 5,877,159, 4,190,495; 4,888,170; 4,968,619; 5,066,596; 5,098,998; 5,294,441; 5,330,753; 5,387,744; 5,424,065; 5,468,485; 5,527,678; 5,627,067; 5,628,996; 5,643,771; 5,654,184; 5,656,488; 5,662,905; 5,672,345; 5,679,880; 5,686,079; 5,695,983; 5,717,071; 5,731,196; 5,736,367; 5,747,028; 5,770,214; 5,773,007; 5,811,105; 5,824,538; 5,830,702; 5,837,509; 5,837,541; 5,840,483; 5,843,426; 5,855,879; 5,855,880; 5,869,066; 5,874,088; 5,877,159; 5,888,799; 6,024,961; 6,051,416; 6,077,678; 6,080,849; 6,100,388; 6,129,917; 6,130,082; 6,150,170; 6,153,203; 6,177,083; 6,190,657; 6,207,167; 6,245,338; 6,254,875; 6,284,477; 6,294,655; 6,337,072; 6,339,141; 6,365,163; 6,365,723; 6,365,726; 6,372,892; 6,383,496; 6,410,012; 6,413,523; 6,426,191; 6,444,445; 6,447,784; 6,471,964; 6,475,482; 6,495,661; 6,500,419; 6,506,550; 6,511,666; 6,531,313; 6,537,558; 6,541,623; 6,566,121; 6,593,147; 6,599,509; 6,610,300; 6,610,529; 6,653,128; 6,682,729; 6,685,935; 6,719,980; 6,737,521; 6,749,831; 6,752,994; 6,780,405; 6,825,028; 6,855,814; 6,863,894; 6,872,547; 6,887,483; 6,905,691; 6,913,753; 6,916,478; 6,923,958; 6,923,972; 6,962,696; 6,992,237; 6,994,860; 7,005,129; 7,018,835; 7,026,155; 7,045,336; 7,056,700; 7,063,850; 7,083,794; 7,094,410; 7,115,269; 7,144,580; 7,144,982; 7,183,105; 7,195,757; 7,226,588; 7,235,234; 7,264,812; 7,279,464; 7,341,725; 7,341,841; 7,341,860; 7,354,592; 7,393,525; 7,407,790; 7,425,438; 7,452,531; 7,459,161; 7,473,247; 7,510,717; 7,514,089; 7,514,415; 7,531,723; 7,541,043; 7,569,219; 7,569,552; 7,569,682; 7,588,767; 7,588,771; 7,601,804.; 7,622,107; 7,625,572; 7,657,380; 7,662,398; 7,666,656; 7,691,393; 7,695,725; 7,700,091; 7,700,104; 7,718,179; 7,732,187; 7,754,221; 7,758,876; 7,763,420; 7,772,386; 7,776,527; 7,794,734; 7,803,531; 7,803,990; 7,807,184; 7,807,456; 7,820,184; 7,829,104; 7,833,775; 7,842,289; 7,842,290; 7,850,958; 7,850,970; 7,871,604; 7,871,815; 7,871,816; 7,887,816; 7,919,081; 7,927,606; 7,930,107; 7,951,386; 7,951,786; 7,955,600; 7,960,518; 7,972,604; 7,985,573; 7,993,651; 8,012,466; 8,021,662; 8,021,848; 8,034,359; 8,043,857; 8,048,428; 8,049,000; 8,053,181; 8,053,421; 8,066,987; 8,071,084; 8,071,319; 8,076,099; 8,101,396; 8,114,409; 8,114,414; 8,124,068; 8,124,408; 8,133,493; 8,137,904; 8,147,820; 8,168,421; 8,173,773; 8,187,610; 8,202,516; 8,207,228; 8,211,431; 8,221,769; 8,227,584; 8,241,623; 8,241,631; 8,241,637; 8,257,713; 8,273,361; 8,287,883; 8,288,359; 8,318,661; 8,323,668; 8,323,959; 8,329,685; 8,337,832; 8,337,861; 8,343,509; 8,343,512; 8,349,586; 8,357,486; 8,357,533; 8,361,707; 8,367,055; 8,399,618; 8,440,207; 8,445,254; 8,445,426; 8,445,662; 8,460,666; 8,465,755; 8,470,551; 8,481,055; 8,501,198; 8,524,220; 8,551,497; 8,557,789; 8,568,707; 8,580,280; 8,586,022; 8,591,862; 8,609,114; 8,623,350; 8,628,776; 8,632,783; 8,633,305; 8,642,257; 8,642,656; 8,647,642; 8,658,350; 8,663,940; 8,669,355; 8,673,311; 8,679,505; 8,703,153; 8,715,929; 8,716,254; 8,716,343; 8,722,064; 8,748,150; 8,758,766; 8,771,669; 8,772,013; 8,778,683; 8,784,829; 8,784,836; 8,790,909; 8,840,908; 8,853,382; 8,859,256; 8,877,212; 8,883,147; 8,889,121; 8,889,150; 8,895,062; 8,916,372; 8,926,993; 8,937,074; 8,951,531; 8,956,618; 8,956,621; 8,956,859; 8,961,989; 8,980,279; 8,992,943; 9,005,665; 9,011,870; 9,012,213; 9,017,986; 9,023,635; 9,040,059; 9,040,233; 9,045,528; 9,045,742; 9,050,285; 9,050,319; 9,051,574; 9,056,909; 9,062,297; 9,068,187; 9,107,864; 9,140,698; 9,161,974; 9,163,219; 9,169,302; 9,173,930; 9,173,935; 9,173,936; 9,180,183; 9,181,546; 9,198,960; 9,200,251; 9,200,289; 9,205,142; 9,220,764; 9,248,177; 9,255,149; 9,255,283; 9,265,804; 9,267,108; 9,289,481; 9,297,015; 9,303,264; 9,309,493; 9,315,817; 9,320,787; 9,320,788; 9,333,251; 9,339,533; 9,358,283; 9,364,528; 9,365,625; 9,376,686; 9,408,880; 9,415,077; 9,415,098; 9,421,252; 9,428,572; 9,441,204; 9,453,227; 9,457,074; 9,457,077; 9,463,238; 9,474,831; 9,480,740; 9,481,884; 9,481,888; 9,486,513; 9,487,577; 9,492,534; 9,499,606; 9,504,750; 950692, 9,526,778; 9,529,005; 9,539,313; 9,540,407; 9,546,199; 9,549,956; 9,556,442; 9,561,270; 9,562,080; 9,562,837; 9,566,321; 9,566,322; 9,567,375; 9,580,478; 9,580,718; 9,592,283; 9,593,339; 9,597,379; 9,598,697; 9,603,799; 9,610,342; 9,616,114; 9,622,486; 9,636,386; 9,642,881; 9,642,904; 9,649,345; 9,651,559; 9,655,815; 9,657,085; 9,657,327; 9,662,385; 9,663,758; 9,670,270; 9,695,229; 9,714,426; 9,717,782; 9,730,996; 9,737,592; 9,737,601; 9,739,773; 9,750,802; 9,758,572; 9,764,021; 9,775,896; 9,795,641; 9,796,762; 9,801,930; 9,808,517; 9,814,772; 9,827,305; 9,844,592; 9,845,342; 9,855,336; 9,856,311; 9,867,785; 9,872,898; 9,878,023; 9,878,024; 9,878,043; 9,884,108; 9,885,051; 9,889,165; 9,901,082; 9,907,755; 9,907,845; 9,913,893; 9,925,257; 9,950,063; 9,986,724; 9,987,355; 9,994,809; 9,999,660; 20010014673; 20020025325; 20020028215; 20020044938; 20020068068; 20020076417; 20020077272; 20020081317; 20020086032; 20020086332; 20020090376; 20020132789; 20020146430; 20020151462; 20020156009; 20020176848; 20030017162; 20030023075; 20030045492; 20030065039; 20030068328; 20030100100; 20030108562; 20030108957; 20030124516; 20030125278; 20030130827; 20030152589; 20030153527; 20030157637; 20030166099; 20030166279; 20030170211; 20030170613; 20030176377; 20030180260; 20030180304; 20030180320; 20030185802; 20030186908; 20030190601; 20030190683; 20030190749; 20030194714; 20030194755; 20030194798; 20030198995; 20030198996; 20030199005; 20030199088; 20030199089; 20030202937; 20030203411; 20030203481; 20030207833; 20030211086; 20030211103; 20030211461; 20030211476; 20030211599; 20030219408; 20030219888; 20030224369; 20030224444; 20030232335; 20030235577; 20040005700; 20040009540; 20040009936; 20040013658; 20040013689; 20040023310; 20040033539; 20040052817; 20040053209; 20040077067; 20040121307; 20040121474; 20040126871; 20040131641; 20040132678; 20040137003; 20040156865; 20040192631; 20040202663; 20040213804; 20040228877; 20040229338; 20040237147; 20040258703; 20040258707; 20040265337; 20050008618; 20050010032; 20050026866; 20050042755; 20050048076; 20050075298; 20050106151; 20050106176; 20050129711; 20050163791; 20050175630; 20050180985; 20050222057; 20050229274; 20050232937; 20050233408; 20050249706; 20050249752; 20050255125; 20050271643; 20050271683; 20050281841; 20050287123; 20060018877; 20060019239; 20060074039; 20060078572; 20060083716; 20060115494; 20060121045; 20060121054; 20060140971; 20060140975; 20060147418; 20060147461; 20060153875; 20060171960; 20060182754; 20060189792; 20060193874; 20060233835; 20060240494; 20060246083; 20060257415; 20060269570; 20070031382; 20070031458; 20070037225; 20070048331; 20070059323; 20070104733; 20070104736; 20070110717; 20070116725; 20070122881; 20070128216; 20070134214; 20070134272; 20070141082; 20070154495; 20070169226; 20070189982; 20070258901; 20070281328; 20070286874; 20070298012; 20080008718; 20080020441; 20080038296; 20080063655; 20080095794; 20080107653; 20080112974; 20080124355; 20080131466; 20080138359; 20080181892; 20080188436; 20080193373; 20080213308; 20080241179; 20080241858; 20080254058; 20080261869; 20080286852; 20080311081; 20080317742; 20090017000; 20090017048; 20090028892; 20090053186; 20090074816; 20090081250; 20090081257; 20090104204; 20090117151; 20090117152; 20090123426; 20090142310; 20090148473; 20090169517; 20090169562; 20090180987; 20090181078; 20090196887; 20090214476; 20090227013; 20090253778; 20090263414; 20090263418; 20090285844; 20090297552; 20090297561; 20090304750; 20090305398; 20090324503; 20090324576; 20090324638; 20090324641; 20100047286; 20100055082; 20100055127; 20100068214; 20100092438; 20100092518; 20100099600; 20100129406; 20100135961; 20100136048; 20100136055; 20100136058; 20100137192; 20100166786; 20100166800; 20100172938; 20100172976; 20100189691; 20100196524; 20100209446; 20100226891; 20100226931; 20100226941; 20100233212; 20100233213; 20100239546; 20100272748; 20100272759; 20100285592; 20100291148; 20100297184; 20100297740; 20100303862; 20100310602; 20100322957; 20110008389; 20110014274; 20110020401; 20110021416; 20110052628; 20110059126; 20110064723; 20110064766; 20110070290; 20110086059; 20110104186; 20110110979; 20110111481; 20110111496; 20110123565; 20110183342; 20110195093; 20110200631; 20110201092; 20110201676; 20110206694; 20110209228; 20110212090; 20110213129; 20110217323; 20110243992; 20110256214; 20110268739; 20110275585; 20110281330; 20110287046; 20110293662; 20110312020; 20120003298; 20120009247; 20120014881; 20120027811; 20120036589; 20120039931; 20120039994; 20120058142; 20120071545; 20120077206; 20120093773; 20120093850; 20120093865; 20120100177; 20120107340; 20120115223; 20120121647; 20120135039; 20120135503; 20120141493; 20120142079; 20120142080; 20120144509; 20120164687; 20120189657; 20120189661; 20120208866; 20120225454; 20120237491; 20120237537; 20120237544; 20120258128; 20120258129; 20120258135; 20120276167; 20120282181; 20120282291; 20120288523; 20120294948; 20120301422; 20120315278; 20130004547; 20130018089; 20130040370; 20130058997; 20130064845; 20130078275; 20130078278; 20130084307; 20130095131; 20130096103; 20130101523; 20130110249; 20130121968; 20130149321; 20130156809; 20130177589; 20130177593; 20130217063; 20130236948; 20130251719; 20130266635; 20130267481; 20130273144; 20130302380; 20130315950; 20130330824; 20130336990; 20130337012; 20130337545; 20140004178; 20140004193; 20140010844; 20140017279; 20140017285; 20140037691; 20140056940; 20140065187; 20140093477; 20140093954; 20140099320; 20140112951; 20140134662; 20140155343; 20140178425; 20140186398; 20140186401; 20140187612; 20140193459; 20140206064; 20140212396; 20140220661; 20140234310; 20140234379; 20140271563; 20140271719; 20140294883; 20140322249; 20140322265; 20140322267; 20140322268; 20140335125; 20140341921; 20140341942; 20140341970; 20140341974; 20140356415; 20140369986; 20140370036; 20140370057; 20140371428; 20150017138; 20150017191; 20150017204; 20150030573; 20150037370; 20150050311; 20150056246; 20150071994; 20150093824; 20150125485; 20150125921; 20150132335; 20150140028; 20150140034; 20150140037; 20150165011; 20150174178; 20150182611; 20150184167; 20150190500; 20150196659; 20150202276; 20150204845; 20150218254; 20150219645; 20150225692; 20150238589; 20150258190; 20150265696; 20150273045; 20150316567; 20150321037; 20150335736; 20150343050; 20150376242; 20160000896; 20160022592; 20160030494; 20160045591; 20160054299; 20160058860; 20160074505; 20160090395; 20160101168; 20160103127; 20160108096; 20160136285; 20160136294; 20160158334; 20160158335; 20160169921; 20160175415; 20160175428; 20160193256; 20160193257; 20160199422; 20160199474; 20160206727; 20160208261; 20160213770; 20160220652; 20160222393; 20160228523; 20160228530; 20160243204; 20160250311; 20160263209; 20160289287; 20160317637; 20160324783; 20160324939; 20160346381; 20160354462; 20160366862; 20160367650; 20160369282; 20170007683; 20170014513; 20170015735; 20170021011; 20170028048; 20170042987; 20170042996; 20170051260; 20170072042; 20170080078; 20170081642; 20170081671; 20170095548; 20170106028; 20170106074; 20170114319; 20170129942; 20170136102; 20170136111; 20170143815; 20170145061; 20170145065; 20170151321; 20170157232; 20170157239; 20170174746; 20170182155; 20170191058; 20170209502; 20170216378; 20170240615; 20170246281; 20170258885; 20170290889; 20170290901; 20170304434; 20170318817; 20170327830; 20170340720; 20170350890; 20170360540; 20170368156; 20170368166; 20180008701; 20180021424; 20180028642; 20180028649; 20180043021; 20180044406; 20180049413; 20180050099; 20180066041; 20180066225; 20180071377; 20180087060; 20180099999; 20180104328; 20180140665; 20180147278; 20180164221; 20180168488; 20180168489; 20180168490; 20180169222; 20180169226; 20180185469; 20180193003; 20180193441; 20180206726; 20180206769; 20180221286; 20180221470; 20180236063; 20180243347; 20180243348; and EP0973911.

