Patent Application
20200157210
The present invention relates to a fusion protein which has an antigen-binding function and is expressed in an intracellular environment.
Intracellularly functionable antibodies, i.e., intrabodies are capable of affecting functions of cells of a higher organism by recognizing and binding to antigens (target molecules) in the cells. These antigens can be important intracellular therapeutic targets which can be inactivated upon binding to intrabodies. Further, in terms of research technique, use of intrabodies has been attracting attention as means for directly and specifically inhibiting functions of proteins by binding to antibodies inside cells.
To produce an intrabody, it is typical to (i) first use a standard method to prepare monoclonal-antibody-producing hybridomas capable of recognizing an antigen, (ii) then construct, from cDNA of each monoclonal-antibody-producing hybridoma, an intracellular expression vector containing DNA encoding a single chain Fv (scFv), and (iii) thus using a complex of heavy chain (VH) and light chain (VL) as an intrabody.
An antibody ordinarily functions by circulating in an extracellular environment (e.g., blood) inside the body and recognizing an extracellular antigen. It is thus assumed that an antibody acts in an extracellular environment. As such, in a case where an antibody is expressed in cytoplasm, the antibody suffers folding and stability issues leading to a lower expression level and a limited half-life of a domain of the antibody. It thus cannot be expected that any antibody functions as an intrabody. Further, scFv is constituted by a heavy chain and a light chain which are connected by a flexible peptide linker, and thus has a tertiary structure not as stable as an original antibody. Furthermore, even if scFv that functions in a test tube is identified, that scFv may not necessarily able to exhibit an expected function when expressed in a cell, since many aspects of an intracellular environment are not reflected in the environment inside the test tube.
Thus, there have been conducted studies on (i) regularity among antibodies capable of withstanding cytoplasmic conditions and (ii) a technique for expecting such antibodies, in order to enable screening of an antibody that functions as an intrabody. These are methods for selecting an antibody capable of functioning in cells. It is difficult, however, to actually obtain an intracellularly stable antibody with use of these methods. There has not been established a technology that utilizes an existing antibody or a newly isolated antibody as an intrabody.
[Patent Literature 1]
International Publication No. WO 03/014960
It is an object of the present invention to provide a technology for using a given antigen-binding peptide as an intrabody that stably functions in a cell.
The inventors of the present invention conducted diligent study in order to attain the object. As a result, the inventors discovered that when an antigen-binding peptide fused with a peptide tag is expressed in a cell, functional stability of the antigen-binding peptide as an intrabody changes in accordance with changes caused by the peptide tag in values of net charge and isoelectric point (pI) of the antigen-binding peptide. In particular, by designing the peptide tag so that values of charge and pI of the intrabody are sufficiently low with respect to a pH environment on a cytoplasmic surface of an endosome rather than a pH environment of the cytoplasm, the inventors achieved that the antigen-binding peptide stably functions as an intrabody in a cell by being fused with that peptide tag.
Based on the above knowledge, the inventors of the present invention further conducted study and consequently completed the present invention.
That is, the present invention is as follows:
1) A fusion protein, containing:
an intracellular-stabilizer peptide; and an antigen-binding peptide,
the intracellular-stabilizer peptide consisting of 10 to 39 amino acids, at least 45% of the 10 to 39 amino acids being acidic amino acids,
the antigen-binding peptide containing at least one of heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3.
2) The fusion protein as set forth in 1), wherein:
28% or less of the 10 to 39 amino acids of the intracellular-stabilizer peptide are basic amino acids; or
the intracellular-stabilizer peptide contains no basic amino acid.
3) The fusion protein as set forth in 2), wherein the intracellular-stabilizer peptide contains no basic amino acid.
4) The fusion protein as set forth in 2), wherein the intracellular-stabilizer peptide contains at least one histidine as a basic amino acid.
5) The fusion protein as set forth in any one 1) through 4), wherein:
the intracellular-stabilizer peptide consists of 14 to 25 amino acids, at least 50% of the 14 to 25 amino acids being acidic amino acids; and
the intracellular-stabilizer peptide containing neither a portion consisting of 8 or more consecutive acidic amino acids nor a portion consisting of 4 or more consecutive amino acids that are not acidic amino acids.
6) The fusion protein as set forth in 5), wherein the intracellular-stabilizer peptide contains neither a portion consisting of 3 or more consecutive acidic amino acids nor a portion consisting of 3 or more consecutive amino acids that are not acidic amino acids.
7) The fusion protein as set forth in 1), wherein the intracellular-stabilizer peptide contains
the following amino acid sequence (1) or (2):
-Xn-XA-XA-Xn-XA-(XA or Xn)-Xn-XA-(XA or Xn)-Xn-(XA or Xn)-XA- (1); or
-Xn-XA-Xn-XA-Xn-XA-XA-Xn-XA-Xn-Xn-XA-XA-Xn-Xn-XA- (2),
where XA is an acidic amino acid and Xn is an amino acid that is not an acidic amino acid.
8) The fusion protein as set forth in 7), wherein XA is aspartic acid or glutamic acid, and Xn is an amino acid selected from the group consisting of asparagine, glutamine, proline, tyrosine, and valine.
9) A polynucleotide encoding a fusion protein recited in any one of 1) through 8) above.
10) An expression vector containing a polynucleotide recited in 9) above.
11) A method for producing a cell capable of expressing an antigen-binding peptide in the cell, the method including the step of: introducing a polynucleotide recited in 9) or an expression vector recited in 10) into a cell.
12) A cell capable of expressing a fusion protein recited in any one of 1) through 8) above.
(Peptide)
In the present specification, the term “peptide” is interchangeable with “polypeptide” or “protein”. A “peptide” includes a structure of amino acids linked by a peptide bond. A “peptide” may further include, for example, a structure of a sugar chain, an isoprenoid group, or the like. The term “peptide”, unless otherwise specified, includes in its scope a peptide that contains an already known analog of a naturally-occurring amino acid having a function as well as the naturally-occurring amino acid.
(Acidic Amino Acid)
In the present specification, the term “acidic amino acid” refers to an amino acid having an isoelectric point of 3.99 or less. This amino acid may be a naturally-occurring amino acid or an analog of a naturally-occurring amino acid. Examples of a naturally-occurring acidic amino acid include aspartic acid and glutamic acid.
(Basic Amino Acid)
In the present specification, the term “basic amino acid” refers to an amino acid having an isoelectric point of 7.40 or more. This amino acid may be a naturally-occurring amino acid or an analog of a naturally-occurring amino acid. Examples of a naturally-occurring basic amino acid include histidine, lysine, and arginine.
(Amino Acid that is Neither Acidic Amino Acid Nor Basic Amino Acid)
In the present specification, an amino acid that fits neither the above definition of an acidic amino acid nor the above definition of a basic amino acid in terms of pH of the amino acid itself is referred to generally as “an amino acid that is neither an acidic amino acid nor a basic amino acid” or “a substantially neutral amino acid”. That is, such an amino acid has an isoelectric point of more than 3.99 and less than 7.40. The amino acid may be a naturally-occurring amino acid or an analog of a naturally-occurring amino acid.
(A and/or B)
In the present specification, the expression “A and/or B” is a concept covering both “A and B” and “A or B”, and is interchangeable with “at least one of A and B”.
A fusion protein of the present invention is a fusion protein containing:
an intracellular-stabilizer peptide; and
an antigen-binding peptide,
the intracellular-stabilizer peptide consisting of 10 to 39 amino acids, at least 45% of the 10 to 39 amino acids being acidic amino acids,
the antigen-binding peptide containing at least one of heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3.
The fusion protein of the present invention serves as an intrabody by being expressed in a given cell.
[Intracellular-Stabilizer Peptide]
(Peptide Length and Containing Acidic Amino Acids)
The intracellular-stabilizer peptide can be constituted by any number of amino acids. The intracellular-stabilizer peptide is preferably a peptide consisting of 50 or less amino acids, more preferably a peptide consisting of 10 to 39 amino acids. Note that at least 45% of all amino acids constituting the intracellular-stabilizer peptide are acidic amino acids.
A percentage of the acidic amino acids among all amino acids constituting the intracellular-stabilizer peptide is not particularly limited, but is preferably 50% or more. The percentage of the acidic amino acids among all amino acids constituting the intracellular-stabilizer peptide may be, for example, 53% or more or 55% or more. The percentage may be preferably 60% or more, and may be preferably 65% or more or 70% or more. In general, an isoelectric point of a polypeptide containing acidic amino acids decreases as a percentage of the acidic amino acids increases.
The number of the acidic amino acids constituting the intracellular-stabilizer peptide is not particularly limited, provided that any of the above ranges of percentage of the acidic amino acids among all amino acids constituting the intracellular-stabilizer peptide is met. For example, the number of the acidic amino acids constituting the intracellular-stabilizer peptide is 6 or more or 7 or more, preferably 8 or more or 9 or more, more preferably 10 or more, even more preferably 11 or more, and particularly preferably 12 or more.
The acidic amino acids constituting the intracellular-stabilizer peptide are each preferably selected from the group consisting of aspartic acid and glutamic acid.
