Many antibodies have been developed to treat central nervous system (CNS) disorders. However, to date there are no US Food and Drug Administration-approved monoclonal antibodies that show efficacy in the brain following systemic administration. A major reason is likely due to the fact that the biological activity of therapeutic monoclonal antibodies and other recombinant protein therapeutics is limited by their ability to cross the blood-brain barrier (“BBB”).
The “blood-brain barrier” is a term used to describe the unique properties of the microvasculature of brain. Brain blood vessels are continuous non-fenestrated vessels, but also contain a series of additional properties that allow them to tightly regulate the movement of molecules, ions, and cells between the blood and the brain. This heavily restricting barrier capacity allows BBB endothelial cells to tightly regulate CNS homeostasis, which is critical to allow for proper neuronal function, as well as protect the CNS from toxins, pathogens, inflammation, injury, and disease. However, the restrictive nature of the BBB, also provides an obstacle for drug delivery to the CNS, especially for large proteins such as antibodies. Typically, less than 0.1% of the injected dose of IgG reaches the brain after peripheral administration, and it is difficult to achieve sufficient concentrations of antibodies in the brain to produce a therapeutic response. The development of antibodies that are able to penetrate the brain at pharmacologically relevant levels is a key therapeutic goal for the treatment of many CNS disorders.
Various methods have been investigated to improve brain exposure to various types of biologics, including antibodies, and avoid the need for direct injection into the cerebrospinal fluid which requires hospitalization of the patient, is highly invasive and can easily cause infection. The most direct approach is to disrupt the tight junctions to allow for paracellular passage. However, this is an unselective procedure for the entry of large molecules as it allows entrance not only for the therapeutic agent but also for other blood components that could be harmful to the brain environment. A similar approach is to use mannitol, an osmotic agent that causes shrinkage of the brain endothelial cells. However, this agent induces rapid, widespread BBB opening and exposes the brain tissue to potentially toxic components of the circulatory system. Another similar approach is the use of focused ultrasound. This is a method of transiently increasing permeability of the BBB at specific brain regions, but again allows non-selective crossing of the BBB and therefore exposure to potentially harmful blood-borne substances.
Macromolecules such as monoclonal antibodies (“mAbs”) can utilize three types of vesicle to traverse brain endothelial cells: (i) clathrin-coated vesicles, (ii) caveolae domains generated from lipid rafts, and (iii) macropinocytotic vesicle. For transcytosis of large molecules, which primarily uses clathrin-coated vesicles, a receptor is required for uptake and trafficking across the brain endothelial cells. This process has been termed “receptor-mediated transcytosis” (“RMT”). This is the only known vesicular system that is selective in cargo delivery as it is coordinated by a specific receptor upon binding. This inherent selectivity is highly advantageous and therefore most attempts to transport large molecules across the BBB have used RMT-based approaches, for example by using transferrin-containing nanoparticles or bispecific antibodies comprised of an arm against the receptor and a second against the therapeutic target.
As multimeric proteins, comprised of more than one polypeptide chain linked together by disulphide bonds, antibodies present special challenges with respect to RMT and transport through the BBB.
Bispecific antibodies using RMT have only resulted in relatively modest increase in the amount of mAb reaching the brain parenchyma, in most cased to the level of about 1% of the injected amount. Moreover, monovalent antibodies may reduce efficacy against the therapeutic target. Additionally, bispecific antibodies add significantly to the complexity of development and to the cost of manufacture. It would be desirable to have a method that does not require an antibody ligand to the receptor (i.e., the arm against the receptor of the bispecific antibody) and that does not interfere with the binding of the natural ligand, for example, binding of transferrin to the transferrin receptor since this could interfere with the physiological transport function of the receptor, which in the case of transferrin is to transport iron.
Importantly, papers based on cellular and in vivo data describe the importance of the mode of BBB receptor engagement where avidity (Wiley et al., 2013), affinity (Bien-Ly et al., 2014) and valency (Niewoehner et al., 2014) of the antibody have a profound effect on the transport efficiency across the brain endothelial cells. Data also indicate that endogenous ligand binding might influence the receptor differently compared with an engineered mAb, which may bind to a different epitope. These papers provide strong evidence that engagement with transcytosis receptors, directly influences the intracellular sorting, which in certain formats, leads to unproductive transport and entrapment within the endosomal system of the brain endothelial cells. This unproductive crossing of the BBB has been described using traditional mAbs (Moos and Morgan, 2001; Manich et al., 2013). Thus, the initial interaction between the ligand and the receptor at the BBB lumen determines the fate of the internalized complex. These findings highlight the need to understand the intracellular trafficking of the ligand-cargo receptor complex in order to generate constructs that will successfully be sorted through the brain endothelial cells to the parenchyma space of the brain.
When studying macromolecule transcytosis, the BBB has been regarded as a “black box”, with very little attention in trying to understand the intracellular trafficking across brain endothelial cells. Thus, the regulation of intracellular transport through the transcytosis pathway in brain endothelial cells remains largely unexplored.
It is an object of the invention to provide methods of delivering proteins across the BBB.
It is a further object of the invention to provide methods of delivering peptides across the BBB.
It is an additional object of the invention to provide methods of delivering antibodies across the BBB.
It is an additional object of the invention to provide methods of delivering non-antibody proteins across the BBB.
It is an additional object of the invention to provide fusion constructs for use in drug discovery, diagnosis, prevention and treatment of diseases.
It is yet an additional object of the invention to provide a synthetic fusion peptide that does not compete with transferrin (so should not interfere with iron transport) and avoids the complexity and cost associated with the development and manufacture of bispecific antibodies.
It is a further object of the invention to provide a peptide or protein (e.g., an antibody) fused to an amino acid sequence THRPPMWSPVWP (SEQ ID NO: 2), amino acid sequence HRPPMWSPVWP (SEQ ID NO: 3), amino acid sequence THRPPMWSPVW (SEQ ID NO: 4), amino acid sequence HRPPMWSPVW (SEQ ID NO: 5), or amino acid sequence HAIYPRH (SEQ ID NO: 28) at their carboxyl-termini or amino-termini.
In furtherance of the above objects and others, the present invention is directed in part to fusion constructs comprising a peptide or protein (e.g., an antibody) fused, directly or through a linker, to a peptide containing or consisting of amino acid sequence THRPPMWSPVWP (SEQ ID NO: 2), amino acid sequence HRPPMWSPVWP (SEQ ID NO: 3), amino acid sequence THRPPMWSPVW (SEQ ID NO: 4), amino acid sequence HRPPMWSPVW (SEQ ID NO: 5), or amino acid sequence HAIYPRH (SEQ ID NO: 28) at their carboxyl-termini or amino-termini. Amino acid sequence THRPPMWSPVWP (SEQ ID NO: 2), amino acid sequence HRPPMWSPVWP (SEQ ID NO: 3), amino acid sequence THRPPMWSPVW (SEQ ID NO: 4), amino acid sequence HRPPMWSPVW (SEQ ID NO: 5), and amino acid sequence HAIYPRH (SEQ ID NO: 28) modulates transport of the peptide or protein through the BBB and/or release of the peptide or protein at the abluminal side of the BBB. As compared to the unmodified peptide or protein, the fusion construct may (i) evade entrapment by or degrade at a slower rate in the endothelial endosomal-lysosomal system and/or (ii) have an improved BBB permeability, and/or (iii) have an improved brain retention. The fusion constructs may be used in drug discovery, diagnosis, prevention and treatment of diseases. The fusion construct may also be used in diagnostic assays and/or included as part of kits.
As compared to the unmodified peptide or protein, which is poorly taken up and then rapidly cleared by the lysosomal system, the fusion construct evades entrapment and/or degradation in the lysosomal system, and is released on the abluminal surface after the post-luminal surface uptake. The fusion construct may therefore provide a higher concentration of the peptide or protein, including diagnostic and therapeutic antibodies, in the brain (e.g., at about 3 hours, 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 12 hours, about 16 hours, about 18 hours, about 20 hours, about 22 hours, about 24 hours, etc.) from the time of exposure of the fusion construct to the BBB and/or a longer exposure to the fusion construct (e.g., at least about 10% longer), due to a reduced clearance or entrapment of the fusion construct by, e.g., lysosomes, as compared to an equal dose of the unmodified peptide or protein. Thus, the fusion construct may have a lower effective therapeutic dose than the unmodified peptide or protein.
In addition, as compared to the unmodified peptide or protein, the fusion construct of the invention are not substantially entrapped in the endosomal-lysosomal system and are released on the abluminal surface of the BBB.
The invention is specifically directed to a fusion construct of Formula I:
M-L-C (Formula I),
wherein M is a peptide or protein,
L is an optional linker, and
C is a peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28. M may be fused, directly or through L, to C at its carboxyl-termini or amino-termini, or both, and either bivalently or monovalently. M may have, e.g., a molecular weight of from about 2 kDa to about 30 kDa, 40 kDa to about 900 kDa, from about 50 kDa to about 800 kDa, from about 60 kDa to about 700 KDa, from about 70 kDa to about 600 kDa, from about 80 kDa to about 500 kDa, from about 90 kDa to about 400 kDa, from about 100 kDa to about 350 kDA, from about 100 kDa to about 300 kDa, from about 100 kDa to about 250 kDa, or from about 100 kDa to about 200 kDa. L may, e.g., be a peptide of sequence GGGS (SEQ ID NO: 6), or may be absent. The fusion construct preferably (i) avoids entrapment and degrades at a slower rate in the endothelial endosomal-lysosomal system than M that is not linked to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28, and/or (ii) has an improved blood-brain barrier permeability than M that is not linked to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28, and/or (iii) has an improved brain retention than M that is not linked to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28. In certain embodiments, M may, e.g., be an antibody or a non-antibody protein targeting full length or post-translationally modified tau protein; the antibody and the non-antibody protein may be therapeutic and used, e.g., for treatment of a tauopathy (e.g., Alzheimer's disease (AD), Pick's disease (PiD), progressive supranuclear palsy (PSP), corticobasal degeneration (CBD), frontotemporal lobar degeneration (FTLD), frontotemporal dementia (FTD), Parkinson's disease, traumatic brain injury (TBI), and the like), another neurodegenerative diseases in which tau pathology is implicated (e.g., Parkinson's disease, multiple sclerosis and amyotrophic lateral sclerosis), and age related cognitive impairment; or diagnostic and used in in vivo and/or in vitro assays and kits.