Claims

1. A live genetically engineered bacterium, selected from the group consisting of Escherichia coli and Salmonella, comprising a genetically engineered construct comprising a nucleic acid sequence encoding SEQ ID NO 015, a SARS-CoV-2 spike protein receptor binding domain (RBD) 488-525 epitope, the live genetically engineered bacterium being adapted for administration to a human or animal and colonization of at least one tissue under non-lethal conditions and the nucleic acid sequence having a prokaryotic promoter for expression of the SARS-Cov2 spike protein RBD 488-525 epitope by the live genetically engineered bacterium in the at least one tissue.
2. The live genetically engineered bacterium according to claim 1, wherein the nucleic acid sequence further encodes a bacterial secretion signal.
3. The live genetically engineered bacterium according to claim 1, which is Escherichia coli Nissel 1917.
4. The live genetically engineered bacterium according to claim 1, which is an attenuated Salmonella typhimurium.
5. The live genetically engineered bacterium according to claim 1, wherein the nucleic acid sequence encodes SEQ ID NO 001.
6. The live genetically engineered bacterium according to claim 1, wherein the nucleic acid sequence further comprises a fused in-frame adjuvant peptide encoding sequence.
7. The live genetically engineered bacterium according to claim 6, wherein the adjuvant peptide encoding sequence encodes a p28 dimer.
8. The live genetically engineered bacterium according to claim 6, wherein the adjuvant peptide encoding sequence encodes an adjuvant selected from the group consisting of flagellin, a flagellin peptide that binds to a toll-like receptor, a combination of p28 and flagellin toll-like receptor binding region, a dimer of C3d p28, and a dimer of C3d p28 with an internal flagellin peptide.
9. The live genetically engineered bacterium according to claim 1, wherein the live genetically engineered bacterium expresses a gut colonization factor.
10. The live genetically engineered bacterium according to claim 1, wherein the gut colonization factor is selected from the group consisting of colicin A, E1, E2, E3, E4, E5, E6, E7, E8, E9, DF13, K, N, U, B, D, Ia, and M.
11. The live genetically engineered bacterium according to claim 1, wherein the nucleic acid sequence further encodes at least one of an angiotensin converting enzyme 2 binding peptide and an angiotensin binding protein 2.
12. The live genetically engineered bacterium according to claim 1, wherein the nucleic acid sequence further encodes a fusion protein selected from the group consisting of YebF, ice nucleation protein, and HlyA.
13. The live genetically engineered bacterium according to claim 12, wherein the fusion protein contains one or more disulfide bonds.
14. The live genetically engineered bacterium according to claim 1, wherein the live genetically engineered bacterium co-expresses a colicin immunity peptide and a colicin lysis peptide with the SARS-Cov2 spike protein RBD 488-525 epitope.
15. A genetically engineered bacterium selected from the group consisting of Escherichia coli and Salmonella, comprising: a first genetically engineered construct comprising a nucleic acid sequence encoding SEQ ID NO 015, a SARS-CoV-2 spike protein receptor binding domain (RBD) 488-525 epitope, having an associated bacterial expression promoter; anda second genetically engineered construct comprising a nucleic acid sequence encoding an adjuvant peptide.
16. The genetically engineered bacterium according to claim 15, wherein the SARS-CoV-2 spike protein RBD 488-525 epitope and the adjuvant peptide are together expressed as a fusion peptide.
17. A method of vaccinating a human against SARS-CoV-2, comprising: administering the live genetically engineered bacterium according to claim 1 orally, intranasally, or rectally to the human or animal;allowing the live genetically engineered bacterium to colonize a tissue of the human or animal; andclearing the live genetically engineered bacterium from the human or animal,wherein said administration, colonization, and clearance are non-lethal to the human or animal.

US Referenced Citations (1194)