From the viewpoint of increasing a degree of contribution of the intracellular-stabilizer peptide in the fusion protein, the number of the amino acids constituting the intracellular-stabilizer peptide is preferably 14 or more, more preferably 15 or more, even more preferably 18 or more, and particularly preferably 20 or more. Further, from the viewpoint of reducing a size of the fusion protein, the number of the amino acids constituting the intracellular-stabilizer peptide is preferably 35 or less, more preferably 30 or less, and even more preferably 25 or less. Note that in a case where a length (the number of the amino acids constituting the intracellular-stabilizer peptide) of the intracellular-stabilizer peptide is 9 amino acids or less, the intracellular-stabilizer peptide may be inadequate from the viewpoint of contribution of the intracellular-stabilizer peptide in the fusion protein. Further, the intracellular-stabilizer peptide having a length of 9 amino acids or less may be inadequate also from the viewpoint of antigen-specificity which the intracellular-stabilizer peptide is required to have when necessary, for example, when an antibody capable of recognizing the intracellular-stabilizer peptide is to be produced. Further, in a case where the intracellular-stabilizer peptide has a length of 40 amino acids or more, the fusion protein has an unnecessarily large size, and can accordingly cause steric hindrance in antigen recognition by the antigen-binding peptide (described later). Note, however, that the intracellular-stabilizer peptide having a length of 40 amino acids or more can be used in a case where a peptide serving as a linker is provided between and linked to the intracellular-stabilizer peptide and the antigen-binding peptide so that the intracellular-stabilizer peptide does not interfere with the antigen recognition. In that case, a plurality of intracellular-stabilizer peptides (which may be a plurality of intracellular-stabilizer peptides of the same kind or may be a combination of different kinds of intracellular-stabilizer peptides) may be used by being linked to one another via a spacer between each adjacent ones of the intracellular-stabilizer peptides.
(Case in which Basic Amino Acid is Contained)
A percentage of basic amino acids among all amino acids constituting the intracellular-stabilizer peptide is not particularly limited, and is preferably 28% or less, more preferably 27% or less or 26.5% or less, even more preferably 25% or less, 20% or less, 15% or less, or 10% or less, and particularly preferably 9% or less, 8% or less, 7% or less, 6% or less, 5% or less, 4% or less, or 3% or less. In a particularly preferable embodiment, the intracellular-stabilizer peptide contains no basic amino acid.
A preferable range of the number of basic amino acids constituting the intracellular-stabilizer peptide is not particularly limited, provided that any of the above ranges of percentage of acidic amino acids among all amino acids constituting the intracellular-stabilizer peptide is met. For example, the number of basic amino acids constituting the intracellular-stabilizer peptide is 6 or less, preferably 5 or less or 4 or less, more preferably 3 or less, even more preferably 2 or less, and particularly preferably 1 or less.
In a case where the intracellular-stabilizer peptide contains a basic amino acid, it is preferable that the basic amino acid be selected from the group consisting of lysine and histidine, and it is more preferable that the intracellular-stabilizer peptide contain at least one histidine as the basic amino acid. Histidine has a characteristic of having the lowest isoelectric point among naturally-occurring basic amino acids. In a case where the intracellular-stabilizer peptide contains a plurality of basic amino acids, a percentage of histidine among the basic amino acids is preferably 30% or more, more preferably 50% or more, even more preferably 60% or more, and particularly preferably 100%. The number of histidine residues contained in the intracellular-stabilizer peptide is, for example, 6, 5, 4, 3, 2, or 1.
(Amino Acid that is Neither Acidic Amino Acid Nor Basic Amino Acid)
The intracellular-stabilizer peptide may contain an amino acid (generally referred to as a “substantially neutral amino acid) that is neither an acidic amino acid nor a basic amino acid, which have been described above.
A percentage of substantially neutral amino acids among all amino acids constituting the intracellular-stabilizer peptide is 55% or less, preferably 50% or less, and more preferably 45% or less. In a case where the intracellular-stabilizer peptide contains a substantially neutral amino acid, a lower limit of a percentage of the substantially neutral amino acid among all amino acids constituting the intracellular-stabilizer peptide is not particularly limited, and is, in an aspect, 15% or more, 20% or more, or 25% or more.
When characteristics of the intracellular-stabilizer peptide as an antigen are taken into consideration, a percentage of hydrophobic amino acids (i.e., nonpolar, substantially neutral amino acids) among all amino acids constituting the intracellular-stabilizer peptide is preferably 25% or less, more preferably 20% or less, and even more preferably 15% or less. However, when a hydrophilic amino acid-hydrophobic amino acid balance in the intracellular-stabilizer peptide is taken into consideration, it may be preferable that one or more hydrophobic amino acids are contained in the intracellular-stabilizer peptide, on the premise that the above range of percentage of hydrophobic amino acids is met. In a case where the intracellular-stabilizer peptide contains hydrophobic amino acids, the number of the hydrophobic amino acids is, for example, 1, 2, 3, or 4. It may be preferable that the number of consecutive hydrophobic amino acids be 3 or less, and it may be more preferable that the number of consecutive hydrophobic amino acids be 2 or less.
In a case where the intracellular-stabilizer peptide contains a naturally-occurring substantially neutral amino acid, the substantially neutral amino acid is preferably selected from the group consisting of asparagine, phenylalanine (a hydrophobic amino acid), glutamine, tyrosine, serine, methionine (a hydrophobic amino acid), tryptophan (a hydrophobic amino acid), valine (a hydrophobic amino acid), glycine (a hydrophobic amino acid), leucine (a hydrophobic amino acid), isoleucine (a hydrophobic amino acid), and proline (a hydrophobic amino acid), more preferably selected from the group consisting of asparagine, glutamine, tyrosine, methionine, valine, glycine, leucine, isoleucine, and proline, and even more preferably selected from the group consisting of asparagine, glutamine, tyrosine, valine, and proline. In an aspect, the intracellular-stabilizer peptide contains at least one (preferably 1 or 2) proline, at least one (preferably 8 or less, for example, 7, 6, 5, 4, 3, or 2) amino acid selected from asparagine, glutamine, and tyrosine, and at least one (preferably 1 or 2) hydrophobic amino acid that is not proline.
Note that preferable types and arrangement of substantially neutral amino acids may be determined, for example, by taking account of: stability (resistance to oxidization, hydrolysis, and the like) of the intracellular-stabilizer peptide formed; whether or not an intramolecular S—S bond is formed; whether or not an intramolecular hydrogen bond is formed; whether or not an undesired motif is formed; and the like.
(Isoelectric Point)
An isoelectric point of the intracellular-stabilizer peptide can be calculated from types of amino acids constituting the intracellular-stabilizer peptide. Calculation of the isoelectric point of the intracellular-stabilizer peptide can be carried out, for example, in accordance with descriptions of Protein Caluculator (http://protcalc.sourceforge.net) or the like.
(More Specific Examples of Intracellular-Stabilizer Peptide)
The following description will discuss more specific examples of the intracellular-stabilizer peptide. Note that in the description below, XA refers to an acidic amino acid, and Xn refers to an amino acid that is not an acidic amino acid, i.e., Xn refers to a basic amino acid and a substantially neutral amino acid, which have been described above.
Note that all of the descriptions in the section [Intracellular-stabilizer peptide] apply to the specific examples below of the intracellular-stabilizer peptide. For example, all of the above descriptions of an acidic amino acid apply to XA, and all of the above descriptions of a basic amino acid and a substantially neutral amino acid apply to Xn. Also with regard to a length etc. of the intracellular-stabilizer peptide, all of the above descriptions apply. Specifically, for example, the examples below of the intracellular-stabilizer peptide may each be an intracellular-stabilizer peptide in which 28% or less of the amino acids are basic amino acids or be an intracellular-stabilizer peptide which contains no basic amino acid (i.e., all Xn are substantially neutral amino acids). Further, the intracellular-stabilizer peptide may be an intracellular-stabilizer peptide that contains at least one histidine as a basic amino acid.
(1) Aspect 1
An intracellular-stabilizer peptide that satisfies all of the conditions listed below.
The intracellular-stabilizer peptide consists of 10 to 39 amino acids and preferably consists of 14 to 25 amino acids.
Of the amino acids constituting the intracellular-stabilizer peptide, at least 45% are acidic amino acids, and preferably at least 50% are acidic amino acids.
The intracellular-stabilizer peptide contains neither a portion consisting of 8 or more consecutive XA nor a portion consisting of 4 or more consecutive Xn. That is, in the intracellular-stabilizer peptide, the number of consecutive XA is 7 or less and the number of consecutive Xn is 3 or less.
(2) Aspect 2
An intracellular-stabilizer peptide that satisfies the conditions of Aspect 1 above and satisfies the condition listed below.
The intracellular-stabilizer peptide contains neither a portion consisting of 6 or more consecutive XA nor a portion consisting of 4 or more consecutive Xn. That is, in the intracellular-stabilizer peptide, the number of consecutive XA is 5 or less and the number of consecutive Xn is 3 or less.
(3) Aspect 3
An intracellular-stabilizer peptide that satisfies the conditions of Aspect 1 above and satisfies the condition listed below.
The intracellular-stabilizer peptide contains neither a portion consisting of 6 or more consecutive XA nor a portion consisting of 3 or more consecutive Xn. That is, in the intracellular-stabilizer peptide, the number of consecutive XA is 5 or less and the number of consecutive Xn is 2 or less.
