Patent Application
20220096598
The present invention relates to the field of biopharmaceuticals.
Specifically, the present invention relates to a fibroblast growth factor 21 variant, more specifically, relates to a fusion protein containing such fibroblast growth factor 21 variant, a GLP-1 variant and a FC sequence, and a use thereof.
The sedentary lifestyle and excessive calorie intake of modern people are exacerbating the globe epidemic of obesity, non-alcoholic fatty liver and type 2 diabetes. Such defects on energy metabolism can further induce severe cardiovascular diseases or even tumors. However, currently, effective treatments for obesity and related complications are very limited, and thus, there is an urgent need for a new drug that has less side effects and can correct the imbalance of energy metabolism.
Fibroblast growth factor 21 (FGF21) is a member of the fibroblast growth factor (FGF) family. It is an important metabolic regulator that is involved in regulating the balance between energy and glucolipid metabolism by activating FGF receptors (FGFRs) and co-receptor β-klotho (KLB) of the tyrosine kinase transmembrane receptor family (Sonoda J, Chen M Z, Baruch A. Hormone Molecular Biology and Clinical Investigation, 2017, 30(2):1-13). The wild-type human FGF21 is a secreted polypeptide containing 181 amino acids, which has an amino acid sequence homology with mouse FGF21 of 81%. N-terminus of human FGF21 sequence is involved in the interaction with FGFRs, meanwhile C-terminus is essential for binding the co-receptor KLB (Micanovic R, Raches D W, Dunbar J D, etc. Journal of Cellular Physiology, 2009, 219(2):227-234). FGF21 can relieve hyperglycemia, reduce triglyceride levels and improve lipid metabolism mainly by activating AMPK/SIRT1/PGC1α (Chau M D, Gao J, Yang Q, etc. Proceedings of the National Academy of Sciences USA, 2010, 107(28):12553-12558). FGF21 is considered to be an effective target for the treatment of various metabolic diseases. For example, by injecting recombinant FGF21 protein into mice and subjects, serum glucose, triglyceride and cholesterol levels can be reduced, insulin sensitivity can be increased, energy metabolism can be promoted, and fatty liver and obesity can be relieved (Hecht R, Li Y S, Sun J et al. PLoS One, 2012, 7(11): e49345; Kharitonenkov A, Beals J M, Micanovic R, et al. PLoS One, 2013, 8(3): e58575). The half-life of FGF21 in the body is very short, and in primates, it's only 0.5-2h. Moreover, in the blood, FGF21 is tended to be cleaved by protease DPPIV at P2 and P4 sites on N-terminus and cleaved by fibroblast activation protein (FAP) at P171 site on C-terminus, thereby losing its activity (Sonoda J, Chen M Z, Baruch A. Hormone Molecular Biology and Clinical Investigation, 2017, 30(2):1-13). These problems have become huge challenges in the development of FGF21 as a drug for the treatment of metabolic diseases.
Glucagon-like peptide-1 (GLP-1) is a member of the glucagon peptide family, an endogenous incretin, involved in the process of glucose transport and metabolism (Lee S, Lee D Y. Annals of Pediatric Endocrinology & Metabolism, 2017, 22(1):15-26). There are two forms of GLP-1 in the human body, i.e., GLP-1 (7-36) mainly secreted by pancreatic tissue, and GLP-1 (7-37) mainly secreted by the intestine. GLP-1 can activate the downstream cAMP-dependent signaling pathway by activating GLP-1 receptor (GLP-1R) of G protein-coupled receptor family. GLP-1 receptor agonists are also currently attractive targets for the treatment of type 2 diabetes, and a variety of drugs, such as Novo Nordisk's liraglutide and Eli Lilly's Dulaglutide, have been approved for clinical use in the treatment of type 2 diabetes. These GLP-1 receptor agonist drugs also have the effect of losing weight, which is, however, mainly achieved by suppressing the appetite and controlling the food intake, thereby greatly reducing the patient's quality of life (Glaesner W, Vick A M, Millican R, etc. Diabetes/Metabolism Research and Review, 2010, 26(4): 287-296).