Number	Name	Date	Kind
4190495	Curtiss, III	Feb 1980	A
4735801	Stocker	Apr 1988	A
4888170	Curtiss, III	Dec 1989	A
4968619	Curtiss, III	Nov 1990	A
5066596	Manning et al.	Nov 1991	A
5098998	Mekalanos et al.	Mar 1992	A
5143830	Holland et al.	Sep 1992	A
5294441	Curtiss, III	Mar 1994	A
5330753	Mekalanos et al.	Jul 1994	A
5387744	Curtiss, III et al.	Feb 1995	A
5424065	Curtiss, III et al.	Jun 1995	A
5468485	Curtiss, III	Nov 1995	A
5470719	Meng et al.	Nov 1995	A
5508192	Georgiou et al.	Apr 1996	A
5527678	Blaser et al.	Jun 1996	A
5627067	Siadak et al.	May 1997	A
5628996	Siadak et al.	May 1997	A
5643771	Stocker	Jul 1997	A
5654184	Curtiss, III et al.	Aug 1997	A
5656488	Curtiss, III et al.	Aug 1997	A
5662905	Siadak et al.	Sep 1997	A
5672345	Curtiss, III	Sep 1997	A
5679564	Pace et al.	Oct 1997	A
5679880	Curtiss, III et al.	Oct 1997	A
5686079	Curtiss, III et al.	Nov 1997	A
5695983	Miller et al.	Dec 1997	A
5717071	Raff	Feb 1998	A
5731196	Miller, III et al.	Mar 1998	A
5736367	Haun et al.	Apr 1998	A
5747028	Calderwood et al.	May 1998	A
5770214	Dougan et al.	Jun 1998	A
5773007	Penney et al.	Jun 1998	A
5811105	Dougan et al.	Sep 1998	A
5824502	Honjo et al.	Oct 1998	A
5824538	Branstrom et al.	Oct 1998	A
5830702	Portnoy et al.	Nov 1998	A
5837509	Israelsen et al.	Nov 1998	A
5837541	Raff	Nov 1998	A
5840483	Curtiss, III	Nov 1998	A
5843426	Miller et al.	Dec 1998	A
5855879	Curtiss, III	Jan 1999	A
5855880	Curtiss, III et al.	Jan 1999	A
5869066	Pace et al.	Feb 1999	A
5874088	Mekalanos	Feb 1999	A
5877159	Powell et al.	Mar 1999	A
5888799	Curtiss, III	Mar 1999	A
5989868	Harrison et al.	Nov 1999	A
6024961	Curtiss, III et al.	Feb 2000	A
6030624	Russell et al.	Feb 2000	A
6051237	Paterson	Apr 2000	A
6051416	Pace et al.	Apr 2000	A
6077678	Pace et al.	Jun 2000	A
6080849	Bermudes et al.	Jun 2000	A
6083715	Georgiou et al.	Jul 2000	A
6100388	Casas et al.	Aug 2000	A
6129917	Potempa et al.	Oct 2000	A
6130082	Majarian et al.	Oct 2000	A
6150170	Powell et al.	Nov 2000	A
6153203	Holmgren et al.	Nov 2000	A
6177083	Lubitz	Jan 2001	B1
6190657	Pawelek et al.	Feb 2001	B1
6207167	Ou et al.	Mar 2001	B1
6207648	Waxman et al.	Mar 2001	B1
6245338	Kyd et al.	Jun 2001	B1
6254875	Kyd et al.	Jul 2001	B1
6284477	Kyd et al.	Sep 2001	B1
6294655	Ford et al.	Sep 2001	B1
6306387	Galan	Oct 2001	B1
6309861	Ambrosius et al.	Oct 2001	B1
6329172	Rhee et al.	Dec 2001	B1
6337072	Ford et al.	Jan 2002	B1
6339141	Ballinger et al.	Jan 2002	B1
6344017	Teeter	Feb 2002	B1
6365163	Holmgren et al.	Apr 2002	B1
6365723	Blattner et al.	Apr 2002	B1
6365726	Ballinger et al.	Apr 2002	B1
6372892	Ballinger et al.	Apr 2002	B1
6376281	Kohler et al.	Apr 2002	B1
6383496	Curtiss, III et al.	May 2002	B1
6410012	Sizemore et al.	Jun 2002	B1
6413523	Clements	Jul 2002	B1
6426191	Ford et al.	Jul 2002	B1
6444445	Nikolich et al.	Sep 2002	B2
6447784	Bermudes et al.	Sep 2002	B1
6455279	Ambrosius et al.	Sep 2002	B1
6471964	Biering et al.	Oct 2002	B1
6475482	Bermudes et al.	Nov 2002	B1
6495661	Glisson et al.	Dec 2002	B1
6500419	Hone et al.	Dec 2002	B1
6506550	Fulton et al.	Jan 2003	B1
6511666	Reynolds et al.	Jan 2003	B1
6531313	Goudsmit et al.	Mar 2003	B1
6537558	Kaniga	Mar 2003	B2
6541623	Ford et al.	Apr 2003	B1
6548287	Powell et al.	Apr 2003	B1
6566121	Jacobs, Jr. et al.	May 2003	B1
6593147	Barbet et al.	Jul 2003	B1
6596509	Bauer et al.	Jul 2003	B1
6596510	Lubitz et al.	Jul 2003	B1
6599509	Fox et al.	Jul 2003	B2
6605697	Kwon et al.	Aug 2003	B1
6610300	Segers et al.	Aug 2003	B1
6610529	Curtiss, III et al.	Aug 2003	B1
6635246	Barrett et al.	Oct 2003	B1
6642027	Diaz-Torres	Nov 2003	B2
6653128	Barbet et al.	Nov 2003	B2
6673569	Kurokawa et al.	Jan 2004	B1
6682729	Powell et al.	Jan 2004	B1
6685935	Pawelek et al.	Feb 2004	B1
6719980	Weston et al.	Apr 2004	B1
6737521	Fischetti et al.	May 2004	B1
6749831	Bennett-Guerrero et al.	Jun 2004	B1
6752994	Jacobs, Jr. et al.	Jun 2004	B2
6770632	Aghi et al.	Aug 2004	B1
6780405	Curtiss, III et al.	Aug 2004	B1
6798684	Low et al.	Sep 2004	B2
6825028	Von Eichel-Streiber et al.	Nov 2004	B1
6828121	Chen	Dec 2004	B2
6852512	Choi et al.	Feb 2005	B2
6855814	Blattner et al.	Feb 2005	B2
6861403	Sanders	Mar 2005	B2
6863894	Bermudes et al.	Mar 2005	B2
6872547	Curtiss, III	Mar 2005	B1
6887483	Apicella et al.	May 2005	B2
6905691	Chatfield et al.	Jun 2005	B1
6913753	Ramachandran et al.	Jul 2005	B2
6916478	Kadurugamuwa et al.	Jul 2005	B2
6916918	Yu et al.	Jul 2005	B2
6919198	Korpela et al.	Jul 2005	B1
6921659	Joly	Jul 2005	B2
6923958	Xiang et al.	Aug 2005	B2
6923972	Bermudes et al.	Aug 2005	B2
6934176	Low et al.	Aug 2005	B2
6962696	Bermudes et al.	Nov 2005	B1
6992237	Habben et al.	Jan 2006	B1
6994860	Ruelle et al.	Feb 2006	B1
7005129	Apicella et al.	Feb 2006	B1
7015027	Redshaw	Mar 2006	B1
7018835	Hone	Mar 2006	B2
7026155	Mahan et al.	Apr 2006	B2
7039956	Hsia	May 2006	B1
7045336	Branstrom et al.	May 2006	B1
7052867	Kwon et al.	May 2006	B2
7056700	Galen	Jun 2006	B2
7056732	Hua et al.	Jun 2006	B2
7063850	Dale	Jun 2006	B1
7070989	Lee et al.	Jul 2006	B2
7079879	Sylvester et al.	Jul 2006	B1
7080116	Purpura	Jul 2006	B2
7083791	Sleeman et al.	Aug 2006	B2
7083794	Curtiss, III et al.	Aug 2006	B2
7084105	Chakrabarty et al.	Aug 2006	B2
7092803	Kapolka et al.	Aug 2006	B2
7092819	Odachi et al.	Aug 2006	B2
7094410	Reisfeld et al.	Aug 2006	B2
7094579	Gray et al.	Aug 2006	B2
7094941	Das et al.	Aug 2006	B2
7095430	Kato et al.	Aug 2006	B2
7095524	Ogawa	Aug 2006	B2
7105327	Kuppusamy et al.	Sep 2006	B1
7108130	Herelier et al.	Sep 2006	B2
7108139	Nguyen	Sep 2006	B2
7108922	Lyu et al.	Sep 2006	B2
7112434	Cannon et al.	Sep 2006	B2
7115269	Darji et al.	Oct 2006	B2
7118634	Goldsteinas et al.	Oct 2006	B2
7119032	Ji et al.	Oct 2006	B2
7125718	Powell et al.	Oct 2006	B2
7127800	Dinan et al.	Oct 2006	B2
7130192	Wang et al.	Oct 2006	B2
7144580	Confer et al.	Dec 2006	B2
7144982	Mayo	Dec 2006	B2
7159299	McMunigal et al.	Jan 2007	B1
7165470	Sakamoto et al.	Jan 2007	B2
7167720	Takahashi et al.	Jan 2007	B2
7183105	Sabbadini et al.	Feb 2007	B2
7195757	Curtiss, III et al.	Mar 2007	B2
7202059	Habermann et al.	Apr 2007	B2
7211843	Low et al.	May 2007	B2
7226588	Apicella et al.	Jun 2007	B2
7235234	Branstrom et al.	Jun 2007	B1
7247296	Redshaw	Jul 2007	B2
7264812	Claerebout et al.	Sep 2007	B2
7279464	Xiang et al.	Oct 2007	B2
7291325	Lee et al.	Nov 2007	B2
7341725	Weston et al.	Mar 2008	B2
7341841	Metzger et al.	Mar 2008	B2
7341860	Curtiss, III et al.	Mar 2008	B2
7344710	Dang et al.	Mar 2008	B2
7354592	Bermudes et al.	Apr 2008	B2
7393525	Powell et al.	Jul 2008	B2
7404963	Sotomayor et al.	Jul 2008	B2
7407790	Hone	Aug 2008	B2
7410788	Beckwith et al.	Aug 2008	B2
7425438	Sung et al.	Sep 2008	B2
7452531	Bermudes et al.	Nov 2008	B2
7459161	Galen	Dec 2008	B2
7470667	Luo et al.	Dec 2008	B2
7473247	Mikszta et al.	Jan 2009	B2
7491528	Lee et al.	Feb 2009	B2
7510717	Apicella et al.	Mar 2009	B2
7514089	Bermudes et al.	Apr 2009	B2
7514415	Klinman et al.	Apr 2009	B2
7531723	Habben et al.	May 2009	B2
7541043	Kopecko et al.	Jun 2009	B2
7569219	Hone	Aug 2009	B2
7569552	Luo et al.	Aug 2009	B2
7569682	Adler et al.	Aug 2009	B2
7588767	Szalay et al.	Sep 2009	B2
7588771	Szalay et al.	Sep 2009	B2
7601804	Nuijten et al.	Oct 2009	B2
7611712	Karp	Nov 2009	B2
7611883	Cranenburgh	Nov 2009	B2
7622107	Horwitz et al.	Nov 2009	B2
7625572	Sun et al.	Dec 2009	B2
7657380	Lazar et al.	Feb 2010	B2
7662398	Szalay et al.	Feb 2010	B2
7666656	Sun et al.	Feb 2010	B2
7687474	Matin et al.	Mar 2010	B2
7691383	Chakrabarty et al.	Apr 2010	B2
7691393	Dubensky, Jr. et al.	Apr 2010	B2
7695725	Dubensky, Jr. et al.	Apr 2010	B2
7700091	Von Eichel-Streiber et al.	Apr 2010	B2
7700104	Hensel et al.	Apr 2010	B2
7718179	Claerebout et al.	May 2010	B2
7718180	Karp	May 2010	B2
7732187	Cochran et al.	Jun 2010	B2
7736898	Fulton et al.	Jun 2010	B1
7740835	Fujimori et al.	Jun 2010	B2
7754221	Szalay et al.	Jul 2010	B2
7758876	Klinman et al.	Jul 2010	B2
7763420	Stritzker et al.	Jul 2010	B2
7772386	Jungblut et al.	Aug 2010	B1
7776527	Hsu et al.	Aug 2010	B2
7786288	Karp	Aug 2010	B2
7790177	Karp	Sep 2010	B2
7794734	Ayalew et al.	Sep 2010	B2
7803531	Fulton et al.	Sep 2010	B2
7803990	Abbitt	Sep 2010	B2
7807184	Vermeij	Oct 2010	B2
7807456	Cochran et al.	Oct 2010	B2
7820184	Stritzker et al.	Oct 2010	B2
7829104	Sun et al.	Nov 2010	B2
7833775	Dubensky, Jr. et al.	Nov 2010	B2
7842289	Dubensky, Jr. et al.	Nov 2010	B2
7842290	Holden	Nov 2010	B2
7850958	Hone	Dec 2010	B2
7850970	Shapiro	Dec 2010	B2
7871604	Curtiss, III et al.	Jan 2011	B1
7871815	Sabbadini et al.	Jan 2011	B2
7871816	Sung et al.	Jan 2011	B2
7887816	Feldman et al.	Feb 2011	B2
7915218	Capecchi et al.	Mar 2011	B2
7919081	Maier et al.	Apr 2011	B2