(4) Aspect 4
An intracellular-stabilizer peptide that satisfies the conditions of Aspect 1 above and satisfies the condition listed below.
The intracellular-stabilizer peptide contains neither a portion consisting of 3 or more consecutive XA nor a portion consisting of 3 or more consecutive Xn. That is, in the intracellular-stabilizer peptide, the number of consecutive XA is 2 or less and the number of consecutive Xn is 2 or less.
(5) Aspect 5
An intracellular-stabilizer peptide that satisfies all of the conditions listed below. Note that Aspect 5 may or may not fall under any of Aspects 1 to 4.
The intracellular-stabilizer peptide consists of 10 to 39 amino acids and preferably consists of 14 to 25 amino acids.
Of the amino acids constituting the intracellular-stabilizer peptide, at least 45% are acidic amino acids, and preferably at least 50% are acidic amino acids.
The intracellular-stabilizer peptide contains the following amino acid sequence:
-Xn-XA-XA-Xn-XA-(XA or Xn)-Xn-XA-(XA or Xn)-Xn-(XA or Xn)-XA- (1)
(6) Aspect 6
An intracellular-stabilizer peptide that satisfies the conditions of Aspect 5 above, has 3 to 7 more XA or Xn on a left side of the amino acid sequence (1) shown in Aspect 5, and has 0 to 6 more XA or Xn on a right side of the amino acid sequence (1) shown in Aspect 5.
(7) Aspect 7
An intracellular-stabilizer peptide that satisfies all of the conditions listed below. Note that Aspect 7 may or may not fall under any of Aspects 1 to 4.
The intracellular-stabilizer peptide consists of 10 to 39 amino acids and preferably consists of 14 to 25 amino acids.
Of the amino acids constituting the intracellular-stabilizer peptide, at least 45% are acidic amino acids, and preferably at least 50% are acidic amino acids.
The intracellular-stabilizer peptide contains the following amino acid sequence:
-Xn-XA-Xn-XA-Xn-XA-XA-Xn-XA-Xn-Xn-XA-XA-Xn-Xn-XA- (2).
(8) Aspect 8
An intracellular-stabilizer peptide that satisfies the conditions of Aspect 7 above, has 0 to 9 more XA or Xn on a left side of the amino acid sequence (2) shown in Aspect 7, and has 0 to 9 more XA or Xn on a right side of the amino acid sequence (2) shown in Aspect 7. Note, however, that a total of the numbers of the amino acids on the respective left and right sides of the amino acid sequence (2) may be preferably or less, more preferably 9 or less, and even more preferably 6 or less or 5 or less.
(9) Aspect 9
An intracellular-stabilizer peptide that falls under any one of Aspects 1 to 8 above, wherein XA is aspartic acid or glutamic acid, and Xn is an amino acid selected from the group consisting of asparagine, glutamine, proline, tyrosine, and valine.
(10) Aspect 10
An intracellular-stabilizer peptide that falls under any one of Aspects 5 to 6 above, wherein: XA is aspartic acid or glutamic acid; and among Xn, (i) one or more of 2th to 6th (preferably 2th to 4th, more preferably 2nd to 3rd) Xn from the left side of the amino acid sequence (1) in the amino acid sequence (1) are each proline and (ii) each Xn that is not proline is an amino acid selected from the group consisting of asparagine, glutamine, tyrosine, and valine. As an example, one of the 2nd to 3rd Xn from the left side of the amino acid sequence (1) in the amino acid sequence (1) is proline, and the other Xn contained in the amino acid sequence (1) are each an amino acid selected from the group consisting of asparagine, glutamine, valine, and tyrosine. As another example, one of the 2nd to 3rd Xn from the left side of the amino acid sequence (1) in the amino acid sequence (1) is proline, and the other Xn contained in the amino acid (1) are each an amino acid selected from the group consisting of asparagine, glutamine, and tyrosine.
(11) Aspect 11
An intracellular-stabilizer peptide that falls under any one of Aspects 7 to 8 above, wherein: XA is aspartic acid or glutamic acid; and among Xn, (i) one or more of 3rd to 6th (preferably 3rd to 5th, more preferably 4th to 5th) Xn from the left side of the amino acid sequence (2) in the amino acid sequence (2) are each proline and (ii) each Xn that is not proline is an amino acid selected from the group consisting of asparagine, glutamine, tyrosine, and valine. As an example, one of the 4th to 5th Xn from the left side of the amino acid sequence (2) in the amino acid sequence (2) is proline, the other of the 4th to 5th Xn is valine, and the other Xn contained in the amino acid sequence (2) are each an amino acid selected from the group consisting of asparagine, glutamine, and tyrosine.
(12) Aspect 12
An intracellular-stabilizer peptide consists of any one of the following amino acid sequences.
(13) Aspect 13
An intracellular-stabilizer peptide that satisfies all of the conditions listed below.
The intracellular-stabilizer peptide consists of 10 to 39 amino acids and preferably consists of 14 to 25 amino acids.
All amino acids constituting the intracellular-stabilizer peptide are acidic amino acids.
(Antigen-Binding Peptide)
(Structure)
A typical antibody structural unit is known to include a tetramer. Each tetramer is constituted by two identical pairs of polypeptide chains, each pair having one light chain (e.g., approximately 25 kDa) and one heavy chain (e.g., approximately 50 kDa to 70 kDa). The amino-terminal portion of each chain has a variable region of approximately 100 or more amino acids, and the variable region is primarily responsible for antigen (target molecule) recognition. The carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. Light chains are classified as either kappa or lambda. Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the isotypes IgG, IgM, IgA, IgD and IgE, respectively, of the antibody. Within the light chain and the heavy chain, the variable region and the variable region are linked to each other by a J region of approximately 12 or more amino acids, and the heavy chain also includes a D region of approximately 10 more amino acids. The variable regions of each light/heavy chain pair form an antibody binding site. These chains all represent the same general structure of relatively conserved framework regions (FRs) linked to one another via three hypervariable regions (also referred to as complementarity determining regions, or CDRs). CDRs derived from the two chains of each pair are arranged by framework regions, so that binding to a specific epitope is made possible.
The term “antigen-binding peptide” refers to a peptide which (i), in a given monoclonal antibody or in a peptide capable of specifically binding to an antigen (a target molecule) similarly as a monoclonal antibody, contributes to binding to the antigen and (ii) has all or part of a region of the antibody which region has an antigen binding capacity. In the present invention, the “antigen-binding peptide”, for example, contains at least one of heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3 of a given monoclonal antibody. It is preferable that the antigen-binding peptide contains at least 2, at least 3, at least 4, at least 5, or all of heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3.
A monoclonal antibody from which the antigen-binding peptide of the present invention is produced may be a natural antibody or an antibody which is produced by genetic recombinant technology. The natural antibody is not limited to any particular one, and can be derived from various species of organism such as a human, a mouse, a rat, a monkey, a goat, a rabbit, a camel, a llama, a cow, and a chicken. The antibody produced by the genetic recombinant technology is not limited to any particular one, and can be, for example, (i) a synthesized antibody produced from a natural antibody, (ii) a recombinant antibody, or (iii) a mutated antibody. Examples of the antibody also include antibodies obtained by subjecting antibodies already produced by genetic recombinant technology to modification that is similar to the aforementioned genetic modification of natural antibodies. The antigen-binding peptide of the present invention is a peptide which includes the full length or part of F(ab′)2, F(ab′), Fab′, Fab, Fv (variable fragment of antibody), scFv, dsFv (disulphide stabilized Fv), dAb (single domain antibody), a diabody, a minibody, or VHH derived from any of the above antibodies. Examples of the “peptide capable of specifically binding to an antigen similarly as a monoclonal antibody” include: a peptide aptamer having high binding specificity for an antigen; a binding domain of a protein (e.g., fibronectin) derived from a living organism having binding specificity for a target molecule; and the like.
[Additional Functional Peptide]
The fusion protein of the present invention may further contain one or more functional peptides other than the intracellular-stabilizer peptide and the antigen-binding peptide. Examples of such a functional peptide include a purification tag peptide, a detection peptide, a degradation promoting peptide (e.g., an HSC70 binding peptide, an XIAP RING domain peptide), a Neh2 domain peptide (a peptide derived from Nrf2), a stress-responsive degradation peptide such as an oxygen-dependent degradation domain (a peptide derived from Hif1α), a drug-binding peptide, and the like.
The purify tag peptide is not limited to any particular one, and can be a purification tag peptide containing acidic amino acids in a proportion of 15% or more, such as an HA tag sequence (YPYDVPDYA (SEQ ID NO: 14)) and a PA tag sequence (GVAMPGAEDDVV (SEQ ID NO: 15)). In a case where the fusion protein contains the tag sequence containing acidic amino acids in a proportion of 15% or more, a further increase in negative charge of the fusion protein is achieved also at low pH. It is more preferable that the purification tag peptide contain acidic amino acids in a proportion of 20% or more.