Although a considerable progress of the research of fusion protein has been made in the past few years, and the glorious prospect of its ultimate clinical application can be expected, generally, when directly prepared based on the wild-type protein sequence, the spatial structure of the fusion protein will be affected, and therefore, its activity will be affected. The patent application CN201280 057819.0 has disclosed a novel protein containing fibroblast growth factor (FGF21) and other metabolic regulators known to improve the metabolic profile of the subject, including its variants. Also disclosed are methods for the treatment of FGF21 related diseases, GLP-1 related diseases and Exendin-4 related diseases, including metabolic conditions. However, the fusion protein obtained in this publication has no activity high enough, it has to be administered frequently in actual clinical use, and its clinical compliance is needed to be further improved.
Therefore, there is still a need for therapeutic agents for FGF21-related diseases with higher activity and better compliance.
In view of the above-mentioned problems of the prior art, the present invention provides a fusion protein with GLP-1 and FGF21 activities, and a method for preparing the same and a use thereof as well. Also provided is a use of the protein according to the present invention for treating or preventing metabolic diseases including obesity, hyperlipidemia, diabetes, and cardiovascular and cerebrovascular diseases. Compared with the prior art, the fusion protein according to the present invention has higher activity, longer half-life and a novel structure, and can significantly reduce blood sugar, blood fat, body weight and improve fat metabolism.
Specifically, the object of the present invention is to provide the following aspects.
In one aspect, the present invention provides a human fibroblast growth factor 21 (FGF21) variant having an amino acid sequence as shown in the following general formula I:
wherein,
X15 is Arg or Val, X94 is Leu or Arg, X114 is Leu or Cys, X130 is Ala or Cys, and X176 is Ala or Glu;
one and only one of X94 and X114 is Leu, and at most one of X94 and X114 is Ala;
and preferably, the amino acid sequence of the variant is as shown in any one of SEQ ID NO:1-4.
In another aspect, the present invention provides a fusion protein represented by the following general formula:
G-L-Fc-L-F, or G-L-G-L-Fc-L-F;
wherein,
F represents the human FGF21 variant according to the present invention;
G represents a GLP-1 variant (GLP-lv) having an amino acid sequence shown in SEQ ID NO:5;
L represents a linker sequence;
FC represents human or animal immunoglobulin and its subtypes and variants, human or animal albumin and its variants, or PEG.
In the fusion protein according to the present invention, the general formula of L is (GGGGS)n, wherein n is an integer from 0 to 5, preferably is 3. FC preferably represents an IgG4FC fragment, and more preferably contains the amino acid sequence shown in SEQ ID NO:17.
According to the present invention, the fusion protein further contains other antigens, functional amino acid sequences and/or signal peptide sequences. Preferably, the functional amino acid sequences are histidine tags or GST tags. Preferably, the amino acid sequence of the fusion protein is as shown in any one of SEQ ID NO: 6-9, 18, or 24-26.
In yet another aspect, the present invention provides a fusion gene, containing the coding nucleotide sequence of the human FGF21 variant or the fusion protein according to the present invention. The coding nucleotide sequence of the FGF21 variant is as shown in any one of SEQ ID NO:20-23. The coding nucleotide sequence of the fusion protein is as shown in any one of SEQ ID NO:10-13, 19, or 27-29.
In still another aspect, the present invention provides an expression construct, containing the coding nucleotide sequence of the human FGF21 variant or the fusion protein according to the present invention.
The expression construct according to the present invention is a prokaryotic expression construct, which is preferably a pET vector system.
Alternatively, the expression construct according to the present invention is an eukaryotic expression construct, which is preferably a plasmid DNA vector, preferably pVAX1 vector and pSV1.0 vector; a recombinant viral vector, preferably recombinant vaccinia virus vector, recombinant adenovirus vector, or recombinant adeno-associated virus vector; or a retroviral vector, preferably HIV virus vector, or lentiviral vector.
In still another aspect, the present invention provides a host cell, containing the expression construct according to the present invention. Preferably, when the expression construct is a prokaryotic expression construct, the host cell is a prokaryotic cell, preferably bacterial cell; alternatively, when the expression construct is a eukaryotic expression construct, the host cell is a eukaryotic cell, preferably mammalian cell, more preferably CHO cell.