7927606	Dubensky, Jr. et al.	Apr 2011	B2
7930107	Lazar et al.	Apr 2011	B2
7939319	Polack et al.	May 2011	B2
7951386	Chang	May 2011	B2
7951786	Klinman et al.	May 2011	B2
7955600	Hensel et al.	Jun 2011	B2
7960518	Throsby et al.	Jun 2011	B2
7972604	Cochran et al.	Jul 2011	B2
7985573	Yacoby et al.	Jul 2011	B2
7993651	Hanke et al.	Aug 2011	B2
7998461	Forbes et al.	Aug 2011	B2
8008283	Hochman et al.	Aug 2011	B2
8012466	Morita et al.	Sep 2011	B2
8021662	Szalay et al.	Sep 2011	B2
8021848	Straus	Sep 2011	B2
8034359	Gunn	Oct 2011	B2
8043857	Sun et al.	Oct 2011	B2
8048428	Reisfeld et al.	Nov 2011	B2
8049000	Helentjaris et al.	Nov 2011	B2
8053181	Lewinsohn et al.	Nov 2011	B2
8053421	Luo et al.	Nov 2011	B2
8066987	Moore et al.	Nov 2011	B2
8071084	Kopecko et al.	Dec 2011	B2
8071319	Metzger et al.	Dec 2011	B2
8076099	Chambers et al.	Dec 2011	B2
8101396	Sabbadini et al.	Jan 2012	B2
8114409	Weston et al.	Feb 2012	B2
8114414	Paterson et al.	Feb 2012	B2
8124068	Horwitz et al.	Feb 2012	B2
8124408	Cai et al.	Feb 2012	B2
8133493	Curtiss, III	Mar 2012	B2
8137904	Szalay et al.	Mar 2012	B2
8147820	Hawke et al.	Apr 2012	B2
8168421	Quinn et al.	May 2012	B2
8173773	He et al.	May 2012	B2
8187610	Waller et al.	May 2012	B2
8198430	Prior et al.	Jun 2012	B2
8202516	Padmanabhan et al.	Jun 2012	B2
8207228	Mayo et al.	Jun 2012	B2
8211431	Throsby et al.	Jul 2012	B2
8221769	Szalay et al.	Jul 2012	B2
8227584	Claerebout et al.	Jul 2012	B2
8241623	Bermudes	Aug 2012	B1
8241631	Throsby et al.	Aug 2012	B2
8241637	Reisfeld et al.	Aug 2012	B2
8257713	Poobalane et al.	Sep 2012	B2
8273361	Reed et al.	Sep 2012	B2
8282919	Eisenstark et al.	Oct 2012	B2
8287883	Dubensky, Jr. et al.	Oct 2012	B2
8288359	Klinman et al.	Oct 2012	B2
8318661	Ny et al.	Nov 2012	B2
8323668	Fleckenstein	Dec 2012	B2
8323959	Szalay et al.	Dec 2012	B2
8329685	Meyer	Dec 2012	B1
8337832	Kopecko et al.	Dec 2012	B2
8337861	Paterson et al.	Dec 2012	B2
8343509	Stritzker et al.	Jan 2013	B2
8343512	Reed et al.	Jan 2013	B2
8349586	Hamer	Jan 2013	B1
8357486	Stritzker et al.	Jan 2013	B2
8357533	Cai et al.	Jan 2013	B2
8361707	Lewinsohn et al.	Jan 2013	B2
8367055	Talaat et al.	Feb 2013	B2
8399618	Lazar et al.	Mar 2013	B2
8440207	Bermudes	May 2013	B2
8445254	Curtiss, III et al.	May 2013	B2
8445426	De Vos et al.	May 2013	B2
8445662	He et al.	May 2013	B2
8460666	Throsby et al.	Jun 2013	B2
8465755	Curtiss, III et al.	Jun 2013	B2
8470551	Sung et al.	Jun 2013	B2
8481055	Klinman et al.	Jul 2013	B2
8501198	Gunn	Aug 2013	B2
8524220	Bermudes	Sep 2013	B1
8551471	Filutowicz et al.	Oct 2013	B2
8551497	Quinn et al.	Oct 2013	B2
8557789	Klinman et al.	Oct 2013	B2
8568707	Szalay et al.	Oct 2013	B2
8580280	Dominowski et al.	Nov 2013	B2
8586022	Szalay et al.	Nov 2013	B2
8591862	Brahmbhatt et al.	Nov 2013	B2
8604178	Bottje et al.	Dec 2013	B2
8609114	Reed	Dec 2013	B2
8623350	Bermudes	Jan 2014	B1
8628776	Throsby et al.	Jan 2014	B2
8632783	Bagnoli et al.	Jan 2014	B2
8633305	Shapiro	Jan 2014	B2
8642257	Szalay et al.	Feb 2014	B2
8642656	Mayo et al.	Feb 2014	B2
8647642	Bermudes	Feb 2014	B2
8658350	Lewinsohn et al.	Feb 2014	B2
8663634	Koenig et al.	Mar 2014	B2
8663940	Granoff et al.	Mar 2014	B2
8669355	Poobalane et al.	Mar 2014	B2
8673311	Cutting et al.	Mar 2014	B2
8679505	Bagnoli et al.	Mar 2014	B2
8685939	Wei et al.	Apr 2014	B2
8703153	Telfer et al.	Apr 2014	B2
8715641	Filutowicz et al.	May 2014	B2
8715929	Benghezal et al.	May 2014	B2
8716254	Xiang et al.	May 2014	B2
8716343	Mayo et al.	May 2014	B2
8722064	Reed et al.	May 2014	B2
8722668	Hochman	May 2014	B2
8734779	Hamaji et al.	May 2014	B2
8748150	Padmanabhan et al.	Jun 2014	B2
8758766	Oloo et al.	Jun 2014	B2
8771669	Bermudes	Jul 2014	B1
8772013	Brahmbhatt et al.	Jul 2014	B2
8778683	Nano	Jul 2014	B2
8784829	Morsey et al.	Jul 2014	B2
8784836	Szalay et al.	Jul 2014	B2
8790909	Benghezal et al.	Jul 2014	B2
8822194	Zhao et al.	Sep 2014	B2
8828681	Bell, III et al.	Sep 2014	B2
8840908	Reed et al.	Sep 2014	B2
8853382	Hammarstrom et al.	Oct 2014	B2
8859256	Szalay et al.	Oct 2014	B2
8877212	Robinson et al.	Nov 2014	B2
8883147	Lazar et al.	Nov 2014	B2
8889121	Curtiss, III et al.	Nov 2014	B2
8889150	Malouin et al.	Nov 2014	B2
8895062	De Leeuw et al.	Nov 2014	B2
8916372	Bereta et al.	Dec 2014	B2
8926993	Dubensky, Jr. et al.	Jan 2015	B2
8937074	Meyer	Jan 2015	B2
8951531	Oloo et al.	Feb 2015	B2
8956618	Berghman et al.	Feb 2015	B2
8956621	Paterson et al.	Feb 2015	B2
8956859	Bermudes	Feb 2015	B1
8961989	Lewinsohn et al.	Feb 2015	B2
8980279	Gunn et al.	Mar 2015	B2
8992943	Kopecko et al.	Mar 2015	B2
9005665	Gourapura et al.	Apr 2015	B2
9011870	Leenhouts et al.	Apr 2015	B2
9012213	Fruehauf et al.	Apr 2015	B2
9017986	Sabbadini et al.	Apr 2015	B2
9023635	Bayer et al.	May 2015	B2
9040059	Curtiss, III et al.	May 2015	B2
9040233	Lewinsohn et al.	May 2015	B2
9045528	Ruker et al.	Jun 2015	B2
9045742	Curtiss, III et al.	Jun 2015	B2
9050285	Curtiss, III et al.	Jun 2015	B2
9050319	Maj et al.	Jun 2015	B2
9051574	Galen et al.	Jun 2015	B2
9056909	Chu et al.	Jun 2015	B2
9062297	Curtiss, III et al.	Jun 2015	B2
9068187	Bermudes	Jun 2015	B1
9107864	Gunn	Aug 2015	B2
9140698	Orth et al.	Sep 2015	B2
9161974	Dubensky et al.	Oct 2015	B2
9163219	Curtiss, III et al.	Oct 2015	B2
9169302	Carboulec et al.	Oct 2015	B2
9173930	Lewinsohn et al.	Nov 2015	B2
9173935	Maj et al.	Nov 2015	B2
9173936	Maj et al.	Nov 2015	B2
9180183	Maj et al.	Nov 2015	B2
9181546	Li et al.	Nov 2015	B2
9198960	Dubensky, Jr. et al.	Dec 2015	B2
9200251	Bermudes	Dec 2015	B1
9200289	Bermudes	Dec 2015	B1
9205142	Bagnoli et al.	Dec 2015	B2
9220764	Talaat et al.	Dec 2015	B2
9248177	Tang et al.	Feb 2016	B2
9255149	Himmler et al.	Feb 2016	B2
9255283	Curtiss, III et al.	Feb 2016	B2
9265804	Newman	Feb 2016	B2
9267108	Giacalone	Feb 2016	B2
9289481	Ramachandran et al.	Mar 2016	B2
9297015	Curtiss, III et al.	Mar 2016	B2
9303264	Curtiss et al.	Apr 2016	B2
9309493	Ilg et al.	Apr 2016	B2
9315817	Bermudes	Apr 2016	B2
9320787	Gunn	Apr 2016	B2
9320788	Gunn	Apr 2016	B2
9333251	Kopecko et al.	May 2016	B2
9339533	Beck et al.	May 2016	B2
9358283	Corbeil et al.	Jun 2016	B2
9364528	Giuliani et al.	Jun 2016	B1
9365625	Bermudes	Jun 2016	B1
9376686	Campos-Neto et al.	Jun 2016	B2
9408880	Kovarik et al.	Aug 2016	B2
9415077	Alonso et al.	Aug 2016	B2
9415098	Lubenau	Aug 2016	B2
9421252	Bermudes	Aug 2016	B2
9428572	Throsby et al.	Aug 2016	B2
9441204	Voorhees et al.	Sep 2016	B2
9453227	Diamond et al.	Sep 2016	B2
9457074	Gourapura et al.	Oct 2016	B2
9457077	Kovarik et al.	Oct 2016	B2
9463238	Chaplin et al.	Oct 2016	B2
9474831	Boyden et al.	Oct 2016	B2
9480740	Reed et al.	Nov 2016	B2
9481884	Li	Nov 2016	B2
9481888	Curtiss, III et al.	Nov 2016	B2
9486513	Bermudes	Nov 2016	B1
9487577	Schwarz et al.	Nov 2016	B2
9492534	Szalay et al.	Nov 2016	B2
9499606	Shapiro	Nov 2016	B2
9504750	Harel et al.	Nov 2016	B2
9506922	Lewinsohn et al.	Nov 2016	B2
9526778	Alonso et al.	Dec 2016	B2
9529005	Orth et al.	Dec 2016	B2
9539313	Sad et al.	Jan 2017	B2
9540407	Maj et al.	Jan 2017	B2
9546199	Oloo et al.	Jan 2017	B2
9549956	Fujiwara et al.	Jan 2017	B2
9556442	Le Gouellec et al.	Jan 2017	B2
9561270	Kohler et al.	Feb 2017	B2
9562080	Urbanowicz et al.	Feb 2017	B2
9562837	Link	Feb 2017	B2
9566321	Giacalone	Feb 2017	B2
9566322	Malouin et al.	Feb 2017	B2
9567375	Luo et al.	Feb 2017	B2
9580478	Nano	Feb 2017	B2
9580718	Curtiss, III et al.	Feb 2017	B2
9592283	Kolander et al.	Mar 2017	B2
9593339	Bermudes	Mar 2017	B1
9597379	Bermudes	Mar 2017	B1
9598697	Curtiss, III et al.	Mar 2017	B2
9603799	Sorayya et al.	Mar 2017	B2
9610342	Giuliani et al.	Apr 2017	B2
9616114	Bermudes	Apr 2017	B1
9622486	Padmanabhan et al.	Apr 2017	B2
9636386	Husseiny Elsayed et al.	May 2017	B2
9642881	Honda et al.	May 2017	B2
9642904	Bagnoli et al.	May 2017	B2
9649345	Honda et al.	May 2017	B2
9651559	Himmler et al.	May 2017	B2
9655815	Xiang et al.	May 2017	B2
9657085	Bermudes	May 2017	B1
9657327	Metzger et al.	May 2017	B2
9662385	Dominowski et al.	May 2017	B2
9663758	Talaat	May 2017	B2
9670270	Sabbadini et al.	Jun 2017	B2
9695229	Shapiro	Jul 2017	B2
9714426	Fruehauf et al.	Jul 2017	B2
9717782	Lewinsohn et al.	Aug 2017	B2
9730996	Gauduin et al.	Aug 2017	B2
9737592	Bermudes et al.	Aug 2017	B1
9737601	Schwarz et al.	Aug 2017	B2
9739773	Bermudes	Aug 2017	B1
9750802	Kovarik et al.	Sep 2017	B2
9758572	Schwarz et al.	Sep 2017	B2
9764021	Ilg et al.	Sep 2017	B2
9775896	Gunn	Oct 2017	B2
9795641	Nardelli Haefliger et al.	Oct 2017	B2
9796762	Kelly et al.	Oct 2017	B2
9801930	Ramachandran et al.	Oct 2017	B2
9808517	Putnam et al.	Nov 2017	B2
9814772	Reed et al.	Nov 2017	B2
9827305	Qiao et al.	Nov 2017	B2
9844592	Blander et al.	Dec 2017	B2