The detection peptide is not limited to any particular one, and can be, for example, a fluorescent protein, an enzyme which emits light or undergoes a change in color through a reaction, or the like. The fluorescent protein can be, but is not limited to, BFP, EBFP, CFP, ECFP, Cypet, AmCyan1, GFP, EGFP, YFP, Venus, mKO, mOrange, RFP, DsRed, tdTomato, mcherry, mStrawberry, Azalea, mPlum, mAG, Kaede, Dronpa, Keima, KikG, KikGR, UnaG or the like. The enzyme which emits light or undergoes a change in color through a reaction can be, but is not limited to, peroxidase, alkaline phosphatase, β-D-galactosidase, glucose oxidase, glucose-6-phosphate dehydrogenase, alcohol dehydrogenase, malate dehydrogenase, penicillinase, catalase, apoglucose oxidase, urease, luciferase, acetylcholinesterase, or the like.
[Structure of Fusion Protein]
The term “fusion protein” refers to a protein which has at least two different types of peptides that are linked to each other by a covalent bond, directly or via a linker. The linker is not limited to any particular one. In order to impart flexibility, the linker preferably mainly contains, for example, an amino acid having a low-molecular side chain, such as glycine, alanine, and serine. It is preferable that 80%, 90%, or more of the linker sequence contain a glycine residue, an alanine residue, or a serine residue, and it is particularly preferable that 80%, 90%, or more of the linker sequence contain a glycine residue or a serine residue.
The intracellular-stabilizer peptide and the antigen-binding peptide contained in the fusion protein may be linked to each other in any order. The intracellular-stabilizer peptide and the antigen-binding peptide may be arranged in this order from the N-terminal side of the fusion protein, or the antigen-binding peptide and the intracellular-stabilizer peptide may be arranged in this order from the N-terminal side of the fusion protein. Further, the intracellular-stabilizer peptide and the antigen-binding peptide may be arranged such that a direction of the N-terminal to the C-terminal of the fusion protein is opposite to a direction of the N-terminal to the C-terminal of the intracellular-stabilizer peptide and/or the antigen-binding peptide themselves. Further, a plurality of intracellular-stabilizer peptides (which may be a plurality of intracellular-stabilizer peptides of the same type or may be a combination of intracellular-stabilizer peptides of different types) may be arranged such that each of the plurality of intracellular-stabilizer peptides is respectively provided on both ends of the antigen-binding peptide.
The additional functional peptide may also be provided in any arrangement. In a case where the functional peptide is a purification tag peptide containing acidic amino acids in a proportion of 15% or more, the purification tag peptide is preferably arranged such that the antigen-binding peptide is interposed between the purification tag peptide and the intracellular-stabilizer peptide (“the intracellular-stabilizer peptide-the antigen-binding peptide-the purification tag peptide” or “the purification tag peptide-the antigen-binding peptide-the intracellular-stabilizer peptide). This arrangement allows achieving a positional balance of overall charge of the fusion protein. Accordingly, it becomes possible to maintain the fusion protein more stable in a cell. The detection peptide may also be provided in any arrangement. From the viewpoint of detectability, it is preferable that the detection peptide be located at the very N-terminal or the very C-terminal of the fusion protein.
Further, identical or different intracellular-stabilizer peptides may be arranged such that each of the intracellular-stabilizer peptides is respectively linked to both ends (i.e., the N-terminal and the C-terminal) of the antigen-binding peptide. In this case, the fusion protein has an increased negative charge also at lower pH. This enables more successfully preventing aggregation in cells.
The fusion protein of the present invention, due to containing the intracellular-stabilizer peptide, has a low isoelectric point as compared with a case in which the antigen-binding peptide is present alone. This allows the fusion protein to undergo less aggregation in a cell as compared with a case in which the antigen-binding peptide is expressed alone in a cell. Thus, the fusion protein can stably function as an intrabody.
In an example, the fusion protein of the present invention preferably has a net negative charge at pH 7.4, more preferably has a net negative charge at pH 6.6, more preferably has a net negative charge at pH 6.0, and even more preferably has a net negative charge at pH 5.0.
The number of amino acids constituting the “fusion protein” is not particularly limited, and is, for example, 1000 or less, preferably 600 or less, more preferably 550 or less. The number of amino acids constituting the “fusion protein” is not particularly limited, and is, for example, 100 or more, 250 or more, or 300 or more.
A polynucleotide of the present invention encodes the fusion protein of the present invention. The term “polynucleotide” may refer to any of a DNA molecule, an RNA molecule, and a hybrid molecule of DNA and RNA. The term “polynucleotide” may refer to a double-stranded polynucleotide or a single-stranded polynucleotide.
The polynucleotide of the present invention can be prepared by a well-known genetic engineering technique, chemical synthesis method, or the like. A specific base sequence of the polynucleotide of the present invention can be easily designed by a person skilled in the art from an amino acid sequence of an intended fusion protein and with reference to, for example, the codon table.
Further, the polynucleotide of the present invention may contain: a regulatory sequence such as a promoter (SV40 promoter, MMTV-LTR promoter, EF1α promoter, CMV promoter, or the like), an enhancer, a ribosome binding site, a splice signal, and a terminator; a selective marker sequence; and the like, as necessary.
Further, by adding, as necessary, a signal peptide sequence to be localized in a nucleus, a mitochondria, or an endoplasmic reticulum or immediately below a plasma membrane, it is possible to localize the fusion protein of the present invention and accordingly control an intracellular location where the fusion protein functions as an intrabody.
The polynucleotide of the present invention may be integrated into a vector. The term “vector” refers to a vehicle for causing a desired polynucleotide to be introduced into a host cell and expressed in the host cell. Examples of the vector include: a viral vector; and a nonviral vector such as a plasmid vector, a bacteria vector, a phage vector, a phagemid vector, and a cosmid vector. Examples of the viral vector include adenovirus, adeno-associated virus (AAV), retrovirus (RSV, MMTV, MOMLV, and the like), lentivirus, Sendai virus, herpes simplex virus, and the like. For introduction of the polynucleotide of the present invention into a cell in vivo, it is preferable to use a viral vector. For introduction of the polynucleotide of the present invention into a cell in vitro, either one of a viral vector and a nonviral vector can be used.
The vector may contain, in addition to DNA to be expressed, for example, a regulatory sequence such as a promoter (SV40 promoter, MMTV-LTR promoter, EF1α promoter, CMV promoter, and the like), an enhancer, a ribosome binding site, a splice signal, a terminator, and the like; and, as necessary, a selective marker sequence (ampicillin-resistant gene, kanamycin-resistant gene, streptomycin-resistant gene, chloramphenicol-resistant gene, and the like) and the like. Each promoter may be a constitutive promoter or an inducible promoter.
Construction of an expression vector can be carried out by, for example, a well-known genetic engineering technique.
[Pharmaceutical Use]
(Pharmaceutical Composition)
The present invention also provides a pharmaceutical composition containing the above-described fusion protein, polynucleotide, or vector.
The pharmaceutical composition of the present invention may further contain a component other than the above-described fusion protein, polynucleotide, or vector. The component other than the above-described fusion protein, polynucleotide, or vector is not limited to any particular one, and can be, for example, a pharmaceutically acceptable carrier, lubricant, preservative, stabilizer, wetting agent, emulsifier, osmotic pressure controlling salt, buffer agent, stabilizer, preservative, excipient, antioxidant, viscosity modifier, coloring agent, flavoring agent, sweetener, or the like. In a case where the pharmaceutical composition is provided as an aqueous solution, pure water (sterilized water), physiological saline, phosphate buffered saline, or the like can be used as a carrier. In a case where the pharmaceutical composition is provided as an appropriate solution other than the above, an organic ester (e.g., glycol, glycerol, olive oil, or the like) that can be introduced into a living organism can be used as a carrier.
The pharmaceutical composition may be contained in a container, a package, a dispenser, or the like together with an instruction manual.
(Use in Treatment and Prevention of Disease)
The above-described pharmaceutical composition may be used, for example, for treatment and/or prevention of a disease associated with an antigen.
As an aspect of the pharmaceutical composition of the present invention, the polynucleotide or the vector of the present invention is introduced into a target cell, and the fusion protein of the present invention is expressed in the target cell so that a function of an antigen associated with a disease is controlled (i.e., suppressed or activated, preferably suppressed) by the antigen-binding peptide. This enables treatment and/or prevention of the disease.
As another aspect of the pharmaceutical composition of the present invention, a mechanism for transporting an antibody from an extracellular environment into a cell is used to cause the fusion protein of the present invention to enter a target cell and function as an intrabody. This enables treatment and/or prevention of a disease.
As another aspect of the pharmaceutical composition of the present invention, in a mechanism (recycling mechanism) in which an antibody moves from an extracellular environment into a cell and then is transported into the extracellular environment again, stability of the fusion protein of the present invention in a target cell is improved so that the fusion protein functions as an antibody inside and/or outside the cell. This enables treatment and/or prevention of a disease.
As another aspect of the pharmaceutical composition of the present invention, a cell which is a collected cell treated so as to be capable of expressing the fusion protein of the present invention and in which the fusion protein of the present invention is expressed is administered to a target. This enables treatment and/or prevention of a disease. In the above aspect, the collected cell may be a homogeneous syngeneic cell (an autologous cell) that is collected from an individual to which the cell is to be administered or may be a heterogeneous syngeneic cell (a heterologous cell) that is collected from an individual different from the individual to which the cell is to be administered.