In still another aspect, the present invention provides a pharmaceutical composition, comprising the human FGF21 variant or the fusion protein according to the present invention.
In still another aspect, the present invention provides a method for preparing a human FGF21 variant or a fusion protein, comprising the step of cloning the coding nucleotide sequence of the fusion protein into an expression vector.
Preferably, the method comprises the steps as follows:
and more preferably, in step 3), the host cell is a CHO-S cell.
The present invention also provides a use of the above-mentioned human FGF21 variant, the fusion protein, the fusion gene, the expression construct, the host cell, or the pharmaceutical composition in the preparation of drugs for obesity, hyperlipidemia, diabetes, and cardiovascular and cerebrovascular diseases.
The amino acid sequences of the human FGF21 variants (FGF21v) Fv2, Fv3, Fv4 and Fv5 of the present invention are shown in SEQ ID NOs: 1, 2, 3 and 4:
The nucleotide sequences of the human FGF21 variants (FGF21v) Fv2, Fv3, Fv4 and Fv5 of the present invention are shown in SEQ ID NOs: 20, 21, 22 and 23:
Compared with the prior art, the present invention has the following advantages:
In the embodiments of the present invention, the activity of the fusion protein according to the present invention was evaluated, utilizing a normal mouse glucose load model of low-density lipoprotein-deficient mice and taking dulaglutide as a positive control drug. The results showed that the fusion protein according to the present invention has a good curative effect and obvious advantages in the treatment of hyperlipidemia.
Hereinafter, the embodiments of the present invention will be described in detail with reference to the drawings, in which:
The present invention will be further described in detail below through the embodiments and examples. Through these descriptions, the characteristics and advantages of the present invention will become clearer.
The term “exemplary” herein means “serving as an example, embodiment, or illustration.” Any embodiment described herein as “exemplary” need not be construed as being superior to or better than other embodiments.
Unless otherwise specified, the reagents used in the following examples are analytical grade reagents, and are commercially available.
Example 1 Preparation of the Fusion Protein of the Present Invention
The fusion protein was prepared by the conventional technical means of the present invention, specifically including the following step of: utilizing pcDNA3.4-TOPO TA cloning kit (purchased from Invitech (Shanghai) Trading Co., Ltd.) to construct pcDNA3.4 plasmid containing the fusion protein (the plasmid map was shown in
The fusion protein according to the present invention can be obtained after purificated by the method as described below: the supernatant was filtered with a 0.22 μm membrane to remove cell debris; protein A affinity column HiTrap MabSelect SuRe (purchased from General Electric Company) was treated with 5 column volumes of equilibration buffer (5.6 mM NaH2PO4, 14.4 mM Na2HPO4, 0.15M NaCl, pH7.2), and then the supernatant was loaded; after loading, the poorly bound contaminated proteins were washed off to the baseline with buffer (5.6 mM NaH2PO4.H2O, 14.4 mM Na2HPO4, 0.5 M NaCl, pH7.2); the protein was eluted with the eluent of 50 mM citric acid/sodium citrate buffer (containing 0.02% Tween-80+5% mannitol, pH3.2), and then was adjusted to pH7.0 by using 1M Tris-Cl (pH8.0). The purified sample was filtered through a 0.22 μm membrane and sterilized, and then stored at 4° C.
Specifically, the fusion protein according to the present invention can be represented by the general formulas of GL-Fc-L-Fv2, GL-Fc-L-Fv3, GL-Fc-L-Fv4, and GL-Fc-L-Fv5, the amino acid sequences were as shown in SEQ ID NO:6-9, respectively, and the nucleotide sequences were as shown in SEQ ID NO:10-13, respectively.