9845342	Thompson et al.	Dec 2017	B2
9855336	O'Connell et al.	Jan 2018	B2
9856311	Ruker et al.	Jan 2018	B2
9867785	Brahmbhatt et al.	Jan 2018	B2
9872898	Gourapura et al.	Jan 2018	B2
9878023	Bermudes	Jan 2018	B1
9878024	Dubensky, Jr. et al.	Jan 2018	B2
9878043	Brahmbhatt et al.	Jan 2018	B2
9884108	Campos-Neto et al.	Feb 2018	B2
9885051	Curtiss, III et al.	Feb 2018	B2
9889165	Taylor et al.	Feb 2018	B2
9901082	Flavell et al.	Feb 2018	B2
9907755	Kabadi et al.	Mar 2018	B2
9907845	Reed et al.	Mar 2018	B2
9913893	Berghman et al.	Mar 2018	B2
9925257	Campos-Neto et al.	Mar 2018	B2
9950063	Reed et al.	Apr 2018	B2
9951340	Lesser et al.	Apr 2018	B2
9986724	Flavell et al.	Jun 2018	B2
9987355	Reed et al.	Jun 2018	B2
9994809	Bhatia et al.	Jun 2018	B2
9999660	Mueller et al.	Jun 2018	B2
10087451	Bermudes	Oct 2018	B2
10141626	Tan et al.	Nov 2018	B2
10188722	Bermudes	Jan 2019	B2
10286051	Bermudes	May 2019	B1
20010014673	Nikolich et al.	Aug 2001	A1
20020025325	Chu	Feb 2002	A1
20020026655	Bermudes	Feb 2002	A1
20020028215	Kadurugamuwa	Mar 2002	A1
20020044938	Fox	Apr 2002	A1
20020068068	Mahan	Jun 2002	A1
20020076417	Mahan	Jun 2002	A1
20020077272	Mahan	Jun 2002	A1
20020081317	Mahan	Jun 2002	A1
20020086032	Mahan et al.	Jul 2002	A1
20020086332	Mahan et al.	Jul 2002	A1
20020090376	Kaniga et al.	Jul 2002	A1
20020102242	Briles et al.	Aug 2002	A1
20020132789	Barbet et al.	Sep 2002	A1
20020146430	Galen	Oct 2002	A1
20020151063	Lasham et al.	Oct 2002	A1
20020151462	Lissolo	Oct 2002	A1
20020156009	Ballinger et al.	Oct 2002	A1
20020176848	Sizemore et al.	Nov 2002	A1
20030008839	van Rooij et al.	Jan 2003	A1
20030009015	Ulrich et al.	Jan 2003	A1
20030017162	Warren et al.	Jan 2003	A1
20030022835	Watson et al.	Jan 2003	A1
20030023075	Blattner et al.	Jan 2003	A1
20030031628	Zhao et al.	Feb 2003	A1
20030036644	Ulrich	Feb 2003	A1
20030045492	Tang et al.	Mar 2003	A1
20030059400	Szalay	Mar 2003	A1
20030065039	Kharazmi et al.	Apr 2003	A1
20030068328	Vladoianu et al.	Apr 2003	A1
20030100100	Jacobs, Jr. et al.	May 2003	A1
20030108562	Hanke et al.	Jun 2003	A1
20030108957	Otvos et al.	Jun 2003	A1
20030109026	Bermudes et al.	Jun 2003	A1
20030113293	Bermudes et al.	Jun 2003	A1
20030124516	Chung et al.	Jul 2003	A1
20030125278	Tang et al.	Jul 2003	A1
20030130827	Bentzien et al.	Jul 2003	A1
20030143676	Strachan et al.	Jul 2003	A1
20030152589	Ramachandran et al.	Aug 2003	A1
20030153527	Powell et al.	Aug 2003	A1
20030157637	Reynolds et al.	Aug 2003	A1
20030166099	Sabbadini et al.	Sep 2003	A1
20030166279	Sabbadini et al.	Sep 2003	A1
20030170211	Goudsmit et al.	Sep 2003	A1
20030170276	Bermudes et al.	Sep 2003	A1
20030170613	Straus	Sep 2003	A1
20030176377	Xiang et al.	Sep 2003	A1
20030180260	Clancy et al.	Sep 2003	A1
20030180304	Ullrich et al.	Sep 2003	A1
20030180320	Darji et al.	Sep 2003	A1
20030185802	Reisfeld et al.	Oct 2003	A1
20030186908	Goldway	Oct 2003	A1
20030190601	Sabbadini et al.	Oct 2003	A1
20030190683	Sabbadini et al.	Oct 2003	A1
20030190749	Surber et al.	Oct 2003	A1
20030194714	Sabbadini et al.	Oct 2003	A1
20030194755	Schnabel et al.	Oct 2003	A1
20030194798	Surber et al.	Oct 2003	A1
20030198995	Sabbadini et al.	Oct 2003	A1
20030198996	Surber et al.	Oct 2003	A1
20030199005	Sabbadini et al.	Oct 2003	A1
20030199088	Sabbadini et al.	Oct 2003	A1
20030199089	Surber et al.	Oct 2003	A1
20030202937	Sabbadini et al.	Oct 2003	A1
20030203411	Sabbadini et al.	Oct 2003	A1
20030203481	Surber et al.	Oct 2003	A1
20030207833	Berkley et al.	Nov 2003	A1
20030211086	Berkley et al.	Nov 2003	A1
20030211103	Buyse et al.	Nov 2003	A1
20030211461	Kariv et al.	Nov 2003	A1
20030211476	O'Mahony et al.	Nov 2003	A1
20030211599	Sabbadini et al.	Nov 2003	A1
20030219408	Sabbadini et al.	Nov 2003	A1
20030219888	Segall et al.	Nov 2003	A1
20030224369	Surber et al.	Dec 2003	A1
20030224444	Sabbadini et al.	Dec 2003	A1
20030232335	Surber et al.	Dec 2003	A1
20030235577	Shapiro et al.	Dec 2003	A1
20040005695	Miksch et al.	Jan 2004	A1
20040005700	Surber et al.	Jan 2004	A1
20040009540	Soohoo et al.	Jan 2004	A1
20040009936	Tang et al.	Jan 2004	A1
20040013658	Fulton et al.	Jan 2004	A1
20040013689	Kadurugamuwa et al.	Jan 2004	A1
20040023310	Kariv et al.	Feb 2004	A1
20040033539	Schnabel et al.	Feb 2004	A1
20040037117	Low et al.	Feb 2004	A1
20040042274	Low et al.	Mar 2004	A1
20040052817	Geldhof et al.	Mar 2004	A1
20040053209	Kariv et al.	Mar 2004	A1
20040054142	Cassart et al.	Mar 2004	A1
20040058849	Sleeman et al.	Mar 2004	A1
20040077067	Sin et al.	Apr 2004	A1
20040115174	Gilboa et al.	Jun 2004	A1
20040121307	Schnabel et al.	Jun 2004	A1
20040121474	SooHoo et al.	Jun 2004	A1
20040126871	Barbet et al.	Jul 2004	A1
20040131641	Mikszta et al.	Jul 2004	A1
20040132678	Hone	Jul 2004	A1
20040137003	Curtiss, III	Jul 2004	A1
20040156865	Confer et al.	Aug 2004	A1
20040192631	Xiang et al.	Sep 2004	A1
20040202648	Cabezon et al.	Oct 2004	A1
20040202663	Hu et al.	Oct 2004	A1
20040213804	Michon et al.	Oct 2004	A1
20040219169	Bermudes et al.	Nov 2004	A1
20040228877	Dubensky, Jr. et al.	Nov 2004	A1
20040229338	King	Nov 2004	A1
20040234455	Szalay	Nov 2004	A1
20040237147	Habben et al.	Nov 2004	A1
20040258703	Glenn et al.	Dec 2004	A1
20040258707	Weston et al.	Dec 2004	A1
20040265337	Zsebo et al.	Dec 2004	A1
20040266003	Powell et al.	Dec 2004	A1
20050008618	Kaufman et al.	Jan 2005	A1
20050009750	Sleeman et al.	Jan 2005	A1
20050010032	Hardham et al.	Jan 2005	A1
20050026866	Pawelek	Feb 2005	A1
20050036987	Pawelek et al.	Feb 2005	A1
20050042755	Von Eichel-Streiber et al.	Feb 2005	A1
20050048076	Apicella et al.	Mar 2005	A1
20050052892	Low et al.	Mar 2005	A1
20050064526	Ulrich et al.	Mar 2005	A1
20050069491	Szalay et al.	Mar 2005	A1
20050075298	Chen et al.	Apr 2005	A1
20050106151	Shapiro	May 2005	A1
20050106176	Curtis et al.	May 2005	A1
20050112139	Karp	May 2005	A1
20050112140	Karp	May 2005	A1
20050112642	Sleeman et al.	May 2005	A1
20050118193	Andino-Pavlovsky et al.	Jun 2005	A1
20050129711	Ramachandran et al.	Jun 2005	A1
20050163791	Adler et al.	Jul 2005	A1
20050175630	Raz et al.	Aug 2005	A1
20050180985	Vladoianu et al.	Aug 2005	A9
20050214317	Karp	Sep 2005	A1
20050214318	Karp	Sep 2005	A1
20050222057	Brahmbhatt et al.	Oct 2005	A1
20050229274	Habben et al.	Oct 2005	A1
20050232937	Willemsen et al.	Oct 2005	A1
20050233408	Pouwels et al.	Oct 2005	A1
20050249706	Bermudes et al.	Nov 2005	A1
20050249752	Sung et al.	Nov 2005	A1
20050255088	Bermudes et al.	Nov 2005	A1
20050255125	Nuijten et al.	Nov 2005	A1
20050267103	Hochman	Dec 2005	A1
20050271643	Sorokulova et al.	Dec 2005	A1
20050271683	Claerebout et al.	Dec 2005	A1
20050281841	Kopecko et al.	Dec 2005	A1
20050287123	Xiang et al.	Dec 2005	A1
20060018877	Mikszta et al.	Jan 2006	A1
20060019239	Ivins et al.	Jan 2006	A1
20060025387	Hochman	Feb 2006	A1
20060057152	Marshall	Mar 2006	A1
20060074039	Klinman et al.	Apr 2006	A1
20060078572	Confer et al.	Apr 2006	A1
20060083716	Kaufman et al.	Apr 2006	A1
20060089350	Hochman et al.	Apr 2006	A1
20060104955	Redshaw	May 2006	A1
20060115483	Sleeman et al.	Jun 2006	A1
20060115494	Sun et al.	Jun 2006	A1
20060121045	Iverson et al.	Jun 2006	A1
20060121054	Sun et al.	Jun 2006	A1
20060127408	Young et al.	Jun 2006	A1
20060140971	Sung et al.	Jun 2006	A1
20060140975	Curtiss et al.	Jun 2006	A1
20060147418	Hone	Jul 2006	A1
20060147461	Galen	Jul 2006	A1
20060153875	Adler et al.	Jul 2006	A1
20060171960	Chu et al.	Aug 2006	A1
20060182754	Horwitz et al.	Aug 2006	A1
20060189792	Ruelle et al.	Aug 2006	A1
20060193874	Jones	Aug 2006	A1
20060233835	Paterson et al.	Oct 2006	A1
20060240494	Otvos et al.	Oct 2006	A1
20060240515	Dimitrov	Oct 2006	A1
20060246083	Dale	Nov 2006	A1
20060257415	Sirard et al.	Nov 2006	A1
20060269570	Hone	Nov 2006	A1
20060270043	Blattner et al.	Nov 2006	A1
20070004666	Lasham et al.	Jan 2007	A1
20070009489	Bermudes et al.	Jan 2007	A1
20070031382	Powell et al.	Feb 2007	A1
20070031458	Favre et al.	Feb 2007	A1
20070037225	Metzger et al.	Feb 2007	A1
20070048331	Apicella et al.	Mar 2007	A1
20070059323	Reisfeld et al.	Mar 2007	A1
20070104689	Gillies et al.	May 2007	A1
20070104733	Gunn	May 2007	A1
20070104736	Apicella et al.	May 2007	A1
20070110717	Luo et al.	May 2007	A1
20070110721	Cranenburgh	May 2007	A1
20070110752	Murison et al.	May 2007	A1
20070116725	Vladoianu et al.	May 2007	A1
20070122881	Surber	May 2007	A1
20070128216	Horwitz et al.	Jun 2007	A1
20070134214	Xu	Jun 2007	A1
20070134264	Marshall	Jun 2007	A1
20070134272	Ayalew et al.	Jun 2007	A1
20070141082	Sung et al.	Jun 2007	A1
20070154495	Gorringe et al.	Jul 2007	A1
20070169226	Habben et al.	Jul 2007	A1
20070189982	Reynolds et al.	Aug 2007	A1
20070191262	Racila et al.	Aug 2007	A1
20070202591	Ulrich	Aug 2007	A1