In an additional aspect, the invention is directed to a fusion construct of Formula I:
M-L-C (Formula I),
wherein M is selected from the group consisting of antibodies, adnectins, pronectins, affibodies, affilins, anticalins, atrimers, avimers, DARPins, fynomers, knottins, Kunitz domains, β-Hairpin mimetics, bicyclic peptides, and other non-antibody proteins; L is absent or an optional linker (e.g., a peptide of sequence GGGS (SEQ ID NO: 6)), and C is a peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28. The fusion construct preferably (i) avoids entrapment and degrades at a slower rate in the endothelial endosomal-lysosomal system than M that is not linked to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28, and/or (ii) has an improved blood-brain barrier permeability than M that is not linked to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28, and/or (iii) has increased brain retention than M that is not linked to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28. M may, e.g., be an antibody, and the amino-terminus of the peptide SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 39 is fused directly to either the carboxyl-terminus or the amino-terminus of light and/or heavy chain of the antibody, either bivalently or monovalently. In other words, the amino-terminus of the peptide SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 be fused to the carboxyl-terminus of the heavy chain of the antibody, or the amino-terminus of the peptide SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO:39 may be fused to both the carboxyl-terminus and the amino-terminus of light or heavy chain of the antibody, either bivalently or monovalently. The antibody may comprise (a) a heavy chain variable region comprising CDR1 represented by sequence GFTFNTYA (SEQ ID NO: 7), CDR2 represented by IRSKSNNYAT (SEQ ID NO: 8), and CDR3 represented by VGGGDF (SEQ ID NO: 9); and (b) a light chain variable region comprising CDR1 represented by sequence QEISVY (SEQ ID NO: 10), CDR2 represented by sequence GAF (SEQ ID NO: 11), and CDR3 represented by sequence LQYVRYPWT (SEQ ID NO: 12). Thus, the antibody may comprise (a) a heavy chain variable region comprising CDR1 identical to sequence GFTFNTYA (SEQ ID NO: 7), CDR2 identical to IRSKSNNYAT (SEQ ID NO: 8), and CDR3 identical to VGGGDF (SEQ ID NO: 9); and (b) a light chain variable region comprising CDR1 identical to sequence QEISVY (SEQ ID NO: 10), CDR2 identical to sequence GAF (SEQ ID NO: 11), and CDR3 identical to sequence LQYVRYPWT (SEQ ID NO: 12). The antibody may also comprise (a) a heavy chain variable region comprising CDR1 homologous to sequence GFTFNTYA (SEQ ID NO: 7), CDR2 homologous to IRSKSNNYAT (SEQ ID NO: 8), and CDR3 homologous to VGGGDF (SEQ ID NO: 9); and (b) a light chain variable region comprising CDR1 homologous to sequence QEISVY (SEQ ID NO: 10), CDR2 homologous to sequence GAF (SEQ ID NO: 11), and CDR3 homologous to sequence LQYVRYPWT (SEQ ID NO: 12). The antibody may have a binding affinity (KD) for TauC3 of from 1×10−9 to 1×10−12 and an off-rate (Kd) of 1×10−3 or less (e.g., from 1×10−4 to 1×10−2 s-1), and a binding affinity (KD) for SEQ ID NO:1 of from 1×10−4 to 1×10−8 M, or no detectable binding with SEQ ID NO:1. In certain embodiments, the antibody shows no detectable binding with SEQ ID NO: 1. The fusion constructs may be used in drug discovery, diagnosis, prevention and treatment of diseases. In certain embodiments, C has cross species reactivity and promotes transcytosis of the fusion construct in different species, including, e.g., humans, monkeys and mouse. In these embodiments, fusion constructs' cross reactivity in different species allows, e.g., for uses of the fusion constructs in pharmacokinetic (PK) and pharmacodynamic (PD) studies in animal models and subsequent extrapolation of the results of studies in animal models to humans.
The invention is specifically directed to a fusion construct of Formula II:
A-L-C (Formula II),
wherein A is an antibody,
L is an optional linker, and
C is a peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28. A may be fused to C at its carboxyl-termini or amino-termini of a light chain, a heavy chain, or both, directly or through L, and either monovalently or bivalently. L may, e.g., be a peptide of SEQ ID NO: 6. The antibody may have, e.g., a molecular weight of from about 40 kDa to about 900 kDa, from about 50 kDa to about 800 kDa, from about 60 kDa to about 700 KDa, from about 70 kDa to about 600 kDa, from about 80 kDa to about 500 kDa, from about 90 kDa to about 400 kDa, from about 100 kDa to about 350 kDA, from about 100 kDa to about 300 kDa, from about 100 kDa to about 250 kDa, or from about 100 kDa to about 200 kDa. The fusion construct preferably (i) avoids entrapment and degrades at a slower rate in the endothelial endosomal-lysosomal system than M that is not linked to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28, and/or (ii) has an increased blood-brain barrier permeability than M that is not linked to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28, and/or (iii) has an improved brain retention than M that is not linked to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28. As compared to the unmodified antibody, which may be poorly taken up and then entrapped by the lysosomal system, the fusion construct evades entrapment and/or degradation in the lysosomal system, and is released on the abluminal surface after the post-luminal surface uptake. The fusion construct may therefore provide a higher concentration of the antibody in the brain (e.g., at about 3 hours, 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 12 hours, about 16 hours, about 18 hours, about 20 hours, about 22 hours, about 24 hours, etc.) from the time of exposure of the fusion construct to the BBB and/or a longer exposure to the fusion construct (e.g., at least about 10% longer), due to a reduced clearance or entrapment of the fusion construct by, e.g., lysosomes, as compared to an equal dose of the unmodified peptide or protein. Thus, the fusion construct may have a lower effective therapeutic dose than the unmodified antibody.
The invention is further directed to a fusion construct of Formula III:
T-L-C (Formula III),
wherein T is an anti-TauC3 antibody,
L is an optional linker, and
C is a peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28. L may, e.g., be a peptide of SEQ ID NO: 6. The amino-terminus of the peptide SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, or SEQ ID NO: 5 may be fused, directly or through L, to the carboxyl-terminus or the amino-terminus of heavy or light, or both of T. In some embodiments, the amino terminus of a peptide containing sequence SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 is fused to the carboxyl-terminus of heavy chain of the anti-TauC3 antibody. The fusion construct preferably retains binding specificity of the anti-tauC3 antibody (i.e., have an equilibrium constant KD to tauC3 of ≥10−9M and is from about 2 to about 3 orders of magnitude higher than the antibody's equilibrium constant KD to FLT (SEQ ID NO:1), preferably, about 1000 times higher than FLT (SEQ ID NO:1)). As compared to the anti-TauC3 antibody, the fusion construct may have an improved penetration through the BBB and provide a higher concentration and duration of effect in the brain than an equal dose of anti-TauC3 antibody, due, e.g., to a reduced clearance of the fusion construct by lysosomes. The fusion construct preferably (i) degrades at a slower rate in the endothelial endosomal-lysosomal system than M that is not linked to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28, and/or (ii) has an improved blood-brain barrier permeability than M that is not linked to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28, and/or (iii) has an improved brain retention than M that is not linked to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28. In the preferred embodiments, the antibody retains its binding capability after being subjected to a temperature from about 40° C. to about 67° C. for 10 minutes and also retains its binding capability after incubation in serum (e.g., mouse) at 37° C. for 21 days. The anti-TauC3 antibody may have an aqueous solubility of 50 mg/ml or more (e.g., from about 50 mg/ml to about 200 mg/ml, from about 55 mg/ml to about 180 mg/ml, from about 55 mg/ml to about 170 mg/ml, from about 55 mg/ml to about 150 mg/ml, from about 55 mg/ml to about 140 mg/ml, from about 55 mg/ml to about 130 mg/ml; or from about 100 mg/ml to about 200 mg/ml, from about 100 mg/ml to about 180 mg/ml, from about 100 mg/ml to about 170 mg/ml, from about 100 mg/ml to about 150 mg/ml, from about 100 mg/ml to about 140 mg/ml, or from about 100 mg/ml to about 130 mg/ml).
In certain embodiments, T is an antibody described in U.S. application Ser. No. 16/838,235, filed on Apr. 2, 2020, herein incorporated by reference. In some of these embodiments, the antibody is an extremely potent humanized mAb that targets TauC3, a particularly noxious, nucleating, pre-tangle, intracellular and preferentially secreted, C-terminally truncated tau fragment ending at aspartate 421 which is highly correlated with cognitive decline in patients with early Alzheimer's disease and present throughout the evolution of neurofibrillary tangles. TauC3 exists in low abundance compared to full-length Tau (FLT) (2N4R) (SEQ ID NO:1) but was shown to exert a disproportionately large pathological effect contributing the majority of tau seeding activity in extracts of Alzheimer's brains. The murine precursor of TBL-100 (i.e., the antibody characterized in Nicholls, S. B., S. L. DeVos, C. Commins, C. Nobuhara, R. E. Bennett, D. L. Corjuc, E. Maury, et al. 2017. “Characterization of TauC3 antibody and demonstration of its potential to block tau propagation.” PLoS ONE 12 (5): e0177914. doi:10.1371/journal.pone.0177914, herein incorporated by reference, was shown to block this activity indicating its potential to prevent tau propagation in the brains of patients with Alzheimer's disease.