In any aspect, a localization signal for localization may be added so that the fusion protein of the present invention is localized in a specific organelle when the fusion protein is expressed in a cell.
An aspect of the term “treatment” encompasses reduction or alleviation, delaying of progress, treatment, and the like of at least one symptom associated with a target disease. An aspect of the term “prevention” encompasses prevention of development and the like of at least one symptom associated with a target disease.
A living organism which is a subject of treatment and/or prevention can be, for example, a human or a non-human animal, more specifically, a vertebrate such as fish, a bird, and a mammal. The mammal can be a laboratory animal such as a mouse, a rat, a rabbit, a guinea pig, and a primate other than a human; a pet animal such as a dog and a cat; a farm animal such as a pig, a cow, a goat, a sheep, and a horse; or a human.
Exemplary diseases which are treated or prevented include cancers, tumors, nervous system diseases (central nervous system diseases, peripheral nervous system diseases), infectious (viral infection, bacterial infection, and the like) diseases, autoimmune diseases or allergy diseases, inflammatory diseases, and the like.
Exemplary cancers or tumors include, but are not limited to, lingual cancer, gingival cancer, malignant lymphoma, malignant melanoma (melanoma), maxillary cancer, nasal cancer, nasal cavity cancer, laryngeal cancer, pharyngeal cancer, glioma, myeloma, glioma, neuroblastoma, papillary carcinoma of thyroid, follicular carcinoma of thyroid, medullary carcinoma of thyroid, primary pulmonary carcinoma, squamous cell carcinoma, adenocarcinoma, alveolar carcinoma, large cell undifferentiated carcinoma, small cell undifferentiated carcinoma, carcinoid, testicular tumor, prostatic cancer, breast cancer (e.g., papillary adenocarcinoma, comedocarcinoma, mucous tumor, medullary carcinoma, lobular carcinoma, scirrhous carcinosarcoma, metastatic tumor), mammary Paget disease, mammary sarcoma, bone tumor, thyroid gland cancer, gastric cancer, liver cancer, acute myelocytic leukemia, acute promyelocytic leukemia, acute myelomonocytic leukemia, acute monocytic leukemia, acute lymphocytic leukemia, acute undifferentiated leukemia, chronic myeloid leukemia, chronic lymphocytic leukemia, adult T cell leukemia, malignant lymphoma (e.g., lymphosarcoma, reticulum cell sarcoma, Hodgkin disease or the like), multiple myeloma, primary macroglobulinemia, infantile leukemia, esophageal carcinoma, gastric cancer, gastrocolic leiomyosarcoma, gastrointestinal malignant lymphoma, pancreas-gall bladder cancer, duodenal cancer, large bowel cancer, primary cancer of liver (e.g., hepatocellular carcinoma, bile duct cancer or the like), hepatoblastoma, uterine intraepithelial carcinoma, cervical squamous cell carcinoma, adenocarcinoma of uterus, adenosquamous carcinoma of uterus, uterine body adenocarcinoma, uterine sarcoma, uterine carcinosarcoma, invasive hydatidiform mole of uterus, malignant chorioepithelioma of uterus, uterine malignant melanoma, ovarian cancer, mesodermal mixed tumor, renal carcinoma, renal pelvic transitional cell carcinoma, ureteral transitional cell carcinoma, papillary carcinoma of urinary bladder, bladder transitional cell carcinoma, urethral squamous cell carcinoma, urethral adenocarcinoma, Wilms tumor, rhabdomyosarcoma, fibrosarcoma, osteosarcoma, chondrosarcoma, synovial sarcoma, myxosarcoma, liposarcoma, Ewing sarcoma, skin squamous cell carcinoma, skin basal cell carcinoma, skin Bowen disease, skin Paget disease, skin malignant melanoma, malignant mesothelioma, metastatic adenocarcinoma, metastatic squamous cell carcinoma, metastatic sarcoma, mesothelioma (e.g., pleural mesothelioma, peritoneal mesothelioma, pericardial mesothelioma or the like) and the like.
Exemplary neurodegenerative diseases include, but are not limited to, Parkinson's disease, Alzheimer's disease, Huntington's disease, prion disease, frontotemporal dementia, Amyotrophic Lateral Sclerosis (ALS), Spinalbulbar Muscular Atrophy (SBMA or Kennedy's Disease), Dentatorubropallidoluysian Atrophy (DRPLA), Spinocerebellar Ataxia (e.g., SCA-1 through SCA-7), dementia, schizophrenia, depression, manic-depressive psychosis, neurosis, psychosomatic disorder, cerebral infarction, multiple sclerosis, progressive supranuclear paralysis, multiple system atrophy, spinocerebellar degeneration, cerebellar degeneration, abnormality in cerebral metabolism, abnormality in cerebral circulation, autonomic imbalance, various abnormalities in the endocrine system associated with the central nervous system, sleep disorder, neurological symptoms (nausea, vomiting, dry mouth, loss of appetite, dizziness, or the like), dyskinesia, learning disability, and the like.
Exemplary infectious diseases include, but are not limited to, diseases caused by infection with a pathogenic virus such as human immunodeficiency virus (HIV), human T cell leukemia virus (e.g., HTLV-I), hepatitis virus (e.g., hepatitis A, B, C, D, or E virus), influenza virus, herpes simplex virus, West Nile fever virus, human papillomavirus, encephalitis virus, or Ebola virus; diseases caused by infection with pathogenic bacteria such as chlamydia, mycobacteria, or Legionella; diseases caused by infection with a pathogenic yeast such as aspergillus or candida; diseases caused by infection by a pathogenic protozoan such as malarial parasites or Trypanosoma parasites; and the like.
A route and method of administration are not particularly limited, and can be selected as appropriate in accordance with a target disease. The pharmaceutical composition may be administered to an affected site directly or indirectly. The route and method of administration may be administration of cells in which the fusion protein of the present invention has been expressed. In an example, the route of administration may be oral, intravenous, intramuscular, subcutaneous, intratumoral, rectal, intraarterial, intraportal, intraventricular, transmucosal, transdermal, intranasal, intraperitoneal, intrapulmonary, intrauterine, and the like routes. Topical administration, a method using a gene gun, and the like may also be employed.
A dose and a frequency of administration of the pharmaceutical composition may be selected appropriately according to the degree of a symptom, the age, gender, and body weight of the patient, the administration form, the specific type of disease, and the like.
[Use as Research Tool]
(Research Reagent)
The present invention also provides a research reagent containing the above-described polynucleotide or vector. The research reagent may further contain a component other than the above-described polynucleotide or vector. The component other than the above-described polynucleotide or vector may be one described in the above section “(Pharmaceutical composition)”.
The research reagent may be contained in a container, a package, a dispenser, or the like together with an instruction manual.
[Usage as Research Tool]
The fusion protein of the present invention can be used for analysis of a function of an antigen (e.g., a protein, a polypeptide, or the like) in a cell. In an example, an antigen-binding peptide for the antigen whose function is to be analyzed is intracellularly expressed as the fusion protein of the present invention, so that the function of the antigen is controlled (preferably, inhibited) to enable the analysis of the function of the antigen.
A target cell is not limited to any particular one. Examples of the target cell include a human cell and a non-human animal cell, and more specific examples of the target cell include a vertebrate cell such as a fish cell, an avian cell, and a mammalian cell. Examples of the mammalian cell include a cell of: a laboratory animal such as a mouse, a rat, a rabbit, a guinea pig, and a primate other than a human; a pet animal such as a dog and a cat; a farm animal such as a pig, a cow, a goat, a sheep, and a horse; or a human. The cell may be a cultured cell or an in vivo cell (an undissociated cell in a living organism). Preferable examples of the cell encompass a cultured cell of a human, an in vivo cell of a human, a cultured cell of a non-human disease-model animal, and an in vivo cell of a non-human disease-model animal.
In a case of introducing a viral vector into a target cell, the introduction can be carried out by a method such as suspension of the viral vector in a cell culture medium. In a case of introducing a nonviral vector into a target cell, the introduction can be carried out by a method such as electroporation method, microinjection method, lipofection method, calcium phosphate method, or DEAE dextran method.
An indicator of an outcome of inhibition of a function of an antigen can be, for example, a phenotype change manifested in a cell, a tissue, or an individual. Analysis of a function of an antigen can be carried out in accordance with these indicators. Examples of an index of a change in a cell include a phenotype change of a cell, for example, a quantitative and/or qualitative change of a produced substance, a change in proliferative activity, a change in cell count, a change in morphology, a change in characteristics, apoptosis induction, and the like. As a produced substance, it is possible to use a secretory protein, a surface antigen, an intracellular protein, mRNA, and the like. As a change in morphology, it is possible to use a change in formation of a cell process and/or the number of cell processes, a change in oblateness, a change in extensibility/aspect ratio, a change in cell size, a change in internal structure, a change in atypia/uniformity and cell density of a cell population, and the like. These changes in morphology can be confirmed by observation under a microscope. As a change in characteristics, it is possible to use changes in anchorage dependency, cytokine-dependent responsiveness, hormone dependency, drug resistance, cell motility, cell migratory activity, pulsatility, an intracellular substance, and the like. Examples of cell motility include cell infiltration activity and cell migratory activity. As a change in the intracellular substance, it is possible to use enzyme activity, amount of mRNA, amount of an intracellular messenger such as Ca2+ or cAMP, amount of an intracellular protein, and the like. As a tissue-related indicator, a functional change according to the tissue to be used can serve as a detection indicator. As a living organism-related indicator, a change in tissue weight, a change in a blood system (e.g., a change in blood cell count), a change in amount of protein, a change in enzyme activity, a change in amount of electrolyte, a change in a circulatory system (e.g., a change in blood pressure or heart rate), and the like can be used.