20070258901	Boschert et al.	Nov 2007	A1
20070281328	Hsu et al.	Dec 2007	A1
20070286874	Cochran et al.	Dec 2007	A1
20070287171	Inouye	Dec 2007	A1
20070298012	King et al.	Dec 2007	A1
20080008718	Schuijffel et al.	Jan 2008	A1
20080020441	Brahmbhatt et al.	Jan 2008	A1
20080038296	Brahmbhatt et al.	Feb 2008	A1
20080063655	Adler et al.	Mar 2008	A1
20080064062	Leonhartsberger et al.	Mar 2008	A1
20080076157	Leonhartsberger et al.	Mar 2008	A1
20080095794	Sun et al.	Apr 2008	A1
20080107653	Vermeij	May 2008	A1
20080112974	Czerkinsky et al.	May 2008	A1
20080124355	Bermudes	May 2008	A1
20080131466	Reed et al.	Jun 2008	A1
20080138359	Steeghs et al.	Jun 2008	A1
20080166757	Bron et al.	Jul 2008	A1
20080166764	Schloesser et al.	Jul 2008	A1
20080181892	Ledbetter et al.	Jul 2008	A1
20080182295	Patkar et al.	Jul 2008	A1
20080187520	Polack et al.	Aug 2008	A1
20080188436	Brahmbhatt et al.	Aug 2008	A1
20080193373	Stritzker et al.	Aug 2008	A1
20080193974	Coleman et al.	Aug 2008	A1
20080206284	Williams et al.	Aug 2008	A1
20080206814	Lee et al.	Aug 2008	A1
20080206818	Wich et al.	Aug 2008	A1
20080213308	Valiante et al.	Sep 2008	A1
20080241179	Weston et al.	Oct 2008	A1
20080241858	Metzger et al.	Oct 2008	A1
20080249013	Cabezon et al.	Oct 2008	A1
20080254058	Glenting et al.	Oct 2008	A1
20080254511	Dassler et al.	Oct 2008	A1
20080260769	Capecchi et al.	Oct 2008	A1
20080261869	Shapiro	Oct 2008	A1
20080280346	de Lorenzo Prieto et al.	Nov 2008	A1
20080286852	Sun et al.	Nov 2008	A1
20080311081	Fruehauf et al.	Dec 2008	A1
20080317742	Chambers et al.	Dec 2008	A1
20090011995	Lee et al.	Jan 2009	A1
20090017000	Cai et al.	Jan 2009	A1
20090017048	Adler et al.	Jan 2009	A1
20090028890	Karp	Jan 2009	A1
20090028892	Claerebout et al.	Jan 2009	A1
20090053186	Hu et al.	Feb 2009	A1
20090068226	Ulrich et al.	Mar 2009	A1
20090074816	Gunn	Mar 2009	A1
20090081250	Paterson et al.	Mar 2009	A1
20090081257	Maier et al.	Mar 2009	A1
20090104204	Throsby et al.	Apr 2009	A1
20090117047	Szalay et al.	May 2009	A1
20090117048	Szalay et al.	May 2009	A1
20090117049	Szalay et al.	May 2009	A1
20090117151	Sung et al.	May 2009	A1
20090117152	Chu et al.	May 2009	A1
20090123382	Szalay et al.	May 2009	A1
20090123426	Li et al.	May 2009	A1
20090136542	Karp	May 2009	A1
20090142310	Klinman et al.	Jun 2009	A1
20090148473	Quinn et al.	Jun 2009	A1
20090169517	Bermudes et al.	Jul 2009	A1
20090169562	Throsby et al.	Jul 2009	A1
20090175829	Forbes et al.	Jul 2009	A1
20090180955	Stritzker et al.	Jul 2009	A1
20090180987	Stritzker et al.	Jul 2009	A1
20090181078	Reed et al.	Jul 2009	A1
20090196887	Morita et al.	Aug 2009	A1
20090208534	Xu et al.	Aug 2009	A1
20090214476	Pretzer et al.	Aug 2009	A1
20090215754	Hochman et al.	Aug 2009	A1
20090220540	Marshall	Sep 2009	A1
20090227013	Helentjaris et al.	Sep 2009	A1
20090253778	Reisfeld et al.	Oct 2009	A1
20090263414	Leenhouts et al.	Oct 2009	A1
20090263418	Speelman-Van Der Wel et al.	Oct 2009	A1
20090285844	Apicella et al.	Nov 2009	A1
20090297552	Aderem et al.	Dec 2009	A1
20090297561	Pasternack et al.	Dec 2009	A1
20090300779	Zhao et al.	Dec 2009	A1
20090304750	Hone et al.	Dec 2009	A1
20090305398	Hone	Dec 2009	A1
20090317404	Markham	Dec 2009	A1
20090324503	Lewinsohn et al.	Dec 2009	A1
20090324576	Padmanabhan et al.	Dec 2009	A1
20090324638	Dattwyler et al.	Dec 2009	A1
20090324641	Dominowski et al.	Dec 2009	A1
20100047286	Sun et al.	Feb 2010	A1
20100055082	Bauer et al.	Mar 2010	A1
20100055127	Venegas	Mar 2010	A1
20100068214	Rood et al.	Mar 2010	A1
20100092438	Fruehauf et al.	Apr 2010	A1
20100092518	Horwitz et al.	Apr 2010	A1
20100099600	Ny et al.	Apr 2010	A1
20100120124	Fernandez Herrero et al.	May 2010	A1
20100129406	Lauer et al.	May 2010	A1
20100135961	Bermudes	Jun 2010	A1
20100135973	Eisenstark et al.	Jun 2010	A1
20100136048	Bermudes	Jun 2010	A1
20100136055	Luo et al.	Jun 2010	A1
20100136058	Luo et al.	Jun 2010	A1
20100137192	Shapiro	Jun 2010	A1
20100166786	He et al.	Jul 2010	A1
20100166800	Cochran et al.	Jul 2010	A1
20100172938	Pouwels et al.	Jul 2010	A1
20100172976	Satishchandran et al.	Jul 2010	A1
20100189691	Fruehauf et al.	Jul 2010	A1
20100196524	Meindert De Vos et al.	Aug 2010	A1
20100209446	Claerebout et al.	Aug 2010	A1
20100226891	Sung et al.	Sep 2010	A1
20100226931	Valiante et al.	Sep 2010	A1
20100226941	Klinman et al.	Sep 2010	A1
20100233195	Delisa et al.	Sep 2010	A1
20100233212	Dubensky, Jr. et al.	Sep 2010	A1
20100233213	Sun et al.	Sep 2010	A1
20100239546	Fruehauf et al.	Sep 2010	A1
20100272748	Kopecko et al.	Oct 2010	A1
20100272759	Beck et al.	Oct 2010	A1
20100285592	Curtiss et al.	Nov 2010	A1
20100291148	Bernardini et al.	Nov 2010	A1
20100297184	Waller et al.	Nov 2010	A1
20100297740	Li et al.	Nov 2010	A1
20100303862	Ramachandran et al.	Dec 2010	A1
20100310602	Reed et al.	Dec 2010	A1
20100322957	Aderem et al.	Dec 2010	A1
20110008389	Cochran et al.	Jan 2011	A1
20110014274	Reed et al.	Jan 2011	A1
20110020401	Gunn	Jan 2011	A1
20110021416	Shapiro	Jan 2011	A1
20110027349	Sable et al.	Feb 2011	A1
20110052628	Hone	Mar 2011	A1
20110059126	Kohler et al.	Mar 2011	A1
20110064723	Truong-Le et al.	Mar 2011	A1
20110064766	Hawke et al.	Mar 2011	A1
20110070290	Reed et al.	Mar 2011	A1
20110086059	Galen et al.	Apr 2011	A1
20110091493	Moahamadzadeh et al.	Apr 2011	A1
20110104186	Valiante et al.	May 2011	A1
20110104196	Karp	May 2011	A1
20110110979	Nardelli Haefliger	May 2011	A1
20110111481	Li	May 2011	A1
20110111496	Li	May 2011	A1
20110123565	Weston et al.	May 2011	A1
20110165680	Blattner et al.	Jul 2011	A1
20110183342	Lewinsohn et al.	Jul 2011	A1
20110195093	Gunn	Aug 2011	A1
20110200631	Morsey et al.	Aug 2011	A1
20110201092	Dubensky, Jr. et al.	Aug 2011	A1
20110201676	Klinman et al.	Aug 2011	A1
20110206694	Fleckenstein	Aug 2011	A1
20110209228	Cocks et al.	Aug 2011	A1
20110212090	Pedersen et al.	Sep 2011	A1
20110213129	Reynolds et al.	Sep 2011	A1
20110217323	Valiante et al.	Sep 2011	A1
20110223241	Tardi et al.	Sep 2011	A1
20110243992	Kernodle	Oct 2011	A1
20110256214	Martin et al.	Oct 2011	A1
20110268661	Markiv et al.	Nov 2011	A1
20110268739	Throsby et al.	Nov 2011	A1
20110274719	Marshall	Nov 2011	A1
20110275585	Brahmbhatt et al.	Nov 2011	A1
20110281330	Sabbadini et al.	Nov 2011	A1
20110287046	Oloo et al.	Nov 2011	A1
20110293662	Blattner et al.	Dec 2011	A1
20110312020	Granoff et al.	Dec 2011	A1
20110318308	Ragolia	Dec 2011	A1
20120003298	Barberis et al.	Jan 2012	A1
20120009247	Maj et al.	Jan 2012	A1
20120014881	Lewinsohn et al.	Jan 2012	A1
20120020883	Stritzker et al.	Jan 2012	A1
20120021517	Jin et al.	Jan 2012	A1
20120027811	Edwards et al.	Feb 2012	A1
20120036589	Poobalane et al.	Feb 2012	A1
20120039931	Reisfeld et al.	Feb 2012	A1
20120039994	Reed et al.	Feb 2012	A1
20120058142	Kopecko et al.	Mar 2012	A1
20120071545	Shapiro	Mar 2012	A1
20120077206	Metzger et al.	Mar 2012	A1
20120083587	Gallo et al.	Apr 2012	A1
20120093773	Li et al.	Apr 2012	A1
20120093850	Bagnoli et al.	Apr 2012	A1
20120093865	Blattner et al.	Apr 2012	A2
20120100177	Ilg et al.	Apr 2012	A1
20120107340	Bagnoli et al.	May 2012	A1
20120108640	Hochman et al.	May 2012	A1
20120115223	Cai et al.	May 2012	A1
20120121647	Alonso et al.	May 2012	A1
20120128594	Choy et al.	May 2012	A1
20120135039	Aldwell et al.	May 2012	A1
20120135503	Sabbadini et al.	May 2012	A1
20120141493	Throsby et al.	Jun 2012	A1
20120142079	Sabbadini et al.	Jun 2012	A1
20120142080	Bermudes	Jun 2012	A1
20120144509	Benghezal et al.	Jun 2012	A1
20120148601	Ulrich et al.	Jun 2012	A1
20120164687	Bereta et al.	Jun 2012	A1
20120177682	Marshall	Jul 2012	A1
20120189572	Wei et al.	Jul 2012	A1
20120189657	Quinn et al.	Jul 2012	A1
20120189661	Nano	Jul 2012	A1
20120208866	Brahmbhatt et al.	Aug 2012	A1
20120225454	Benghezal et al.	Sep 2012	A1
20120237491	Padmanabhan et al.	Sep 2012	A1
20120237537	Lewinsohn et al.	Sep 2012	A1
20120237544	Cutting et al.	Sep 2012	A1
20120244621	Weiss et al.	Sep 2012	A1
20120258128	Dowling et al.	Oct 2012	A1
20120258129	He et al.	Oct 2012	A1
20120258135	Gunn et al.	Oct 2012	A1
20120276167	Lam et al.	Nov 2012	A1
20120282181	Lewinsohn et al.	Nov 2012	A1
20120282291	Berghman et al.	Nov 2012	A1
20120288523	Jacobs	Nov 2012	A1
20120294948	Poobalane et al.	Nov 2012	A1
20120301422	Meyer	Nov 2012	A1
20120315278	Throsby et al.	Dec 2012	A1
20130004547	Lam et al.	Jan 2013	A1
20130018089	Klinman et al.	Jan 2013	A1
20130040370	Genin	Feb 2013	A1
20130058997	Reed et al.	Mar 2013	A1
20130064845	Malouin et al.	Mar 2013	A1
20130078275	Tao	Mar 2013	A1
20130078278	Kopecko et al.	Mar 2013	A1
20130084307	Reed et al.	Apr 2013	A1
20130095131	Campos-Neto et al.	Apr 2013	A1
20130096103	Valiante et al.	Apr 2013	A1