In some embodiments, the anti-tauC3 antibody, or an antigen-binding fragment thereof, fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 comprises (a) a heavy chain variable region comprising CDR1 represented by sequence GFTFNTYA (SEQ ID NO: 7), CDR2 represented by IRSKSNNYAT (SEQ ID NO: 8), and CDR3 represented by VGGGDF (SEQ ID NO: 9); and (b) a light chain variable region comprising CDR1 represented by sequence QEISVY (SEQ ID NO: 10), CDR2 represented by sequence GAF (SEQ ID NO: 11), and CDR3 represented by sequence LQYVRYPWT (SEQ ID NO: 12). In some of these embodiments, the antibody has a binding affinity (KD) for TauC3 of from 1×10−9 to 1×10−12 and an off-rate (Kd) of 1×10−3 or less (e.g., from 1×10−4 to 1×10−2 s−1), and a binding affinity (KD) for FLT (SEQ ID NO:1) of from 1×10−4 to 1×10−8 M, or no detectable binding with (SEQ ID NO:1).
In some embodiments, the anti-TauC3 antibody, or an antigen-binding fragment thereof, fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 comprises:
(a) a variable heavy chain comprising sequence LVQLVESGGGLVQPGGSLKLSCAASGFTFNTYAMNWVRQASGKGLEWVARIRSKS-NNYATYYAASVKGRFTISRDDSKSMAYLQMDSLKTEDTAVYYCVGGGDFWGQGTL VTVSS (SEQ ID NO: 13) or a sequence homologous to SEQ ID NO: 13; and
(b) the variable light chain comprising a sequence selected from the group consisting of DIQMTQSPSSLSASVGDRVTITCRASQEISVYLGWFQQKPGKAPKRLIYGAFKLQSGV PSRFSGSRSGTEFTLTISSLQPEDFATYYCLQYVRYPWTFGGGTKVEIK (SEQ ID NO: 14) or a sequence homologous to SEQ ID NO: 14,
DIQMTQSPSSLSASVGDRVTITCRASQEISVYLGWYQQKPGKAPKRLIYGAFT LQSGVPSRFSGSRSGTEYTLTISSLQPEDFATYYCLQYVRYPWTFGGGTKVEIK (SEQ ID NO: 15) or a sequence homologous to SEQ ID NO: 15,
DIQMTQSPSSLSASVGDRVTITCRASQEISVYLGWYQQKPGKAPKRLIYGAFSL QSGVPSRFSGSRSGTEYTLTISSLQPEDFATYYCLQYVRYPWTFGGGTKVEIK (SEQ ID NO: 16) or a sequence homologous to SEQ ID NO: 16,
DIQMTQSPSSLSASVGDRVTITCRASQEISVYLGWFQQKPGKAPKRLIYGAFKL QSGVPSRFSGSRSGTEYTLTISSLQPEDFATYYCLQYVRYPWTFGGGTKVEIK (SEQ ID NO: 17) or a sequence homologous to SEQ ID NO: 17, and
DIQMTQSPSSLSASVGDRVTITCRASQEISVYLSWFQQKPGKAIKRLIYGAFSL QSGVPSRFSGSRSGTEYTLTISSLQPEDFATYYCLQYVRYPWTFGGGTKVEIK (SEQ ID NO: 18) or a sequence homologous to SEQ ID NO: 18.
In some embodiments, the anti-TauC3 antibody fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 comprises a variable heavy chain (VH) polypeptide of SEQ ID NO: 13 and the variable light chain (VL) polypeptide of SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 17, or SEQ ID NO: 18.
In some embodiments, the anti-TauC3 antibody, or an antigen-binding fragment thereof, fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 comprises (a) a variable heavy chain (VH) polypeptide comprising CDR1 represented by SEQ ID NO: 7, CDR2 represented by SEQ ID NO: 8, and CDR3 represented by SEQ ID NO: 9, the variable heavy chain (VH) polypeptide possessing at least 70% sequence identity to SEQ ID NO: 13; and (b) a variable light chain (VL) polypeptide comprising CDR1 represented by SEQ ID NO: 10, CDR2 represented by SEQ ID NO: 11, and CDR3 represented by SEQ ID NO: 12, the variable light chain (VL) polypeptide possessing at least 70% sequence identity to SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 17, or SEQ ID NO: 18.
In some embodiments, the anti-TauC3 antibody fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 is a humanized antibody comprising a VL chain polypeptide possessing at least 75% sequence identity to SEQ ID NO: 13, and a VH chain polypeptide possessing at least 75% sequence identity to SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 17, or SEQ ID NO: 18.
In some embodiments, the anti-TauC3 antibody fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 comprises a VL chain polypeptide possessing at least 80% sequence identity to SEQ ID NO: 13, and a VH chain polypeptide possessing at least 80% sequence identity to SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 17, or SEQ ID NO: 18.
In some embodiments, the anti-TauC3 antibody fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 comprises a VL chain polypeptide possessing at least 85% sequence identity to SEQ ID NO: 13, and a VH chain polypeptide possessing at least 85% sequence identity to SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 17, or SEQ ID NO: 18.
In some embodiments, the anti-TauC3 antibody fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 comprises a VL chain polypeptide possessing at least 90% sequence identity to SEQ ID NO: 13, and a VH chain polypeptide possessing at least 90% sequence identity to SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 17, or SEQ ID NO: 18.
In some embodiments, the anti-TauC3 antibody fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 comprises a VL chain polypeptide possessing at least 95% sequence identity to SEQ ID NO: 13, and a VH chain polypeptide possessing at least 95% sequence identity to SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 17, or SEQ ID NO: 18.
In some embodiments, the anti-TauC3 antibody fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 is a humanized antibody comprising (a) a heavy chain variable region comprising CDR1 represented by sequence GFTFNTYA (SEQ ID NO: 7), CDR2 represented by IRSKSNNYAT (SEQ ID NO: 8), and CDR3 represented by VGGGDF (SEQ ID NO: 9; and (b) a light chain variable region comprising CDR1 represented by sequence QEISVY (SEQ ID NO: 10), CDR2 represented by sequence GAF (SEQ ID NO: 11), and CDR3 represented by sequence LQYVRYPWT (SEQ ID NO: 12); and has a binding affinity (KD) for TauC3 of from 1×10−10 1×10−12 and an off-rate (Kd) of 1×10−3 or less (e.g., from 1×10−4 to 5.4×10−4 or from 5.5×10−4 to 1×10−3 s−1), and a binding affinity (KD) for SEQ ID NO:1 of from 1×10−4 to 1×10−8M, or no detectable binding with SEQ ID NO:1.
In some embodiments, the anti-TauC3 antibody fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 is a humanized antibody comprising (a) a heavy chain variable region comprising CDR1 homologous to sequence GFTFNTYA (SEQ ID NO: 7), CDR2 homologous to IRSKSNNYAT (SEQ ID NO: 8), and CDR3 represented by VGGGDF (SEQ ID NO: 9; and (b) a light chain variable region comprising CDR1 homologous to sequence QEISVY (SEQ ID NO: 10), CDR2 homologous to sequence GAF (SEQ ID NO: 11), and CDR3 homologous to sequence LQYVRYPWT (SEQ ID NO: 12); and has a binding affinity (KD) for TauC3 of from 1×10−10 to 1×10−12 and an off-rate (Kd) of 1×10−3 or less (e.g., from 1×10−4 to 5.4×10−4 or from 5.5×10−4 to 1×10−3 s−1), and a binding affinity (KD) for SEQ ID NO:1 of from 1×10−4 to 1×10−8M, or no detectable binding with SEQ ID NO:1.
In some embodiments, the anti-TauC3 antibody fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 is a humanized antibody comprising (a) a heavy chain variable region comprising CDR1 identical to sequence GFTFNTYA (SEQ ID NO: 7), CDR2 identical to IRSKSNNYAT (SEQ ID NO: 8), and CDR3 identical to VGGGDF (SEQ ID NO: 9; and (b) a light chain variable region comprising CDR1 identical to sequence QEISVY (SEQ ID NO: 10), CDR2 identical to sequence GAF (SEQ ID NO: 11), and CDR3 identical to sequence LQYVRYPWT (SEQ ID NO: 12); and has a binding affinity (KD) for TauC3 of from 1×10−10 to 1×10−12 and an off-rate (Kd) of 1×10−3 or less (e.g., from 1×10−4 to 5.4×10−4 or from 5.5×10−4 to 1×10−3 s−1), and a binding affinity (KD) for SEQ ID NO:1 of from 1×10−4 to 1×10−8M, or no detectable binding with SEQ ID NO:1.
In some embodiments, the anti-TauC3 antibody fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 is a chimeric antibody comprising (a) a heavy chain variable region comprising CDR1 represented by sequence GFTFNTYA (SEQ ID NO: 7), CDR2 represented by IRSKSNNYAT (SEQ ID NO: 8), and CDR3 represented by VGGGDF (SEQ ID NO: 9; and (b) a light chain variable region comprising CDR1 represented by sequence QEISVY (SEQ ID NO: 10), CDR2 represented by sequence GAF (SEQ ID NO: 11), and CDR3 represented by sequence LQYVRYPWT (SEQ ID NO: 12); and has a binding affinity (KD) for TauC3 of from 1×10−10 to 1×10−12 and an off-rate (Kd) of 1×10−3 or less (e.g., from 1×10−4 to 5.4×10−4 or from 5.5×10−4 to 1×10−3 s−1), and a binding affinity (KD) for SEQ ID NO:1 of from 1×10−4 to 1×10−8 M, or no detectable binding with SEQ ID NO:1.
As compared to anti-tauC3 antibody, the fusion construct has an increased penetration across the BBB and/or reduced clearance and/or degradation by the lysosomal and/or endosomal system(s).
In certain embodiments, the antiTauC3 antibody fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 comprises high chain variable region:
and light chain variable region:
As compared to anti-tauC3 antibody, the fusion construct has an increased penetration across the BBB and/or reduced clearance and/or degradation by the lysosomal and/or endosomal system(s).
In certain embodiments, the antiTauC3 antibody fused to the peptide containing or consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28 comprises high chain variable region encoded by:
and light chain variable region encoded by:
As compared to the anti-tauC3 antibody, the fusion construct has an increased penetration across the BBB and/or reduced clearance and degradation by the lysosomal and/or endosomal system(s).