A method for measuring these detection indicators is not particularly limited, and it is possible to use light absorbance, light emission, color, fluorescence, radioactivity, fluorescence polarization degree, surface plasmon resonance signal, time-resolved fluorescence, mass, absorption spectrum, light scattering, fluorescence resonance energy transfer, and the like. These measurement methods are well-known to a person skilled in the art, and can be selected as appropriate in accordance with a purpose. For example, absorption spectrum can be measured by a generally used photometer, plate reader, or the like, light emission can be measured by a luminometer or the like, and fluorescence can be measured by a fluorometer or the like. Mass can be measured by a mass spectrometer. Radioactivity can be measured using a measurement device such as a gamma counter depending on the type of radiation. Fluorescence polarization degree can be measured using BEACON (Takara Shuzo Co., Ltd.). Surface plasmon resonance signal can be measured using BIACORE. Time-resolved fluorescence, fluorescence resonance energy transfer, and the like can be measured using ARVO or the like. Further, a flow cytometer and the like can be used for measurement. These methods of measurement can be used in such a manner that two or more types of detection indicators are measured by one measurement method, and if convenient, two or more types of measurements can be performed simultaneously and/or continuously to enable measuring a greater number of detection indicators. For example, fluorescence and fluorescence resonance energy transfer can be simultaneously measured using a fluorometer.
The fusion protein of the present invention can be used for observation of a behavior of an antigen (e.g., a protein, a polypeptide, or the like) in a cell. In an example, the observation of the behavior of the antigen can be carried out in such a manner that (i) an antigen-binding peptide for the antigen whose behavior is to be observed is intracellularly expressed as the fusion protein of the present invention and (ii) a reaction between the antigen and the fusion protein is detected. The observation of the behavior of the antigen encompasses observation of expression of the antigen, localization of the antigen, and the like at a certain point in time or over time.
The detection of the reaction between the antigen and the fusion protein can be carried out, for example, by using fluorescence, light emission, color, or the like of a detection peptide contained in the fusion protein.
The present invention also provides a method for intracellular expression of an antigen-binding peptide. This expression method includes a step of causing the above-described polynucleotide (i.e., a polynucleotide encoding the fusion protein of the present invention) to be expressed in a cell.
The expression may be constitutive expression or transient expression. The expression may also be inducible expression. For constitutive expression, a polynucleotide in which a promoter capable of constitutive expression is linked to an upstream gene of the fusion protein may be used. For transient expression, for example, RNA instead of DNA may be introduced into and expressed in a cell. For inducible expression, a polynucleotide in which an inducible promoter is linked to an upstream gene of the fusion protein may be used. Then, an inducing factor (e.g., IPTG or the like) may be taken into the cell when the antigen-binding peptide is expressed.
Examples of a target cell include the cells listed in the section “<3. Usage>”.
In the expression method of the present invention, the antigen-binding peptide is expressed in a state where the antigen-binding peptide is fused with an intracellular-stabilizer peptide (that is, as a fusion protein). The fusion protein of the present invention, due to containing the intracellular-stabilizer peptide, has a low isoelectric point as compared with a case in which the antigen-binding peptide is present alone. This allows the fusion protein to undergo less aggregation in a cell as compared with a case in which the antigen-binding peptide is expressed alone in a cell. Thus, the fusion protein can stably function as an intrabody.
In an embodiment, the expression method of the present invention further includes a step of introducing the above-described polynucleotide into a cell. The above-described polynucleotide may be introduced in the form of a vector. Examples of a specific introduction method include the methods described in the section “<3. Usage>”. As such, the present invention further provides a method for producing a cell capable of expressing an antigen-binding peptide in the cell. This production method further includes a step of introducing the above-described polynucleotide (i.e., a polynucleotide encoding the fusion protein of the present invention) or the above-described expression vector into a cell. The present invention further provides a cell capable of expressing the fusion protein of the present invention.
The present invention also provides a kit for producing the above-described polynucleotide encoding a fusion protein containing an intracellular-stabilizer peptide and an antigen-binding peptide, the kit containing a polynucleotide encoding the intracellular-stabilizer peptide.
The kit of the present invention may be a versatile kit that allows easily producing, for a desired antigen-binding peptide, a polynucleotide encoding a fusion protein.
The polynucleotide of the present invention encoding an intracellular-stabilizer peptide may be integrated into the above-described vector. Further, the polynucleotide may contain a factor (e.g., a promoter, a ribosome binding site, a terminator, and the like) necessary for protein expression, a selective marker, a restriction enzyme recognition site, or the like.
Further, the kit of the present invention may further contain at least one of a buffer, a restriction enzyme, another necessary reagent, an instrument, an instruction manual, and the like.
The following will provide Examples to more specifically describe embodiments of the present invention. As a matter of course, the present invention is not limited to Examples provided below, and details of the present invention can be realized in various manners. Further, the present invention is not limited to the embodiments described above, and it may be varied in various ways within the scope of the appended claims. Thus, an embodiment based on a combination of technical means disclosed in different embodiments is encompassed in the technical scope of the present invention. Furthermore, all of the publications and patents cited in the present specification are incorporated herein by reference in their entirety.
[Laboratory Animals]
All experimental procedures were carried out in accordance with the guidelines of the Animal Experiment Committee of RIKEN. Mice which were used were housed on a 12 h:12 h light/dark cycle, with the dark cycle occurring from 20:00 to 8:00.
[Antibodies]
Antibodies used in this study are listed in Table S1.
[Isolation of Antibody-Reactive Phages]
An scFv gene was isolated by the Recombinant Phage Antibody System (RPAS) (GE Healthcare). DNA sequences of scFv-A36 are deposited in the DNA database of Japan (DDBJ) under accession number AB472376.
[Construction of Expression Vectors]
Expression vectors constructed based on PCR using specific primers are described below.
[Production of Recombinant Virus Vectors]
ScFv-GFPA36 and scFv-GFPM4 were produced using AAV1 serotype, and s3Flag-scFv-A36-HA and s3Flag-scFv-M4-HA were produced using AAV9 serotype. Details of AAV vector plasmids and production of the AAV vector plasmids are described below.
[Stereotaxic Injection of AAV Vectors]
Male wild B6 mice or male DAT-cre (+/−) mice (8 weeks old) were anesthetized with isoflurane (Escain; Mylan) via an anesthetizer (MK-A110; Muromachi) and placed into a stereotaxic frame (Stereotaxic Just for Mouse, Muromachi). AAV vectors were injected into the substantia nigra of the right hemisphere (coordinates relative to bregma in millimeters, AP; −3.08, LR; −1.25, DV; −4.5).
[Purification of Recombinant scFv Antibodies]
Recombinant antibody scFv-GFPA36 was expressed in E. coli strain BL21 and purified under denatured or non-denatured condition using Ni-NTA agarose chromatography. Recombinant antibody s3Flag-scFv-A36-HA was purified under non-denatured condition using anti-Flag (M2) antibody-conjugated affinity beads (Sigma) from E. coli strain BL21 co-transformed with pT-Trx vector expressing thioredoxin (Trx) to enhance soluble expression of foreign proteins (Yasukawa et al., 1995).
[Immunofluorescence Staining]
Immunostaining was performed by a standard technique. Immunofluorescence signals were visualized with Alexa Fluor 488- or Alexa Fluor 594-labeled secondary antibodies (Invitrogen). Fluorescence-labeled preparations were imaged under a Fluoview FV1000 confocal microscope (Olympus) or a BZ-9000 fluorescence microscope (Keyence).
[Measurement of Antibody Affinity by ELISA]
The antibody binding affinity of GST-Syt I-C2A was measured by ELISA as described below.
[Behavior Test]
Modified rotarod test was performed with previously reported rotarod test (Shiotsuki et al., 2010) with a modification. In the present study, rotarod for mice (MK-610A, Muromachi) was equipped with a large rod (9 cm in diameter) covered by anti-slip tapes (Nitoflon adhesive tapes, No. 903UL, 0.13 mm in thickness, Nitto denko).
[ScFv Proteins Aligned with scFv-A36]
Accession number and amino acid residues of scFv proteins aligned with scFv-A36 are listed in Table S2.
[Laboratory Animals]
Dat+/IRES-cre mice (Backman et al., 2006) were purchased from Jackson laboratory. AAV virus vectors expressing scFv genes were used together with a DAT-Cre mouse line to selectively express antibody genes in dopamine neurons of substantia nigra. All mice having virus vectors used for microdialysis and behavioral tests were each a male littermate from mated heterozygotes. Balb/c, Balb/c-nu, and wild-type C57B6/J mice purchased from Charles Liver Japan were used for antibody production or experiments using lentivirus vectors and AAV vectors, and primary dopamine neuron culture.