20130101523	Lewinsohn et al.	Apr 2013	A1
20130110249	Schwarz et al.	May 2013	A1
20130121968	Quay	May 2013	A1
20130130292	Szalay et al.	May 2013	A1
20130149321	Ny et al.	Jun 2013	A1
20130156809	Sad et al.	Jun 2013	A1
20130164307	Markham	Jun 2013	A1
20130164380	Durum et al.	Jun 2013	A1
20130177589	Nano	Jul 2013	A1
20130177593	Gunn et al.	Jul 2013	A1
20130209405	Curtiss et al.	Aug 2013	A1
20130217063	Metzger et al.	Aug 2013	A1
20130236948	Barreira et al.	Sep 2013	A1
20130251719	Muller et al.	Sep 2013	A1
20130266635	Maj et al.	Oct 2013	A1
20130267481	Maj et al.	Oct 2013	A1
20130273144	Maj et al.	Oct 2013	A1
20130287810	Mohamadzadeh et al.	Oct 2013	A1
20130295054	Huang et al.	Nov 2013	A1
20130302380	Fujiwara et al.	Nov 2013	A1
20130315950	Dubensky et al.	Nov 2013	A1
20130330824	Li	Dec 2013	A1
20130336990	Meyer	Dec 2013	A1
20130337012	Gunn	Dec 2013	A1
20130337545	Sabbadini et al.	Dec 2013	A1
20130345114	Williams et al.	Dec 2013	A1
20140004178	Morici	Jan 2014	A1
20140004193	Gourapura et al.	Jan 2014	A1
20140010844	Gunn	Jan 2014	A1
20140017279	Brito et al.	Jan 2014	A1
20140017285	Brito et al.	Jan 2014	A1
20140037691	Reed et al.	Feb 2014	A1
20140056940	Dominowski et al.	Feb 2014	A1
20140065187	Carboulec et al.	Mar 2014	A1
20140086950	Pascual et al.	Mar 2014	A1
20140093477	Orth et al.	Apr 2014	A1
20140093885	Hua et al.	Apr 2014	A1
20140093954	Giacalone	Apr 2014	A1
20140099320	Throsby et al.	Apr 2014	A1
20140112951	Tang et al.	Apr 2014	A1
20140134662	Havell et al.	May 2014	A1
20140148582	Gallo et al.	May 2014	A1
20140155343	Brahmbhatt et al.	Jun 2014	A1
20140178341	Zhao et al.	Jun 2014	A1
20140178425	Bagnoli et al.	Jun 2014	A1
20140186398	Blander et al.	Jul 2014	A1
20140186401	Diamond et al.	Jul 2014	A1
20140187612	Agrez et al.	Jul 2014	A1
20140193459	Reed et al.	Jul 2014	A1
20140205538	Wei et al.	Jul 2014	A1
20140206064	Bayer et al.	Jul 2014	A1
20140212396	Newman	Jul 2014	A1
20140220661	Bermudes	Aug 2014	A1
20140234310	Shapiro	Aug 2014	A1
20140234379	Fujiwara et al.	Aug 2014	A1
20140256922	David et al.	Sep 2014	A1
20140271563	Alonso et al.	Sep 2014	A1
20140271719	Talaat	Sep 2014	A1
20140294883	Poobalane et al.	Oct 2014	A1
20140322249	Xiang et al.	Oct 2014	A1
20140322265	Chaplin et al.	Oct 2014	A1
20140322267	Haiwick et al.	Oct 2014	A1
20140322268	Reed et al.	Oct 2014	A1
20140335125	Le Gouellec et al.	Nov 2014	A1
20140341921	Honda et al.	Nov 2014	A1
20140341942	Oloo et al.	Nov 2014	A1
20140341970	Reed et al.	Nov 2014	A1
20140341974	Sorayya et al.	Nov 2014	A1
20140356415	DeShong et al.	Dec 2014	A1
20140369986	Padmanabhan et al.	Dec 2014	A1
20140370036	Shapiro	Dec 2014	A1
20140370057	Curtiss et al.	Dec 2014	A1
20140371428	Schwarz et al.	Dec 2014	A1
20150017138	Fruehauf et al.	Jan 2015	A1
20150017191	Fox et al.	Jan 2015	A1
20150017204	Bermudes	Jan 2015	A1
20150030573	Fruehauf et al.	Jan 2015	A1
20150037370	Corbeil et al.	Feb 2015	A1
20150050311	Schubert et al.	Feb 2015	A1
20150056246	Putnam et al.	Feb 2015	A1
20150071994	Schentag et al.	Mar 2015	A1
20150093824	Satishchandran et al.	Apr 2015	A1
20150125485	Dubensky, Jr. et al.	May 2015	A1
20150125921	Kotelko et al.	May 2015	A1
20150132335	Malouin et al.	May 2015	A1
20150140028	Sad et al.	May 2015	A1
20150140034	Dominowski et al.	May 2015	A1
20150140037	Galan et al.	May 2015	A1
20150165011	Lubenau	Jun 2015	A1
20150174178	Kovarik et al.	Jun 2015	A1
20150182611	Kopecko et al.	Jul 2015	A1
20150184167	Fruehauf et al.	Jul 2015	A1
20150190500	Berghman et al.	Jul 2015	A1
20150196659	Leenhouts et al.	Jul 2015	A1
20150202276	Lewinsohn et al.	Jul 2015	A1
20150204845	De Armas et al.	Jul 2015	A1
20150218254	Sabbadini et al.	Aug 2015	A1
20150219645	Lewinsohn et al.	Aug 2015	A1
20150225692	Bhatia et al.	Aug 2015	A1
20150238589	Gunn et al.	Aug 2015	A1
20150258190	Grandi	Sep 2015	A1
20150265696	Gourapura et al.	Sep 2015	A1
20150273045	Kolander et al.	Oct 2015	A1
20150316567	Salha et al.	Nov 2015	A1
20150321037	Li et al.	Nov 2015	A1
20150335736	Reed et al.	Nov 2015	A1
20150343050	Gunn	Dec 2015	A1
20150359909	O'Sullivan et al.	Dec 2015	A1
20150376242	Oloo et al.	Dec 2015	A1
20160000896	Carboulec et al.	Jan 2016	A1
20160022592	Kabadi et al.	Jan 2016	A1
20160028148	Tan et al.	Jan 2016	A1
20160030494	Henn et al.	Feb 2016	A1
20160045591	Campos-Neto et al.	Feb 2016	A1
20160054299	De Armas et al.	Feb 2016	A9
20160058860	Reed et al.	Mar 2016	A1
20160074505	Kovarik et al.	Mar 2016	A1
20160090395	Maj et al.	Mar 2016	A1
20160101168	Husseiny Elsayed et al.	Apr 2016	A1
20160103127	Lewinsohn et al.	Apr 2016	A1
20160108096	Thompson et al.	Apr 2016	A1
20160136285	Gozdziewicz et al.	May 2016	A1
20160136294	Leenhouts et al.	May 2016	A1
20160158334	Giacalone	Jun 2016	A1
20160158335	Bagnoli et al.	Jun 2016	A1
20160169921	Orth et al.	Jun 2016	A1
20160175415	Dubensky, Jr. et al.	Jun 2016	A1
20160175428	Tang et al.	Jun 2016	A1
20160193256	Honda et al.	Jul 2016	A1
20160193257	Honda et al.	Jul 2016	A1
20160199422	Newman	Jul 2016	A1
20160199474	Ramachandran et al.	Jul 2016	A1
20160206727	Haiwick et al.	Jul 2016	A1
20160208261	Satishchandran et al.	Jul 2016	A1
20160213770	Ilg et al.	Jul 2016	A1
20160220652	Petit et al.	Aug 2016	A1
20160222393	Bermudes	Aug 2016	A1
20160228523	Newman	Aug 2016	A1
20160228530	Paterson	Aug 2016	A1
20160243204	Ny et al.	Aug 2016	A1
20160250311	Lubenau	Sep 2016	A1
20160263209	Gunn	Sep 2016	A1
20160289287	Hancock et al.	Oct 2016	A1
20160317637	Agrawal et al.	Nov 2016	A1
20160324783	Fox et al.	Nov 2016	A1
20160324939	Allan	Nov 2016	A1
20160346381	Qiao et al.	Dec 2016	A1
20160354462	Campos-Neto et al.	Dec 2016	A1
20160366862	Havell et al.	Dec 2016	A1
20160367650	Paterson	Dec 2016	A1
20160369282	Li et al.	Dec 2016	A1
20170007683	Mueller et al.	Jan 2017	A1
20170014513	O'Connell et al.	Jan 2017	A1
20170015735	Schwarz et al.	Jan 2017	A1
20170021011	Kovarik et al.	Jan 2017	A1
20170028048	Lewinsohn et al.	Feb 2017	A1
20170042987	D'Souza	Feb 2017	A1
20170042996	Wallecha et al.	Feb 2017	A1
20170051260	Bermudes et al.	Feb 2017	A1
20170072042	Fergen et al.	Mar 2017	A1
20170080078	Gourapura et al.	Mar 2017	A1
20170081642	Chaplin et al.	Mar 2017	A1
20170081671	Diamond et al.	Mar 2017	A1
20170095548	Malouin et al.	Apr 2017	A1
20170106028	Fujiwara et al.	Apr 2017	A1
20170106074	Alonso et al.	Apr 2017	A1
20170114319	Le Gouellec et al.	Apr 2017	A1
20170129942	Plante et al.	May 2017	A1
20170136102	Sharma	May 2017	A1
20170136111	Nano	May 2017	A1
20170143815	Giacalone	May 2017	A1
20170145061	Lu et al.	May 2017	A1
20170145065	Haagsman et al.	May 2017	A1
20170151321	Luo et al.	Jun 2017	A1
20170157232	Bremer et al.	Jun 2017	A1
20170157239	Bermudes	Jun 2017	A1
20170174746	Sad et al.	Jun 2017	A1
20170182155	Reed et al.	Jun 2017	A1
20170191058	De Armas et al.	Jul 2017	A1
20170209502	Honda et al.	Jul 2017	A1
20170216378	Honda et al.	Aug 2017	A1
20170240615	Shapiro	Aug 2017	A1
20170246281	Super et al.	Aug 2017	A1
20170258885	Luirink et al.	Sep 2017	A1
20170290889	Loke et al.	Oct 2017	A1
20170290901	Talaat	Oct 2017	A1
20170304434	Dominowski et al.	Oct 2017	A1
20170318817	Padmanabhan et al.	Nov 2017	A1
20170327830	Curtiss et al.	Nov 2017	A1
20170340720	Bagnoli et al.	Nov 2017	A1
20170350890	Cirillo et al.	Dec 2017	A1
20170360540	Jackwood et al.	Dec 2017	A1
20170368156	Husseiny Elsayed et al.	Dec 2017	A1
20170368166	Gunn	Dec 2017	A1
20180008701	Dominowski et al.	Jan 2018	A1
20180021424	Dominowski et al.	Jan 2018	A1
20180028642	Cherpes et al.	Feb 2018	A1
20180028649	Reed et al.	Feb 2018	A1
20180043021	Schwarz et al.	Feb 2018	A1
20180044406	Schwarz et al.	Feb 2018	A1
20180049413	Havell et al.	Feb 2018	A1
20180050099	Gunn et al.	Feb 2018	A1
20180066041	Szij Rto et al.	Mar 2018	A1
20180066225	Choi et al.	Mar 2018	A1
20180071377	Putnam et al.	Mar 2018	A1
20180087060	Fruehauf et al.	Mar 2018	A1
20180099999	Thompson et al.	Apr 2018	A1
20180104328	Qiao et al.	Apr 2018	A1
20180140665	Giacalone	May 2018	A1
20180147278	Klocke et al.	May 2018	A1
20180164221	Singh et al.	Jun 2018	A1
20180168488	Jones et al.	Jun 2018	A1
20180168489	Jones et al.	Jun 2018	A1
20180168490	Jones et al.	Jun 2018	A1
20180169222	Lopez	Jun 2018	A1
20180169226	Reed et al.	Jun 2018	A1
20180185469	Gourapura et al.	Jul 2018	A1
20180193003	Jones et al.	Jul 2018	A1
20180193441	Rubio Nistal et al.	Jul 2018	A1
20180206726	Singh et al.	Jul 2018	A1
20180206769	Pak et al.	Jul 2018	A1
20180221286	Kabadi et al.	Aug 2018	A1
20180221470	Reed et al.	Aug 2018	A1
20180236063	Reed et al.	Aug 2018	A1
20180243347	Agrawal et al.	Aug 2018	A1
20180243348	Honda et al.	Aug 2018	A1
20180271787	Tardi et al.	Sep 2018	A1
20190017057	Bermudes	Jan 2019	A1
20190055569	Lesser et al.	Feb 2019	A1