In certain embodiments, the fusion construct comprises SEQ ID NO: 2 fused to either the N- or C-terminus of the anti-tauC3 antibody heavy chain. For example, the fusion construct may comprise heavy chain:
and light chain:
In certain embodiments, the fusion construct may comprise Fc region that has been modified not to bind Fc-γ receptor, e.g., by introducing the D265A and N297G (DANG) mutations. It was reported that the D265A and N297G (DANG) mutations are efficacious in attenuating effector function in primates.
The fusion constructs of Formulas II and III may be used, e.g., in diagnosis and treatment of various tauopathies, including, e.g., Alzheimer's disease (AD), Pick's disease (PiD), progressive supranuclear palsy (PSP), corticobasal degeneration (CBD), frontotemporal lobar degeneration (FTLD), frontotemporal dementia (FTD), Parkinson's disease, amyotrophic lateral sclerosis (ALS), multiple sclerosis (MS), traumatic brain injury (TBI), and the like. Additionally, the anti-tauC3 fusion constructs of the invention may have utility in other neurodegenerative diseases in which tau pathology is implicated such as Parkinson's disease, multiple sclerosis and amyotrophic lateral sclerosis. Additionally, the anti-tauC3 fusion constructs of the invention may have utility in age related cognitive impairment.
The invention is further directed to a method of improving penetration of a peptide or protein through the BBB comprising fusing the peptide or protein to the a peptide containing SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28, directly or through a linker. The fusion may be at the carboxyl terminus of the peptide or protein, the amino-terminus of the peptide or protein, or an internal sequence of the peptide or protein (provided that it does not interfere with the peptide's or protein's activity and binding.
The invention is further directed to a method of improving blood brain barrier penetration of an antibody comprising fusing carboxyl-terminus of light chain, heavy chain, or both, of the antibody to the amino-terminus of a peptide containing sequence SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28, directly or through a linker.
The invention is further directed to a method of delivering peptides and proteins across the BBB comprising fusing carboxyl-terminus of a peptide or protein to the amino-terminus of a peptide containing SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO:39, directly or through a linker, and placing the resulting fusion construct in contact with the BBB.
The invention is further directed to a method of delivering antibodies across BBB comprising fusing carboxyl-terminus and/or amino-terminus of the light chain, heavy chain (or both) of the antibody to the amino-terminus of a peptide containing SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 28, directly or through a linker, and placing the resulting fusion construct in contact with the BBB.
The invention is further directed to a method for improving the efficiency of transcytosis. The method uses a synthetic fusion peptide of Formula I, II, and III that does not compete with transferrin (so should not interfere with iron transport) and avoids the complexity and cost associated with the development and manufacture of bispecific antibodies and avoids use of transferrin.
“Antibody” as used herein is meant to include intact molecules (i.e., a full length antibody (IgM, IgG, IgA, IgE)) and fragments thereof, as well as synthetic and biological derivatives thereof, such as for example Fab, (Fab′2), and Fv fragments-free or expressed, e.g., on the surface of filamentous phage on pIII or pVIII or other surface proteins, or on the surface of bacteria, which are capable of binding an antigen. Fab, (Fab′2) and Fv fragments lack the Fc fragments of intact antibody, clear more rapidly from the circulation and may have less non-specific tissue binding of antibody. The antibody may be a monoclonal antibody or a polyclonal antibody. Recombinant antibodies are encompassed by the term “antibody.” The term “antibody” further encompasses chimeric and humanized antibodies. The antibody may also be a fully human antibody (e.g., from a transgenic mice or phage).
The term “humanized antibody” as used herein refers to an antibody in which the complementary-determining regions (CDRs) of a mouse or other non-human antibody are grafted onto a human antibody framework. By human antibody framework is meant the entire human antibody excluding the CDRs.
The term “human antibody” as used herein refers to an antibody in which the entire sequence derived from human genetic repertoire (e.g., from a transgenic mice or phage).
The term “TBL-110” means the fusion construct of Example 1.
The terms “TBL-100” and “murine anti-TauC3 antibody” in the present application means “murine anti-Tau3” characterized in Nicholls, S. B., S. L. DeVos, C. Commins, C. Nobuhara, R. E. Bennett, D. L. Corjuc, E. Maury, et al. 2017. “Characterization of TauC3 antibody and demonstration of its potential to block tau propagation.” PLoS ONE 12 (5): e0177914. doi:10.1371/journal.pone.0177914.
The term “homologous” as used herein means that that the sequence is at least 80% identical to the sequence it is homologous to, and the polymeric peptide (e.g., an antibody) comprising the homologous sequence(s) has substantially same biological activity as the polymeric peptide comprising the sequence(s) it is homologous to. For example, a humanized antibody comprising (a) a heavy chain variable region comprising CDR1 represented by sequence GFTFNTYA (SEQ ID NO: 7), CDR2 represented by IRSKSNNYAT (SEQ ID NO: 8), and CDR3 represented by VGGGDF (SEQ ID NO: 9); and (b) a light chain variable region comprising CDR1 represented by sequence QEISVY (SEQ ID NO: 10), CDR2 represented by sequence GAF (SEQ ID NO: 11), and CDR3 represented by sequence LQYVRYPWT (SEQ ID NO: 12); and an antibody in which one more of CDR sequences are replaced by a homologous sequence(s) both have a binding affinity (KD) for TauC3 of from 1×10−10 to 1×10−12 and a binding affinity (KD) for SEQ ID NO:1 of from 1×10−4 to 1×10−8 M, or no detectable binding with SEQ ID NO:1. By definition, homologous antibodies have substantially similar three dimensional shape.
As used herein, “CDR” means “complementary determining region.” CDRs may also be referred to as hypervariable regions. Unless otherwise specified, the CDR sequences disclosed herein are defined by IMGT numbering system.
As used herein, “represented by SEQ ID NO:” with reference to the CDR sequence means that the sequence of the CDR is identical or homologous to the recited SEQ ID NO.
The term “chimeric antibody” as used herein refers to an antibody in which the whole of the variable regions of a mouse or rat antibody are expressed along with human constant regions.
As used herein, “light chain” is the small polypeptide subunit of the antibody. A typical antibody comprises two light chains and two heavy chains.
As herein, “an equal dose” means a dose equal in units of weight. For example, “an equal dose” of a 1 mg dose of a protein is a 1 mg dose of the fusion construct.
As used herein, the “heavy chain” is the large polypeptide subunit of the antibody. The heavy chain of an antibody contains a series of immunoglobulin domains, with at least one variable domain and at least one constant domain.
The term “affinity” as used herein refers to the strength with which an antibody molecule binds its epitope, or the strength a non-antibody protein (e.g., affibody) binds its scaffold. The affinity is determined by surface plasmon resonance (SPR).
The term “KD” as used herein refers to the equilibrium dissociation constant (KD=Kd/Ka, wherein Kd is a dissociation rate constant, and Ka is an association rate constant).
The term “pathological tau” encompasses tauC3, fibrils comprising tauC3, and aggregates comprising tauC3 (e.g., a heterogeneous population comprising full-length tau, tau oligomers and/or post-translational modified tau (truncated or phosphorylated). In addition to tauC3, pathological tau may comprise heterogeneous population of full-length tau (e.g., 2N4R), tau oligomers and/or post-translationally modified tau (truncated or hyperphosphorylated).
The term “seeding” refers to the activities that take place intracellularly after tauC3 and/or fibrils comprising tauC3 and/or aggregates comprising tauC3 are taken up by the cell.
The term “adnectin” means a 94-amino-acid thermostable (Tm>80° C.) binding protein fragment derived from the tenth domain of fibronectin type III (10Fn3).
The term “affilin” or “anticalin” means a protein fragment derived from lipocalins.
The term “avimer” means a class of binding protein fragments derived from the A-domain of various cell surface receptors (i.e., the low density-related protein (LRP) and very low density lipoprotein receptor (VLDLR)).
The term “fynomers” mean a protein derived from amino acids 83-156 of the Srchomology 3 (SH3) domain of FYN tyrosine kinase and composed of a pair of anti-parallel beta sheets joined by two flexible loops which are the sites of ligand binding.
The term “knottin” means stable 30-amino-acid protein fold (<4 kDa) composed of three anti-parallel β-strands connected by loops of variable length and multiple disulfide bonds. A subclass of knottin is the cyclotides in which the N- and C-terminus of the protein is joined post-translationally to form a circular molecule.
The term “Affibody” means a protein fragment derived from the Z-domain of the Ig-binding region of Staphylococcus aureus protein A which adopt a three-helix bundle motif and contain no cysteines.
The term “β-Hairpin mimetic” means a single β-hairpin motif designed to reproduce the conformational and electronic properties of functional native protein epitopes. (Simeon et al., Protein Cell 2018, 9(1):3-14).
The abbreviations “DARPins” means Designed ankyrin repeat proteins. DARPins are artificial protein scaffolds based on ankyrin repeat (AR) proteins.
The term “TauC3” means C-terminally truncated tau fragment ending at aspartate 421 of htau40 (SEQ ID NO: 1).
As used herein, “FLT” is an abbreviation for full length Tau (i.e., htau40 (SEQ ID NO: 1)).
As used herein, the terms “therapeutically effective amount” and “effective amount” means an amount of a therapeutic agent (e.g., an anti-tauC3 antibody analogue) or composition that leads to a measurable clinical effect in a patient. The effective amount of the therapeutic agent is determined by the circumstances surrounding the case, including the compound administered, the route of administration, the status of the symptoms being treated and similar patient and administration situation considerations among other considerations. An “effective amount” generally comprises from about 0.01 mg/kg to about 100 mg/kg, preferably from 0.5 mg/kg to 20 mg/kg of the antitauC3 antibody analogue described herein. In certain embodiments, an “effective amount” is 1 mg/kg, 3 mg/kg, 4 mg/kg, 6 mg/kg, 8 mg/kg or 10 mg/kg is used. In certain embodiments, greater than about 0.2%, 0.5%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, or 10% of the administered dose reaches CSF.