G-L-Fc-L-Fv2 SEQ ID NO:6 (the part in bold represents the amino acid sequence of the GLP-1 variant, the part in bold italics represents the amino acid sequence of the linker sequence, and the part underlined represents the amino acid sequence of Fc):
HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
AESK
YGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDP
EVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKC
KVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGN
VFSCSVMHEALHNHYTQKSLSLSLG
DSSPLLQFGG
G-L-Fc-L-Fv3 SEQ ID NO:7 (the part in bold represents the amino acid sequence of the GLP-1 variant, the part in bold italics represents the amino acid sequence of the linker sequence, and the part underlined represents the amino acid sequence of Fc):
AES
KYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQE
DPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKE
YKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSR
WQEGNVFSCSVMHEALHNHYTQKSLSLSLG
DSSP
G-L-Fc-L-Fv4 SEQ ID NO:8 (the part in bold represents the amino acid sequence of the GLP-1 variant, the part in bold italics represents the amino acid sequence of the linker sequence, and the part underlined represents the amino acid sequence of Fc):
HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
AESK
YGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDP
EVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKC
KVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGN
VFSCSVMHEALHNHYTQKSLSLSLG
DSSPLLQFGG
G-L-Fc-L-Fv5 SEQ ID NO:9 (the part in bold represents the amino acid sequence of the GLP-1 variant, the part in bold italics represents the amino acid sequence of the linker sequence, and the part underlined represents the amino acid sequence of Fc):
HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
AESK
YGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDP
EVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKC
KVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGN
VFSCSVMHEALHNHYTQKSLSLSLG
DSSPLLQFGG
Additionally, the inventors prepared a wild-type G-L-Fc-L-F fusion protein, having an amino acid sequence as shown in SEQ ID NO:14:
The nucleotide sequence of said fusion protein was as shown in SEQ ID NO:15.
The nucleotide sequence of the signal peptide used in said fusion protein was shown in SEQ ID NO:16:
Example 2 Effect of the Fusion Protein According to the Present Invention on the AMPK Signal Pathway of HepG2 Cells
HepG2 cells (obtained from the Academy of Military Medical Sciences) were cultured to a confluence of more than 90% by using DMEM medium containing 10% FBS, and then were digested and resuspended to be inoculated into a 6-well plate according to 2.5×105 cells per well. Then, 2 mL of DMEM medium containing 10% FBS was added into each well to culture the cells overnight at 37° C. and 5% CO2 saturated humidity up to 70%-80% saturation. Subsequently, the original medium was removed and replaced by a fresh pre-warmed serum-free DMEM medium. After cultured for another 6 hours, 100 nM purified wild-type fusion protein G-L-Fc-L-F(GF) and its four mutants G-L-Fc-L-Fv2(GFv2), G-L-Fc-L-Fv3(GFv3), G-L-Fc-L-Fv4(GFv4), G-L-Fc-L-Fv5(GFv5) were added. After treated for 24 hours, the culture supernatant was removed, and the cells were digested and collected. Then, the cells were washed once with pre-cooled PBS, and lysed by using RIPA lysis buffer containing 1% PMSF (purchased from Beijing Kangwei Century Biotechnology Co., Ltd.) to extract total protein according to the instruction. 15 μL of total protein was taken to detect the expression levels of total AMPK (AMPKα antibody) and phosphorylated AMPK (pAMPK, phospho-AMPKα (Thr172) antibody) in the cells (both antibodies were purchased from Cell Signaling Technologies) by immunoblotting.
The results were shown in
Example 3 Comparison of the Activation Effects of GF Fusion Protein and its Mutants on GLP1 Receptor and FGF21 Receptor
The HEK293 cells (HEK293-GLP1R/β-klotho/CRE-Luciferase) expressing GLP1 receptor, FGF21 co-receptor (β-klotho) and CRE-luciferase inducible expression system were cultured to a confluence of more than 90% by using DMEM medium containing 10% FBS, and then were digested and resuspended to be inoculated into a 96-well plate according to 4×104 cells per well. Then, 100 μL of DMEM medium containing 10% FBS was added into each well to culture the cells overnight at 37° C. and 5% CO2 saturated humidity. On the second day, a wild-type fusion protein G-L-Fc-L-F(GF) and its four mutants G-L-Fc-L-Fv2(GFv2), G-L-Fc-L-Fv3(GFv3), G-L-Fc-L-Fv4(GFv4), G-L-Fc-L-Fv5(GFv5) with different concentration gradients (0, 0.001, 0.01, 0.1, 1, 10, 100 nM) were added. After treated for 6-8h, the culture supernatant was removed, and the cells were washed twice with PBS and lysed according to the instructions to detect the expression of luciferase (using a single luciferase reporter gene detection kit, purchased from Beijing Yuanpinghao Biotechnology Co., Ltd.). By analyzing the data with a software Graphpad Prism, EC50 value of a GF protein was obtained and as shown in Table 1. The results showed that EC50 values of the four mutants were all lower than that of the wild-type fusion protein GF, indicating that the four mutants had a better effect of activating two receptors at the same time. Among them, the mutant GFv5 had the lowest EC50 value, indicating that it had the highest activity.