Foreign Referenced Citations (23)

Number	Date	Country
0973911	Jan 2000	EP
1270730	Jan 2003	EP
1402036	Mar 2004	EP
1407052	Apr 2004	EP
1068339	Jul 2008	EP
WO0047222	Aug 2000	WO
WO0125397	Apr 2001	WO
WO02067983	Sep 2002	WO
WO02074336	Sep 2002	WO
WO2002070645	Sep 2002	WO
WO02083214	Oct 2002	WO
WO02087494	Nov 2002	WO
WO03014380	Feb 2003	WO
WO2004016281	Feb 2004	WO
WO2005005630	Jan 2005	WO
WO2005018332	Mar 2005	WO
WO2005054477	Jun 2005	WO
WO2006017929	Feb 2006	WO
WO2006048344	May 2006	WO
WO2008073148	Jun 2008	WO
WO2008089132	Jul 2008	WO
WO2009021548	Feb 2009	WO
WO2009126189	Oct 2009	WO

Non-Patent Literature Citations (5)

Entry
Sievers et al. 2020 (Clinical Trials Indentifier: NCT04334980; bacTRL-Spike-1; Symvivo Corporation; first posted Apr. 6, 2020; https://www.clinicaltrials.gov/ct2/show/ NCT04334980 (Year: 2020).
Symvivo's bacTRL product information; 2019 (Year: 2019).
Diamond et al. 2020 (The Challenges of Vaccine Development against a New Virus during a Pandemic; Cell Host& Microbe; 27: 699-703). (Year: 2020).
Wang et al. 2020 (An Evidence Based Perspective on mRNA-SARS-CoV-2 Vaccine Development; Medical Science Monitor 26: 2924700 (Year: 2020).
Ciotti et al. 2019 (COVID-19 Outbreak: An Overview; Chemotherapy 64:215-223; published online Apr. 7, 2020) (Year: 2020).

Expression of SARS-CoV-2 spike protein receptor binding domain in attenuated salmonella as a vaccine

Information

Patent Number

Date Filed

Date Issued

Inventors

Examiners

Agents

CPC

Field of Search

US

International Classifications

Abstract

Description

Claims

US Referenced Citations (1194)

Foreign Referenced Citations (23)

Non-Patent Literature Citations (5)