Short peptides can be fused to the N-terminus or C-terminus of antibody light or heavy chains (or both) without affecting antibody conformation or potency.
In certain embodiments, M of Fusion constructs of Formula I is selected from the group containing or consisting of pronectins (e.g., angiocept), affibodies (e.g., ABY-025, SOBI002, ABY-035), affilins (e.g., PRS-010, PRS-050), anticalins (e.g., PRS-080, PRS-060, PRS-110, PRS-343), atrimers (e.g., ATX 3105), avimers (e.g., AMG220), DARPins (e.g., MP0112, MP0260, MP0250, MP0274), fynomers (e.g., COVA322, COVA208, Knottin, Kuntizt domain), bicyclic peptides, and other non-antibody proteins.
In certain embodiments, A of the fusion construct of Formula II may be selected from the group consisting of U.S. Pat. No. 2,398,852 (Dezamizumab), AAB-001 (Bapineuzumab), ABBV-066 (Risankizumab), ABBV-323, ABBV-323, ABBV-8E12 (C2N 8E12), ABL-001 (Asciminib), ABL301, ABP-710 (Infliximab), ABT-165, ABT-414 (Depatuxizumab), ACZ885 (Canakinumab), ADC-1013, ADCT-402, ALD403 (Eptinezumab), ALX0061 (Vobarilizumab), AMG301 (Aimovig), AMG330, ANB020, ARGX-110, ARGX-111, ASKP1240 (Bleselumab), ATN-103 (Ozoralizumab), BAN0805 (ABBV-0805), BAN2401 (mab158), BAY 1351 (Nerelimomab), B-E8 (Elsilimomab), Bertilimumab, BI 655064, BI 655066, BI 695500, BI 695501, BIM 037 (Aducanumab), BIIB033 (Opicinumab), BIIB054 (Cinpanemab), BIIB074 (Vixotrigine), BIIB076, BMS-936561, Brolucizumab, BT-061 (Tregalizumab), C225 (cetuximab), CAT-192 (Metelimumab), CC-90002 (INBRX-103), CLNH11 (Pritumumab), cmt 412 (Priliximab), DB00028 (Gamunex), DB00073 (Rituximab), DB00095 (Efalizumab), DB00108 (Natalizumab), DB05459 (Briakinumab), DB05656 (Veltuzumab), DB06162 (Lumiliximab), DB06241 (Clenoliximab), DB06606 (Teplizumab), DB06650 (Ofatumumab), DB08935 (Obinutuzumab), DB09052 (Blinatumomab), DB11767 (Sarilumab), DB11803 (Sirukumab), DB11988 (Ocrelizumab), DB12053 (Visilizumab), DB12169 (Tralokinumab), DB12294 (Anrukinzumab), DB12636 (Samalizumab), DB12849 (Clazakizumab), DB13127 (Olokizumab), DB14004 (Tildrakizumab), DB14039 (Erenumab), DB14041 (Fremanezumab), DI-Leu16-IL2), Fazinumab, GC-1008 (Fresolimumab), GSE64382 (Itolizumab), GSK2862277, GSK3050002, GSK3174998, GSK3772847, GZ402668, HLX01, HLX03 (Adalimumab), Herceptin, Humax®-TAC-ADC, Humax-TAC-PBD, Inebilizumab, Inolimomab, IPH33, IPH52, JNJ-63709178, JNJ-63733657, JNJ-64007957, KHK4083, KHK6640, LY2062430 (Solanezumab), LY2599666, LY2951742 (Galcanezumab), LY3303560, MCLA-117, MEDI1341, MEDI1814, MEDI2070 (Brazikumab), MEN112, Mogamulizumab, NEOD001, Nesvacumab, Odulimomab, PF-04360365 (Ponezumab), PMN310, PRX002/R07046015, QAX576, REGN1979, REGN3500, RG1450 (Gantenerumab), RG6026, RG6100, RG6168, RG7412 (Crenzumab), RG7716, RG7828, RG7876, RG7935, RN624 (Tanezumab), RO 7105705, Rontalizumab, RYI 008 (Gerilimzumab), SAR228810, SAR3419 (Coltuximab ravtansine), SAR650984 (Isatuximab), SGN-CD19B, SGN-CD70A, Sym004 (Modotuximab), TAB-107 (Cedelizumab), TAB-262 (Teneliximab), TAB-H16 (Dapirolizumab pegol), TAK-573, TG-110 (Ublituximab), UCB4144, VX15/2503 (Pepinemab), xmab5574 (CD19), Xmab5871, Xoma 052, and (Gevokizumab), and Zanolimumab.
In certain embodiments, A of the fusion construct of Formula II is a monoclonal antibody for treatment of Alzheimer's disease (AD). AD is a chronic neurodegenerative progressive disease that starts with an early onset in a small population with familial genetic causes and later in life for the larger population with no clear genetic basis. The most common symptom associated with this disease is episodic memory loss, progressing to severe cognitive decline. The underlying cause of AD is yet unknown. AD is characterized by the loss of neurons and synapses in the cerebral cortex and certain sub-cortical regions. There is strong genetic evidence that AD is a protein misfolding disorder that results in plaque and tangle deposition of abnormally folded amyloid beta (Aβ) peptide and tau protein in the brain, the two classical hall-marks of the disease (Coate et al., 1991; Hardy and Mullan, 1992). Currently, there is no approved treatment for slowing or arresting disease progression. A seminal study, showed that active immunization against full-length Aβ in combination with an adjuvant reduced amyloid plaque burden in an AD transgenic mouse model (Schenk et al., 1999). Subsequently, numerous studies have demonstrated the efficiency of active and passive Aβ immunotherapy in preclinical AD mouse models. However, despite early optimism derived from these successful preclinical studies, this approach has not yet been developed into disease-modifying therapies in humans. For example, in 2012 two Phase III clinical trials of the anti Aβ Mabs, bapineuzumab and solanezumab, failed to meet their primary clinical end points of improved cognition (Doody et al., 2014; Salloway et al., 2014). Importantly, bapineuzumab caused vascular side effects designated as amyloid-related imaging abnormalities. This resulted in discontinuation of the high-dose group, which may explain the lack of clinical efficacy due to suboptimal brain exposure. In spite of these disappointing clinical results, other mAbs are currently being tested in AD prevention trials, where recent clinical trials have demonstrated that mAbs against the aggregated form of the Aβ peptide produced a dose and time-dependent reduction of amyloid plaque in the brain and potentially also led to clinical benefit. The most promising clinical data have been observed in patients with early (prodromal) or mild AD, suggesting that early intervention is important although in practice it is extremely difficult to find patients at this stage of the disease.
There are several mAbs in human clinical trials with the aim of reaching therapeutic concentrations within the brain parenchyma space to establish clinical benefit with the greatest number being tested in AD.
In certain embodiments, A of the fusion construct of Formula II is selected from the group consisting of solanezumab, aducanumab, gantenerumab, BAN2401, LY3372993, SAR255952, Donanemab (aka N3pG) LY3202626, R07105705, BIIB076, C2N 8E12, LY3303560.
T of the invention encompasses chimeric, humanized and human antibodies that are specific for the C-terminus of TauC3 (“anti-TauC3 antibodies”). The anti-TauC3 antibodies have a binding affinity (KD) for TauC3 of from 1×10−10 to 1×10−12 and a binding affinity (KD) for full length tau (“FLT”) (SEQ ID NO:1) of from 1×10−4 to 1×10−8 M. For example, the anti-TauC3 antibodies may have a binding affinity (KD) for TauC3 of about 5×10−12 M to about 1.2×10−10 from about 1×10−11 M to about 1×10−10 M, from about 1×10−11 M to about 9×10−11 M, from about 1×10−11 M to about 8×10−11 M, from about 1×10−11 M to about 7×10−11 M, from about 1×10−11 M to about 6×10−11 M, from about 1×10−11 M to about 5×10−11 M, or from about 1×10−11 M to about 4×10−11 M; and a binding affinity (KD) for FLT of from 1×10−4 to 1×10−8 M. In the preferred embodiments, the antibody retains its binding capability after being subjected to a temperature from about 40° C. to about 67° C. for 10 minutes and also retains its binding capability after incubation in serum (e.g., mouse) at 37° C. for 21 days. The high binding capability of the anti-TauC3 antibodies allows the antibodies to target TauC3 without compromising normal physiological functions of FLT. In some embodiments, the specificity of the antibody allows to target only the most noxious species of tau, one may potentially reduce the effective therapeutic dose, as compared to an antibody which is not specific and does not discriminate between different species of tau. The anti-TauC3 antibodies, and their antigen binding fragments, could be used, e.g., in the diagnosis and treatment of neurodegenerative disorders associated with pathological activities of TauC3 in the brain, including, e.g., Alzheimer disease (AD), progressive supranuclear palsy (PSP), frontotemporal dementia (FTD), traumatic brain injury (TBI), Pick's disease (PiD), corticobasal degeneration (CBD), frontotemporal lobar degeneration (FTLD), etc. The anti-TauC3 antibody may have an aqueous solubility of 50 mg/ml or more (e.g., from about 50 mg/ml to about 200 mg/ml, from about 55 mg/ml to about 180 mg/ml, from about 55 mg/ml to about 170 mg/ml, from about 55 mg/ml to about 150 mg/ml, from about 55 mg/ml to about 140 mg/ml, from about 55 mg/ml to about 130 mg/ml; or from about 60 mg/ml to about 130 mg/ml.
In certain embodiments, T of the fusion construct of Formula III is TBL-100 or TauC3 antibody.
Tau protein (2N4R) (SEQ ID NO: 1), often referred to as full-length tau (FLT), is a microtubule associated protein that distributes mainly to axons. Tau protein takes part in modulating the assembly, spatial organization and behavior of microtubules (MT) in neurons. FLT is preferentially cleaved by caspase-3, at residue 421 near the C-terminus of the protein, forming a truncated form of the protein known as TauC3.