Example 4 Construction and Expression of GGF Fusion Protein with New Structure and Analysis of its Activity
Based on the four GF mutants, fusion proteins GGFv2, GGFv3, GGFv4, GGFv5 with new structures were constructed and expressed.
Specifically, the fusion proteins with new structures were represented by general formulas of G-L-G-L-Fc-L-Fv2 (GGFv2), G-L-G-L-Fc-L-Fv3 (GGFv3), G-L-G-L-Fc-L-Fv4 (GGFv4), G-L-G-L-Fc-L-Fv5 (GGFv5). Their amino acid sequences were as shown in SEQ ID NO:24-26 and 18, respectively. Their nucleotide sequences were as shown in SEQ ID NO:27-29 and 19.
The amino acid sequence of G-L-G-L-Fc-L-Fv2 was as shown in SEQ ID NO:24:
The amino acid sequence of G-L-G-L-Fc-L-Fv3 was as shown in SEQ ID NO:25:
The amino acid sequence of G-L-G-L-Fc-L-Fv4 was as shown in SEQ ID NO:26:
The amino acid sequence of G-L-G-L-Fc-L-Fv5 was as shown in SEQ ID NO:18:
The nucleotide sequence of G-L-G-L-Fc-L-Fv2 was as shown in SEQ ID NO:27; the nucleotide sequence of G-L-G-L-Fc-L-Fv3 was as shown in SEQ ID NO:28; the nucleotide sequence of G-L-G-L-Fc-L-Fv4 was as shown in SEQ ID NO:29; the nucleotide sequence of G-L-G-L-Fc-L-Fv5 was as shown in SEQ ID NO:19.
The activation effects of four purified GGFv proteins on GLP1 receptor and FGF21 receptor were evaluated by using HEK293-GLP1R/β-klotho/CRE-Luciferase cells. See Example 3 for specific methods. As shown in
Example 5 Verifying the Biological Activity of Bifunctional Protein in Hyperlipidemia Model Mice
24 low-density lipoprotein-deficient mice (Ld1r−/− mice) (purchased from Jiangsu Jicui Yaokang Biotechnology Co., Ltd.), 4-8 weeks old, were fed with high-fat diet (containing 60% fat, purchased from Beijing Bai Ao Biotech Co., Ltd.) for 2 weeks, and then they became hyperlipidemia model mice. The mice were divided into 4 groups according to random body weights: control group (con, saline), G group (duraglutide), GFv5 group (GFv5 protein), GGFv5 group (GGFv5 protein), and each group had 6 mice. A dosage of 20 nmol/kg was administrated to each group twice a week by means of subcutaneous injection. The random body weights of mice were weighed and recorded every week. After 4 weeks of treatment, serum biochemical indicators were detected as follows: taking blood from eyeballs of mice; centrifuging at 3000 rpm for 10 minutes to separate serum; and sending samples to Beijing North Biomedical Technology Co., Ltd. for detecting triglyceride (TG), total cholesterol (TG), high-density lipids Protein (HDL), and low-density lipoprotein (LDL) indicators.
The results as shown in
The results as shown in
The above description of the embodiments does not constitute any limitation to the scope of the present invention. Within the spirit of the present invention, various changes or modifications can be made by those skilled in the art, all of which fall within the scope of the appended claims.
| Number | Date | Country | Kind |
|---|---|---|---|
| 201910093697.4 | Jan 2019 | CN | national |
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/CN2019/120357 | 11/22/2019 | WO | 00 |