[Isolation of Antibody-Reactive Phages]
In scFv, the heavy- and light-chain variable regions of the antibody are fused by a glycine linker encoded in a single gene. RPAS (GE Healthcare) allows large repertoires of scFv to be displayed on the surface of M13 phages. Total RNA was isolated from mouse (Balb/c) spleen immunized with GST-Syt II-C2A (Fukuda et al., 1994; Fukuda et al., 1999). The heavy- and light-chain variable regions (VH and VL, respectively) were amplified in two separate reactions by using degenerate primers (GE Healthcare). The resultant PCR products were joined by a linker encoding a flexible 15 amino acid chain of (Gly4-Ser)3. The VH-glycine linker-VL complex (scFv) was subcloned into the Sfi I and Not I site of the pCANTAB 5E vector (GE Healthcare). Recombinant phage antibodies were generated by transformation of E. coli TG-1 cells with a phagemid vector containing scFv cDNA and infection of M13-KO7 helper phage. Isolation of antibody-reactive phages was performed by biopanning according to the manufacturer's instruction manual. Log-phase TG-1 cells were infected with antibody-reactive phage. Individual antibody-displayed phages from the phage library were screened by ELISA using recombinant GST-Syt II-C2A bound to the microtiter wells. The antibody-reactive phages were visualized by horseradish peroxidase (HRP)-conjugated anti-M13 antibody. Sequencing of the antibody-reactive scFv clone (termed scFv-A36) was performed by an automated DNA sequencer.
[Construction of Expressing Vectors]
Based on the scFv-A36 cDNA sequence, two linker primers were designed for PCR amplification in which Kozak sequence, T7 peptide, and BamHI restriction enzyme sites were introduced into the 5′ flanking region of A36, and Muni site, hexa histidine residues, and a Not I site were introduced into the 3′ flanking region of A36 (Table 1).
TG
CAATTGCCGTTTTATT-TCCAACTTTGTCCC-3′
Then, the PCR product was directly ligated into the pGEM-T-easy cloning vector (Promega, Tokyo, Japan), (the resultant product was named pGEM-scFv-A36; A of
Then, the digested EGFP fragment was ligated into the BamHI site of pGEM-scFv-A36 to produce a vector pGEM-scFv-GFP A36. To construct pET-scFv-GFP A36, the BamHI-NotI digested fragment of pGEM-scFv-GFPA36 was ligated into the BamHI and NotI sites of a modified pET3a (M. Fukuda, unpublished data) E. coli expression vector (Novagen). For transient expression of scFv-GFPA36 driven by a cytomegalovirus (CMV) promoter in mammalian cells, the NotI fragment of pGEM-scFv-GFPA36 was ligated into pIRES vector (Invitrogen) to produce the vector pIRES-scFv-GFP A36. For the construction of scFv-A36 mutants, a DNA fragment including CDR1 and CDR3 regions of the heavy chain of A36 was amplified by PCR using the two following degenerate primers (Table 3). Note that N is A, C, G, or T (equimolar).
Then, the CDR1 and CDR3 mutant fragments were digested using HindIII and BstEII, and were ligated into the HindIII and Bst EII site of the parental A36. From these DNA fragments, a mutant scFv-displayed phage library was generated as described above. Multiple alignment of amino acid sequences of scFvs was performed by CLUSTALW (version. 2.1: http://clustalw.ddbj.nig.ac.jp/index.php?lang=ja) (Thompson et al., 1994). 3× Flag tag (MDYKDHDGDYKDHDIDYKDDDDK (SEQ ID NO: 1)) and HA tag (YPYDVPDYA (SEQ ID NO: 14)) fused scFv constructs (s3Flag-scFv-HA) were synthesized and codon-optimized for the expression in mice. For transient expression in mammalian cells, the s3Flag-scFv-HA fragments were cloned into the pEF-BOS vector (Mizushima and Nagata, 1990). The s3Flag-scFv-HA fragments were cloned into the pET3a vector for expression and purification of s3Flag-scFv-HA proteins in E. coli BL21 cells.
[Cell Culture and Transfection]
Primary dopamine neuron cultures were prepared from the ventral mesencephalon of embryonic-day 13-14 male and female mouse embryos. Briefly, ventral mesencephalon was dissociated by treatment with trypsin (0.25% for 20 min at 37° C.), followed by trituration with a fire-polished Pasteur pipette in neurobasal medium supplemented with 10% FBS containing DNase I. Dissociated cells (6×104) were plated on poly-L-lysine (1 μg/ml)-coated glass coverslips (Fisherbrand, diameter; 12 mm) in a 24-well plates (Iwaki), and then cultured with 500 μl of neurobasal medium supplemented with B27 (Invitrogen). The cells at 7 days in vitro (DIV) in each well were infected with 5 μl of AAV vectors (Titer: 1×1011 μg/ml) to express GFP-tagged scFv proteins, and followed by immunocytochemistry or dopamine release assay 7 days after infection. 293T and COS-7 cells obtained from RIKEN Bioresource Center Cell Bank (Tsukuba, Japan) were cultured with DMEM supplemented with 10% FBS. These cells were transfected with expression vectors by Lipofectamine2000 according to the manufacturer's instruction manual (Invitrogen) and were used for immunochemical analysis 1 day after transfection.
[Purification of Recombinant scFv Antibodies]
E. coli strain BL21 (DE3) (Novagen) was used for expression of scFv-GFPA36. The expression of scFv-GFPA36 was induced by 1 mM isopropyl-1-thio-β-D-galactopyranoside (IPTG) for 3 h at 30° C. ScFv-GFPA36 protein was solubilized with a buffer (8 M urea, 0.1 M NaH2PO4, 10 mM Tris-HCl [pH 8.0]) and purified by Ni-NTA Agarose chromatography (Qiagen) according to the manufacturer's recommendations. Under denaturing conditions, the column was washed with 4 ml of a buffer (8 M urea, 0.1 M NaH2PO4, 10 mM Tris-HCl [pH 6.3]). ScFv-GFPA36 protein was then eluted from the column with 1 ml of a buffer (8 M urea, 0.1 M NaH2PO4, 0.01 M Tris-HCl [pH 4.5]). The eluted scFv-GFPA36 protein was dialyzed with a buffer (10 mM HEPES-KOH; pH 7.2). To purify scFv-GFPA36 under non-denature condition, the cells expressing scFv-GFPA36 were re-suspended in a PBS buffer containing protease inhibitor cocktail and sonicated on ice, and then solubilized for 1 h at 4° C. by the addition of Triton X-100 (1%). After centrifugation, the supernatant was subjected to Ni-NTA (nickel-nitrilotriacetic acid, GE Healthcare) chromatography. Expressed scFv-GFPA36 was eluted from the column with a buffer (10 mM HEPES-KOH; pH 7.2) containing 5 mM Histidine and followed by dialysis against a buffer (10 mM HEPES-KOH; pH 7.2, 150 mM NaCl).
To purify s3Flag-scFv-A36-HA under non-denatured condition, E. coli BL21 (DE3) competent cells (Novagen) were co-transformed with pET3a vector (Novagen) expressing s3Flag-scFv-A36-HA and pT-Trx vector expressing thioredoxin (Trx) to enhance soluble expression of foreign proteins (Yasukawa et al., 1995). Log phase transformed cells were induced by the addition of 1 mM IPTG. The cells were collected by centrifugation 3 h after induction. The cells were re-suspended in a PBS buffer containing protease inhibitor cocktail. The cell suspension was sonicated on ice and solubilized for 1 h at 4° C. by the addition of Triton X-100 (1%). After centrifugation and filtration with 0.45 μm pore filter, the supernatant was subjected to purification chromatography using anti-Flag (M2) antibody-conjugated affinity beads (Sigma). Expressed s3Flag-scFv-A36-HA was purified according to the manufacturer's recommendations. s3Flag-scFv-A36-HA was eluted from the column with a buffer (50 mM Tris-HCl, pH 7.4, 150 mM NaCl) containing 3× Flag peptide (1 mg/ml) and dialyzed against a buffer (20 mM Hepes-KOH, pH 7.2, 50 mM NaCl).
[Measurement of Antibody Affinity by ELISA]
Purified GST-Syt I-C2A (0.25 pmol) in buffer was coated in 96-well plates for 16 h at room temperature. Each wells was blocked with 5% skim milk in a PBS buffer for 2 h at room temperature and was incubated with 0.22 nM to 36 nM purified s3Flag-scFv-A36-HA. The binding was quantified by incubation with mouse anti-Flag (M2) primary antibody and HRP-conjugated anti-mouse secondary antibody. Specific binding was calculated by subtracting the binding of s3Flag-scFv-A36-HA to 0.25 pmol GST-coated wells. Nonlinear regression of the s3Flag-scFv-A36-HA binding data was performed with the Hill-Langmuir equation,
where B is the concentration of s3Flag-scFv-A36-HA bound to the GST-Syt I-C2A, Bmax is the concentration of the total binding sites, [s3Flag-scFv-A36-HA] is the free s3Flag-scFv-A36-HA concentration, and Kd is the dissociation constant.