TauC3 exists in low abundance compared to FLT (believed less than 1%) but was shown to exert a disproportionately large pathological effect, accounting, e.g., for the majority of tau propagation in AD brain, presumably by driving tau filament formation by nucleation. TauC3 is an extremely noxious protein. TauC3 is implicated in various tauopathies and neurodegenerative disorders, including, e.g., Alzheimer's disease (AD), Pick's disease (PiD), progressive supranuclear palsy (PSP), corticobasal degeneration (CBD), frontotemporal lobar degeneration (FTLD), frontotemporal dementia (FTD), traumatic brain injury (TBI), and the like. TauC3 may also be implicated, e.g., Parkinson's disease, multiple sclerosis and amyotrophic lateral sclerosis. An SNP (rs1768208 C/T) has been identified as a strong risk factor for PSP and shown to result in increased levels of the pro-apoptotic protein appoptosin in PSP patients. Elevations in appoptosin correlate with activated caspase-3 and tauC3 levels.
Fusion constructs which selectively bind TauC3 and exhibit no substantial binding to FLT (SEQ ID NO:1) may be used to treat various tauopathies, without compromising the physiological function of FLT.
Administration of a fusion construct of Formula III can be used, e.g., as a therapy to treat or immunize from tauopathies.
The fusion construct of Formula III may be administered to a human in a therapeutically effective amount to treat a tauopathy. Administration is performed using standard effective techniques, include peripherally (i.e. not by administration into the central nervous system) or locally to the central nervous system. Peripheral administration includes but is not limited to intravenous, intraperitoneal, subcutaneous, pulmonary, transdermal, intramuscular, intranasal, buccal, sublingual, or suppository administration. Local administration, including directly into the central nervous system (CNS) includes, but is not limited to, via a lumbar, intraventricular or intraparenchymal catheter or using a surgically implanted controlled release formulation.
Humans amenable to treatment include individuals at risk of disease but not showing symptoms, as well as patients presently showing symptoms. In the case of Alzheimer's disease, virtually anyone is at risk of suffering from Alzheimer's disease. Therefore, the present methods can be administered prophylactically to the general population. Such prophylactic administration can begin at, e.g., age 50 or greater. The present methods are especially useful for individuals who do have a known genetic risk of a tauopathy (e.g., Alzheimer's disease). Such individuals include those having relatives who have experienced this disease and those whose risk is determined by analysis of genetic or biochemical markers. For example, genetic markers of risk toward Alzheimer's disease include mutations in the APP gene, particularly mutations, at position 717 and positions 670 and 671 referred to as the Hardy and Swedish mutations respectively. Other markers of risk are mutations in the presenilin genes, PS1 and PS2, and ApoE4, family history of AD, hypercholesterolemia or atherosclerosis. Individuals presently suffering from Alzheimer's disease can be recognized from characteristic dementia by the presence of risk factors described above. In addition, a number of diagnostic tests are available for identifying individuals who have AD. These include imaging, and/or measurement of CSF tau and Aß42 levels. Elevated tau and decreased Aß42 levels signify the presence of AD. Individuals suffering from Alzheimer's disease can also be diagnosed by Alzheimer's disease and Related Disorders Association criteria.
In asymptomatic patients, treatment can begin at any age (e.g., 10, 20, 30, 40, 50, or 60). Usually, however, it is not necessary to begin treatment until a patient reaches 40, 50, 60, 70, 75 or 80. Treatment typically entails multiple dosages over a period of time. Treatment can be monitored by assaying antibody, or activated T-cell or B-cell responses to the therapeutic agent over time. If the response falls, a booster dosage is indicated. In the case of potential Down's syndrome patients, treatment can begin antenatally by administering therapeutic agent to the mother or shortly after birth.
In prophylactic applications, pharmaceutical compositions comprising an anti-tau antibody analogue according to the invention are administered to a patient susceptible to, or otherwise at risk of a tauopathy in an amount sufficient to eliminate or reduce the risk, lessen the severity, or delay the outset of the disease, including biochemical, histologic and/or behavioral symptoms of the disease, its complications and intermediate pathological phenotypes presented during development of the disease. In therapeutic applications, compositions comprising a fusion construct of Formula III are administered to a patient suspected of, or already suffering from, such a disease in an amount sufficient to cure, or at least partially arrest, the symptoms of the disease biochemical, histologic and/or behavioral), including its complications and intermediate pathological phenotypes in development of the disease. In some methods, administration of agent reduces or eliminates mild cognitive impairment. An amount adequate to accomplish therapeutic or prophylactic treatment is defined as a therapeutically- or prophylactically-effective dose or amount. In both prophylactic and therapeutic regimes, agents are usually administered in several dosages until a sufficient immune response has been achieved. Typically, the immune response is monitored and repeated dosages are given if the immune response starts to wane.
Effective doses of the fusion construct of Formula III, for the treatment of the above described conditions vary depending upon many different factors, including means of administration, target site, physiological state of the patient, other medications administered, and whether treatment is prophylactic or therapeutic. Treatment dosages need be tested on a case by case basis in clinical trials and often titrated to optimize safety and efficacy. An additional advantage of the fusion construct of Formula III of the present invention in certain embodiments may be that, for equal mass dosages, dosages of the fusion construct of Formula III contain a higher molar dosage of the antibodies effective in clearing and/or “inactivating,” than a composition comprising antibodies that are less specific for tauC3 than the fusion construct of Formula III. Typically, fusion construct of Formula III would be administered by intravenous infusion or subcutaneous injection. The amount of the fusion construct of Formula III for administration by intravenous infusion may vary from 0.5 to 10 mg per patient. Subcutaneous injections generally require higher doses to reach the brain in sufficient quantity. The antibodies (e.g., whole IgG molecules) may be administered once a month.
Dosage and frequency vary depending on the half-life of the fusion construct of Formula III in the patient. In general, fusion constructs comprising humanized antibodies show the longest half-life, followed by fusion constructs comprising chimeric antibodies, and fusion constructs comprising nonhuman antibodies. The dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patent can be administered a prophylactic regime.
In some methods, dosage of the fusion construct is adjusted to achieve a plasma antibody concentration of 1-1000 μg/ml and in some methods 25-300 μg/ml. Alternatively, antibody can be administered as a sustained release formulation, in which case less frequent administration is required.
The dose of the fusion construct of Formula III to block tauC3 seeding is not necessarily the same as the dose of the fusion construct of Formula III to inhibit tauC3 aggregation. In view of the information provided in the present specification, one of ordinary skill in the art can determine the specific doses by routine experimentation.
The efficacy of the administration/treatment may be accessed by measuring levels of pathogenic tau or phospho tau in plasma and/or CSF. Based on this assessment, the dose and/or frequency of administration may be adjusted accordingly.
In certain embodiments, effect on cognition may also be accessed.
The efficacy may also be accessed by a degree of brain atrophy, as determined by MRI.
The safety of the administration/treatment may be accessed by number of participants experiencing adverse events (AEs), serious AEs, and abnormalities in clinical laboratory tests, vital signs, ECGs, MRI, and physical and neurological exams as well as worsening of cognition. Based on this assessment, the dose and/or frequency of administration may be adjusted accordingly.
The fusion construct of Formula III may be administered intranasally, by a subcutaneous injection, intramuscular injection, IV infusion, transcutaneously, buccally, etc., or as described in more detail below.
In an additional aspect, the invention is directed to a method of blocking spreading of pathological tau from one neuron to another or from one part of the brain to another.
In an additional aspect, the invention is directed to a method of blocking tauC3 seeding activity in the brain of a patient.
The invention is also directed to a method of reducing the spread of pathological tau aggregation in the brain of a patient.
The invention is further directed to a method of reducing the spread of aggregates comprising tauC3 in the brain of a patient.
The invention is further directed to a method of reducing the spread of fibrils comprising tauC3 in the brain of a patient.
In a further aspect the invention, the invention is directed to a method of reducing intracellular aggregation of tau induced by intracellular uptake of tauC3 and tauC3 fibrils.
In each aspect, the method comprises administering a therapeutically effective amount of a fusion construct of Formula III to a human. The fusion construct of Formula III is capable of uniquely recognizing an aggregated form of pathological tau without significantly affecting normal physiological functions of FLT. In an embodiment, an essential part of the epitope of the fusion construct of Formula III is the carboxy group forming a neoepitope at the C-terminus residue in a peptide corresponding to the last ten C-terminal residues of tauC3 (SEQ ID NO: 18 SSTGSIDMVD). The fusion construct of Formula III preferably has an equilibrium constant KD to tauC3 that is from about 2 to about 3 orders of magnitude higher than the antibodies equilibrium constant KD to FLT (SEQ ID NO:1). The fusion construct of Formula III binds tauC3 with equilibrium constant KD of from 1×10−10 M to 1×10−11 M, but have an equilibrium constant KD with FLT (SEQ ID NO:1) which is from 1×10−4 M to 1×10−8 M or show no detectible binding with FLT (SEQ ID NO:1). In the preferred embodiments, the fusion construct of Formula III binds tauC3 with an equilibrium constant KD of from 1×10−11 M to 9×10−11 M, and bind FLT (i.e., 2N4R) (SEQ ID NO:1) with an equilibrium constant KD of from 1×10−8 M to 9×10−8M or show no detectable binding with FLT (i.e., 2N4R) (SEQ ID NO:1). The fusion construct of Formula III preferably has a very slow off rate from tauC3 (i.e., an association constant (ka) of from 9,000,000 l/Ms to 14,000,000 l/MS) and substantially no affinity to 2N4R (i.e., ka of less than 100,000 l/MS). The antibodies may, e.g., be a humanized antibody, a chimeric antibody or an immunological fragment of any of the foregoing.
A human may or may not be having a symptom associated with tau aggregation prior to administration of a therapeutically effective amount of the fusion construct of Formula III. In other words, a human may or may not be experiencing a symptom associated with tau seeding and/or aggregation. One of the ordinary skill in the art would appreciate that pathological tau seeding and aggregation likely commences prior to diagnosis or the onset of symptoms associated with tau aggregation. In some embodiments, a human is having a symptom associated with tau seeding and/or aggregation. In other embodiments, a human is not having a symptom associated with tau seeding and/or aggregation. In still other embodiments, a human has detectable tau pathology but is not having any other symptom associated with tau symptoms and/or aggregation. Reducing the spread of tau aggregation in the brain of a human by administering the therapeutic agents and pharmaceutical compositions according to the invention may reduce the development and/or progression of symptoms associated with the pathological seeding and/or aggregation of tau.
Preventing, inhibiting or slowing down spreading of pathological tau aggregation may therefore be used in the treatment of pathologies associated with generation and spread of tau aggregates. Exemplary disorders that have symptoms associated with tau aggregation include, but are not limited to, progressive supranuclear palsy, dementia pugilistica (chronic traumatic encephalopathy), frontotemporal dementia and parkinsonism linked to chromosome 17, Lytico-Bodig disease (Parkinson-dementia complex of Guam), tangle-predominant dementia, ganglioglioma and gangliocytoma, meningioangiomatosis, subacute sclerosing panencephalitis, lead encephalopathy, tuberous sclerosis, Hallervorden-Spatz disease, lipofuscinosis, Pick's disease, corticobasal degeneration, argyrophilic grain disease (AGD), Frontotemporal lobar degeneration, Alzheimer's Disease, and frontotemporal dementia. Methods for diagnosing these disorders are known in the art.
Exemplary symptoms associated with tau seeding or aggregation may include, e.g., impaired cognitive function, altered behavior, emotional dysregulation, seizures, and impaired nervous system structure or function. Impaired cognitive function includes but is not limited to difficulties with memory, attention, concentration, language, abstract thought, creativity, executive function, planning, and organization. Altered behavior includes but is not limited to physical or verbal aggression, impulsivity, decreased inhibition, apathy, decreased initiation, changes in personality, abuse of alcohol, tobacco or drugs, and other addiction-related behaviors. Emotional dysregulation includes but is not limited to depression, anxiety, mania, irritability, and emotional incontinence. Seizures include but are not limited to generalized tonic-clonic seizures, complex partial seizures, and non-epileptic, psychogenic seizures. Impaired nervous system structure or function includes but is not limited to hydrocephalus, Parkinsonism, sleep disorders, psychosis, impairment of balance and coordination. This includes motor impairments such as monoparesis, hemiparesis, tetraparesis, ataxia, ballismus and tremor. This also includes sensory loss or dysfunction including olfactory, tactile, gustatory, visual and auditory sensation. Furthermore, this includes autonomic nervous system impairments such as bowel and bladder dysfunction, sexual dysfunction, blood pressure and temperature dysregulation. Finally, this includes hormonal impairments attributable to dysfunction of the hypothalamus and pituitary gland such as deficiencies and dysregulation of growth hormone, thyroid stimulating hormone, lutenizing hormone, follicle stimulating hormone, gonadotropin releasing hormone, prolactin, and numerous other hormones and modulators. Methods for detecting and evaluating symptoms associated with tau aggregation are known in the art.
In some embodiments, a symptom associated with tau aggregation refers to dementia. Dementia is not itself a specific disease, but is an overall term that describes a wide range of symptoms associated with a decline in memory or other thinking skills severe enough to reduce a person's ability to perform everyday activities. Dementia is also a shared clinical feature of many diseases associated with tau aggregation. A skilled practitioner will be familiar with the numerous methods available to diagnose the severity of dementia. For example, several cognitive tests and screening questionnaires for dementia are known in the art, all with varying degrees of sensitivity and specificity. Non-limiting examples include the mini mental state examination (MMSE), the abbreviated mental test may score (AMTS), the modified mini mental state exam (3MS), the cognitive abilities screening instrument (CASI), the Trail-making test, the clock drawing test, the Informant Questionnaire on cognitive decline in the elderly, the General practitioner assessment of cognition, the Clinical Dementia Rating (CDR), Eight-item informant interview to differentiate aging and dementia (AD8).
In some embodiments, the severity of the symptoms of dementia is quantified using the Clinical Dementia Rating. Using the Clinical Dementia Rating, a score of 0 indicates no symptoms, a score of 0.5 indicates very mild symptoms, a score of 1 indicates mild symptoms, a score of 2 indicates moderate symptoms and a score of 3 indicates severe symptoms. Thus, any increase in a Clinical Dementia Rating score for a human indicates a worsening in cognition and an increase in dementia. Moreover, change in Clinical Dementia Rating from 0 to greater than 0, indicates the development or onset of dementia.
In some embodiments, a symptom associated with tau seeding or aggregation refers to tau pathology or a tauopathy. The term “tau pathology” or “tauopathy” refers to the pathological seeding or aggregation of tau. In some embodiments, tau pathology refers to neurofibrially tangles. In other embodiments, tau pathology refers to hyperphosphorylated tau. In still other embodiments, tau pathology refers to a high level of tau aggregates detectable in blood, plasma, serum, CSF, or ISF, anywhere from 2 to approximately 40-fold higher than that detected in individuals without disease.
Pharmaceutical compositions in accordance with the invention comprise the fusion construct of Formula I, II or III, and one or more pharmaceutically acceptable excipients.
The fusion construct of Formula III binds tauC3 with equilibrium constant KD of from 1×10−10 M to 1×10−11 M, but have an equilibrium constant KD with FLT (SEQ ID NO:1) which is from 1×10−4 M to 1×10−8 M or show no detectible binding with FLT (SEQ ID NO:1). In the preferred embodiments, the fusion construct of Formula III binds tauC3 with an equilibrium constant KD of from 1×10−11 M to 9×10−11 M, and binds FLT (SEQ ID NO:1) with an equilibrium constant KD of from 1×10−8 M to 9×10″ M or show no detectable binding with FLT (SEQ ID NO:1). The fusion construct of Formula III preferably has a very slow off rate from tauC3 (i.e., an association constant (ka) of from 9,000,000 l/Ms to 14,000,000 l/MS) and substantially no affinity to FLT (SEQ ID NO:1) (i.e., ka of less than 100,000 l/MS). A of the fusion construct of Formula III may, e.g., comprise a humanized antibody, a chimeric antibody or a human antibody (e.g., from tg mice).
The pharmaceutical compositions are designed to be appropriate for the selected mode of administration, and pharmaceutically acceptable excipients such as compatible dispersing agents, buffers, surfactants, preservatives, solubilizing agents, isotonicity agents, stabilizing agents and the like are used as appropriate.
Effective peripheral systemic delivery by intravenous or subcutaneous injection is a preferred method of administration to a living patient. Suitable vehicles for such injections are straightforward.
The concentration of the fusion construct of Formula I, II or III in formulations to be administered is an effective amount and ranges from as low as about 0.1% by weight to as much as about 95% or about 99.9% by weight and will be selected primarily based on fluid volumes, viscosities, and so forth, in accordance with the particular mode of administration selected if desired. In certain embodiments, the fusion construct of Formula I, II or III may comprise from about 15 or about 20% by weight of the composition.
A composition for injection to a patient could be made up to contain from 1-250 ml sterile buffered water of phosphate buffered saline and about 1-5000 mg of any one of or a combination of the fusion construct of Formula I, II or III. The formulation could be sterile filtered after making the formulation, or otherwise made microbiologically acceptable. A typical composition for intravenous infusion could have volumes between 1-250 ml of fluid, such as sterile Ringer's solution, and 1-100 mg per ml, or more in anti-tau antibody analogue concentration. Therapeutic agents of the discovery can be frozen or lyophilized for storage and reconstituted in a suitable sterile carrier prior to use. Lyophilization and reconstitution may lead to varying degrees of antibody activity loss (e.g. with conventional immune globulins, IgM antibodies tend to have greater activity loss than IgG antibodies).
Dosages administered are effective amounts for the purposes indicated and may have to be adjusted to compensate. The pH of the formulations that are generally of pharmaceutical grade quality will be selected to balance antibody stability (chemical and physical) and comfort to the patient when administered. Generally, a pH between 4 and 8 is tolerated. Doses will vary from individual to individual based on size, weight, and other physiobiological characteristics of the individual receiving the successful administration.
In an aspect, a typical dose contains from about 0.1 mg to about 10 mg fusion construct of Formula I, II or III. In certain embodiments, the dose is from about 0.5 mg to about 10 mg. Doses can range from about 0.55 mg/kg to about 10 mg/kg. The frequency of dosing with whole IgG antibodies is usually per month whereas antibody fragments need to be dosed more often in view of their shorter half-life, as needed as to effectively treat the symptoms.
The timing of administration of the treatment relative to the disease itself and duration of treatment will be determined by the circumstances surrounding the case. Treatment could begin after diagnosis of a disease associated with tau aggregation. Alternatively, treatment could begin after clinical confirmation of a symptom associated with tau aggregation. Further still, treatment could begin after detection of tau pathology. Treatment could begin immediately in a hospital or clinic, or at a later time after discharge from the hospital or after being seen in an outpatient clinic. Duration of treatment could range from a single dose administered on a one-time basis to a life-long course of therapeutic treatments.
Although the foregoing methods appear the most convenient and most appropriate and effective for administration of proteins such as humanized antibodies, by suitable adaptation, other effective techniques for administration, such as intraventricular administration, transdermal administration and oral administration may be employed provided proper formulation is utilized herein.
Typical effective amounts or doses can be determined and optimized using standard clinical techniques and will be dependent on the mode of administration in view of the information provided herein and knowledge available in the art.
A fusion construct was prepared. The heavy and light chain sequences of the fusion construct were as follows:
SDS-Page and Western blot analysis of the resulting construct in presented in
The following general procedures were used:
Plasmid Preparation:
1) Target DNA sequence was designed, optimized and synthesized;
2) The complete sequence was sub-cloned into pcDNA3.4vector;
3) Transfection grade plasmid was maxi-prepared for Expi293F cell expression.
Cell Culture and Transient Transfection:
1) Expi293FTMcells were grown in serum-free Expi293TMExpression Medium (Thermo Fisher Scientific).
2) The cells were maintained in Erlenmeyer Flasks (Corning Inc.) at 37° C. with 8% CO2on an orbital shaker (VWR Scientific).
3) One day before transfection, the cells were seeded at an appropriate density in Corning Erlenmeyer Flasks.
4) On the day of transfection, DNA and ExpiFectamine™293 Reagent were mixed at an optimal ratio and then added into the flask with cells ready for transfection.
5) The recombinant plasmids encoding target antibody were transiently co-transfected into suspensionExpi293Fcell cultures. Approximately 16-18 hours post-transfection, ExpiFectamine™ 293 Transfection Enhancer 1 and ExpiFectamine™ 293 Transfection Enhancer 2 were added to each flask. The cell culture supernatants collected and ay 6 were used for purification.
Purification and Analysis:
1) Cell culture broth was centrifuged and followed by filtration.
2) Filtered cell culture supernatant was loaded onto an affinity purification column at an appropriate flowrate.
3) After washing and elution with appropriate buffers, the eluted fractions were pooled and buffer exchanged to the final formulation buffer.
4) The purified protein was analyzed by SDS-PAGE, Western blotanalysis to determine the molecular weight and purity.
5) The concentration was determined by A280 method.
Anti-tauC3 antibody's ability to prevent tauC3-induced changes in mitochondrial morphology as an index of neurotoxicity is tested using cultured neurons transfected with tauC3 plasmid or by exposing the cells to apoptotic insults to induce caspase 3 cleavage of FLT (SEQ ID NO:1).
Immunohistochemistry is used to identify antitauC3 antibody-tauC3 complexes and explore their subcellular localization in cultured neurons and brain slices by high resolution fluorescence microscopy.
Internalization and retention of murine antiTauC3 antibody (“TBL-100”) and fusion construct of Example 1 were compared.
Rate of internalization and retention of the fusion construct of Example 1 appeared to be greater than of the murine antiTauC3 antibody.
Co-localization of the fusion construct with lysosomal markers as well as increased retention of the test article following treatment with bafilomycin suggests that internalized murine anti-TauC3 antibody may be more efficiently cleared via lysosomal activity than the fusion construct of Example 1.
Cells
Human Brain Microvascular Endothelial Cells (HBMVEC) (iXCells) are plated at 1500 cells per well of a 384 well plate and cultured for 24 hours prior to treatment with each of murine antiTauC3 antibody and fusion construct of Example 1 (“test articles”) in both the presence and absence of Bafilomycin.
Treatment
Murine Anti-TauC3 antibody and fusion construct test antibodies are tested in 3-point dose-response—1:500, 1:100, 1:20—for 3, 6 and 24 hour treatment exposures. Parallel wells on the same plate are also treated with either 0.1% DMSO or 100 nM Bafilomycin to measure effects of lysosomal activity following test article internalization. Following the appropriate time-course for each of the three time points, cells are fixed and permeabilized in a PFA solution and blocked overnight in goat block buffer.
Analysis
Automated quantitative analysis of neurite outgrowth as well as standard metrics associated with neuronal health using the Thermo CX7 HCS. Instrumentation and analysis suite. A minimum of 4 replicate wells per condition with 9 fields acquired per well using a 20× objective.
1. Dissociate HBMVEC cells (IXCells) and count using Countess II cell counter.
2. Prepare mixture of 14 ml complete media and 1.05×106 cells.
3. Enough for 700 wells of low volume 384 well plate (20 ul/1500 cells per well).
4. Array cells into each of three plates (3, 6, 24 hour test article treatment).
5. Return plated cells to 37 degree incubator for 24 hours.
6. Following 24 hour pre-culture, prepare dilutions of TBL-100 and TBL-110 (1:500, 1:100, 1:20) in 8 ml of complete media.
6. Divide each dilution into two equal volumes.
7. To one, add Bafilomycin stock to yield a final concentration of 100 nM.
8. Use Apricot liquid handling platform to carry out complete media change.
9. Return plates to incubator for 3, 6 and 24 hours.
10. At the conclusion of each time point incubation, fix for 20 minutes using 4% PFA solution in PBS, wash with PBS, and permeabilize cells.
11. Block overnight in goat block buffer.
12. To each well of all three plates, add the following mixture of primary antibodies is added:
13. Return plates to 4 degree fridge overnight
14. Wash plates 4× each with PBS using Apricot before adding the following mixture of secondary antibodies and labels for 1 hour at room temperature:
15. Remove secondary antibody mixture using Apricot and fill wells with PBS containing antibiotic/antimycotic and sodium-azide
16. Seal plates and image using Thermo Scientific CellInsight CX7 instrument and a 20× objective
Increased retention of TBL-100 (murine antiTauC3 antibody) following Bafilomycin treatment suggests that in untreated cells it is readily cleared by the lysosome.
Both test articles show higher levels of colocalization with the lysosomal marker LAMP2 than with Transferrin Receptor (TR) at later time points but TBL-100 (murine antiTauC3 antibody) more readily colocalizes with both at early time points suggesting rapid uptake by TR and subsequent clearance by the lysosome.
High levels of intracellular TBL-110 (fusion construct of Example 1), which is not colocalized with either LAMP2 or TR, suggests that this test article is released upon internalization or is taken up by an alternative mechanism.
The findings of Example 2 were confirmed in Human, Monkey and Brain Microvascular Cells (HBMVEC).
Cells
Human, Monkey or Mouse Brain Microvascular Endothelial Cells (BMVEC) from Creative Bioarray were plated at 1500 cells per well of a 384 well plate and cultured for 24 hours prior to treatment with each of murine antiTauC3 antibody and fusion construct of Example 1 in both the presence and absence of 100 nM Bafilomycin.
Treatment
Murine antiTauC3 antibody(TBL-100) and fusion construct of Example 1(TBL-110) (collectively “test articles”) were tested in. 3-point dose-response—1:500, 1:100, 1:20—for 24 hour treatment exposures. Parallel wells on the same plate were also treated with either 0.1% DMSO or 100 nM Bafilomycin to measure effects of lysosomal activity following test article internalization. Following the appropriate time-course for each of the three time points, cells were fixed and permeabilized in a PFA solution and blocked in goat block buffer.
Analysis
Automated quantitative analysis of standard metrics was performed using the Thermo CX7 HCS instrumentation and analysis suite. A minimum of 8 replicate wells per condition with 16 fields acquired per well using a 40× objective.
1. Dissociate BMVEC cells and count using Countess II cell counter.
2. Array cells into plates for 24 hour test article treatment.
3. Return plated wells to 37 degree incubator for 24 hours.
4. Following 24 hour pre-culture, prepare dilutions of Murine antiTauC3 antibody and fusion construct of Example 1 (1:500, 1:100, 1:20) in 8 ml of complete media.
5. Divide each dilution into two equal volumes.
6. To one, add Bafflomycin stock to yield a final concentration of 100 nM.
7. Use Apricot liquid handling platform to carry out complete media change.
8. Return plates to incubator for 24 hours.
9. At the conclusion of each time point incubation, fix for 20 minutes using 4% PFA solution in PBS, wash with PBS, and permeabilize cells.
10. Block 1 hour at room temperature in goat block buffer.
11. To each well of all three plates, add the following mixture of primary antibodies is added:
12. Return plates to 4 degree fridge overnight.
13. Wash plates 5× each with PBS using Apricot before adding the following mixture of secondary antibodies and labels for 1 hour at room temperature:
14. Remove secondary antibody mixture using Apricot and fill wells with PBS containing antibiotic/antimycotic and sodium-azide.
15. Seal plates and image using Thermo Scientific CellInsight CX7 instrument and a 40× objective.
Results Summary
1. Rate of internalization and retention of fusion construct of Example 1 (TBL-110) appears to be greater than of the murine antiTauC3 antibody (TBL-100) in Human, Monkey and Mouse BMVEC lines.
2. Increased retention of fusion construct of Example 1 compared to the murine antiTauC3 antibody was greatest in the absence of Bafilomycin (i.e. in the presence of Bafilomycin, and at the highest test concentrations, both the murine antiTauC3 antibody and fusion construct of Example 1 had similar high levels of retention).
3. The addition of Bafilomycin preferentially increased retention of the murine antiTauC3 antibody rather than fusion construct of Example 1 for Human and Monkey BMVEC, cell lines.
4. Transferrin-R and LAMP2 expression levels were not significantly affected by increasing doses of either test article.
5. Both murine antiTauC3 antibody and fusion construct of Example 1 showed partial colocalization with Transferrin Receptor as well as LAMP2.
Thus, the construct of Example 1 (TBL-110) shows cross species reactivity and works in human, monkey and mouse cell lines. This findings allow for, e.g., for preclinical pharmacokinetic (PK), pharmacodynamics (PD) and toxicology studies of the fusion constructs in animals and possible extrapolation of data generated in studies in animal models to humans.
A taut 3 overexpressing AAV mouse model was injected intraperitoneally (IP) weekly for 6 months with IgG1 or anti-TauC3 IgG1 (TBL-110) mAb fused to Tfr binding peptide at the C-terminus of the heavy chains. Brain sections were analyzed by immunohistochemistry to determine the relative brain uptake of two different concentrations of control IgG or TBL-100. Images of the antibody stained brain sections were quantitatively analyzed and compared for statistical significance. The images are replicated in
In the preceding specification, the invention has been described with reference to specific exemplary embodiments and examples thereof. It will, however, be evident that various modifications and changes may be made thereto without departing from the broader spirit and scope of the invention as set forth in the claims that follow. The specification and drawings are accordingly to be regarded in an illustrative manner rather than a restrictive sense.
This application claims the benefit of U.S. Provisional Application No. 62/829,776, filed on Apr. 5, 2019, hereby incorporated by reference.
| Number | Date | Country | |
|---|---|---|---|
| 62829776 | Apr 2019 | US |