[Immunofluorescence Staining]
Immunocytochemistry and immunohistochemistry were performed by standard technique as follows. The cells were fixed with 4% PFA for 2 min at room temperature, followed by permeabilization with 0.3% Triton X-100 in PBS for 2 min at room temperature. The cells were then immediately washed three times with a blocking solution (1% BSA and 0.1% Triton X-100 in PBS), followed by incubation with the blocking solution for 1 h at room temperature and then with the primary antibodies for 2 h at room temperature. Immunofluorescence signals were visualized by incubation with Alexa Fluor 488- or Alexa Fluor 594-labeled secondary antibodies (Invitrogen). The primary antibodies and the secondary antibodies conjugated with Alexa Fluor dyes are listed in Table S1. In the experiments quantifying the percentage of the cells with intrabodies-formed aggregates, at least 100 cells in a dish per each experiment were counted for quantification of percentage of cells with aggregates. The data were obtained from three independent experiments. For immunohistochemistry, mice were fixed in 4% paraformaldehyde. Cryosections of the mice's brains (16 μm in thickness) were permeabilized with 0.3% Triton X-100 in PBS for 2 h at room temperature and incubated with primary antibodies in blocking solution (1% BSA, 0.1% Triton X-100) for 16 h at 4° C. Immunofluorescence signals were visualized with Alexa Fluor 488- or Alexa Fluor 594-labeled secondary antibodies (Invitrogen). Fluorescence-labeled preparations were imaged under a Fluoview FV1000 confocal microscope (Olympus) or a BZ-9000 fluorescence microscope (Keyence).
[Immunoblot Analysis]
Flag-tagged full-length mouse Syt I-XI were prepared as described previously (Fukuda et al., 1999). Total homogenate of Flag-tagged Syt I-XI transiently expressed in COS-7 cells was subjected to 10% sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and transferred to a polyvinylidene difluoride (PVDF) membrane. Purified scFv-GFPA36 (1.6 μg/ml) was used as the primary antibody. HRP-labeled anti-T7 monoclonal antibody (1/5000 dilution, Merck Millipore) was used as the secondary antibody. Immunoreactive bands were visualized by an enhanced chemiluminescence (ECL) detection system (GE Healthcare). To ensure that equivalent amounts of Flag-tagged Syts have been loaded, the blots were reprobed with anti-Flag antibody. To investigate whether purified s3Flag-A36-HA recognized mouse Syt I/II in the brain, the mouse brain tissues were isolated and homogenized in a homogenization buffer (20 mM HEPES-KOH, pH 7.2, 150 mM NaCl, 0.5% TrintonX-100, and complete protease inhibitor cocktail; Roche) and agitated for 1 h at 4° C. Total homogenate of 2.5-μg protein was subjected to western blotting using purified s3Flag-A36-HA as a primary antibody. Immunoreactive bands were visualized by ECL using anti-Flag antibody (the secondary antibody) and HRP-labeled anti-mouse antibody. In the experiments using the mouse brain injected with AAV vectors, the mouse brain tissues were isolated and homogenized in a buffer (PBS, 0.5% NP40, 1 mM 2ME, 2 mM EDTA, and complete protease inhibitor cocktail) and followed by shearing with 27-G needle syringe, and agitating for 1 h at 4° C. The total homogenate was subjected to western blotting using anti-TH, anti-Tubulin, anti-Syt I antibodies as primary antibodies.
[Immunoprecipitation]
COS-7 cells were cotransfected with pIRES-scFv-GFPA36 or pIRES-scFv-GFPM4 and pEF—BOS-Flag-Syt I, or control vector (pEF-BOS). Transfection of plasmid DNA was performed by LipofectAMINE (Invitrogen) according to the manufacturer's recommendations. Two days after transfection, the cells were scraped and homogenized in a buffer (10 mM HEPES-KOH [pH 7.2], 100 mM NaCl, 1 mM β-mercaptoethanol). The homogenate was centrifuged at 1,200×g for 5 min at 4° C., and the supernatant was solubilized with a lysis buffer (10 mM HEPES-KOH [pH 7.2], 0.1% Triton X-100, 100 mM NaCl, 1 mM β-mercaptoethanol) for 1 h at 4° C. After centrifugation at 20,400×g for 15 min at 4° C., the supernatant was transferred to a new tube, and Flag-Syt I or II was immunoprecipitated by anti-Flag antibody (Sigma) and protein A sepharose (GE Healthcare). After washing the beads with lysis buffer, the beads were boiled in 1×SDS sample buffer (62.5 mM Tris-HCl [pH 6.8], 2% SDS, 2% β-mercaptoethanol, 0.001% bromophenol blue [BPB], 10% glycerol). After centrifugation at 13,000×g for 5 min, the supernatant was used for western blot analysis. Coimmunoprecipitated scFv-GFPA36 was first detected by HRP-labeled anti-T7 antibody. Blots were reprobed with anti-Syt I antibody (Stressgen) to ensure that Flag-Syt I was precipitated. To examine the interaction of Syt I and intracellular s3Flag-scFv-A36-HA, 293T cells were cotransfected with pEF-BOS-Syt I and pEF-BOS-s3Flag-scFv-A36-HA or pEF-BOS-s3Flag-scFv-M4-HA vector using Lipofectamine2000. Twenty-eight hours after transfection, the cells were scraped, lysed in a buffer (20 mM HEPES-NaOH [pH 7.4], 150 mM NaCl, 0.5% Triton X-100, protease inhibitor (EGTA-free, Roche)) for 1 h, and followed by shearing with a 27-gauge needle syringe. The homogenate was centrifuged at 1,5000 rpm for 10 min at 4° C., and the supernatant was transferred to a new tube containing CaCl2 (500 μM) and was subjected to immunoprecipitation by anti-HA agarose (Sigma). After washing the beads with lysis buffer containing 500 CaCl2, the beads were boiled in 1×SDS sample buffer for 3 min. After centrifugation at 12,000× rpm for 5 min, the supernatant was used for western blot analysis. Coimmunoprecipitated Syt I was detected by the primary anti-Syt I (Stressgen) antibody and the secondary HRP-labeled anti-mouse-IgG Light chain specific antibody. Blots were also probed with anti-Flag (M2) primary antibody (Sigma) and anti-HRP-labeled anti-mouse-IgG Light chain specific secondary antibody to ensure that scFv proteins were precipitated.
[Produce of AAV Vectors]
The AAV9/3 vector plasmids contained the human synapsin I promoter (hSynIp), followed by the inverted cDNA of interest between the double loxP sequence (loxP-lox2722) derived from pAAV-DIO-eNpHR-YFP vector (addgene: #26966), a 241-bp fragment (FrgH) containing nucleotides 2519-2760 derived from rat tau 3′-UTR (Brun et al., 2003), a woodchuck hepatitis virus posttranscriptional regulatory element (WPRE), and a simian virus 40 polyadenylation signal sequence (SV40 pA) between the inverted terminal repeats of the AAV3 genome. The AAV9 vp cDNA with a mutation (T466F) (Gao et al., 2004) was synthesized as described previously (Petrs-Silva et al., 2011). The recombinant AAV9/3 vectors were produced by transient transfection of HEK293 cells using the vector plasmid, an AAV3 rep and AAV9 vp expression plasmid, and the adenoviral helper plasmid pHelper (Agilent Technologies) as described previously (Li et al., 2006), resulting in the vectors, AAV9/3-hSynIp-DIO-s3Flag-scFv-A36 or -M4-HA. The recombinant viruses were purified by isolation from two sequential continuous CsCl gradients, and the viral titers were determined by qRT-PCR.
The AAV1 vector plasmids contained the hSynIp, followed by the cDNA of interest, FrgH, WPRE, and SV40 pA between the inverted terminal repeats of the AAV1 genome. Recombinant AAV1 vectors were produced as described above, resulting in the vectors AAV1-hSynIp-scFvGFPA36 or M4.
[Stereotaxic Injection of AAV Vectors]
Male wild mice or female DAT-cre (+/−) mice (8 weeks old) were anesthetized with isoflurane (Escain; Mylan). The skull at injection site was then cut by a drill (Model 1474 Stereotaxic drill, Muromachi). AAV vectors were injected into the substantia nigra of the right hemisphere (coordinates relative to bregma in millimeters, AP; −3.08, LR; −1.25, DV; −4.5) using a 33-gauge needle and a 5-μl syringe (Model 75 RN SYR, Hamilton) controlled by an injection pump (Legato 130, Muromachi) at 0.2 μl min−1 for 2 μl. The needle was left in place after injection for 10 min. At least 33 days after injection, the mice were used for microdialysis, behavior test, or immunochemical analysis.
[Measurement of Dopamine Release Using Primary Cultured Dopamine Neurons]
The primary dopamine neurons 7 days after infection with AAV vectors were washed two times with 500 μl of a pre-warmed PSS-LK buffer (20 mM HEPES-NaOH, pH 7.4, 140 mM NaCl, 4.7 mM KCl, 2.5 mM CaCl2, 1.2 mM MgSO4, 1.2 mM KH2PO4, 11 mM glucose), and the cells were then incubated with 200 μl of a PSS-LK buffer for 5 min at 37° C. After the PSS-LK buffer was collected, the cells were stimulated with 200 μl of a PSS-HK buffer (20 mM HEPES-NaOH, pH 7.4, 85 mM NaCl, 60 mM KCl, 2.5 mM CaCl2, 1.2 mM MgSO4, 1.2 mM KH2PO4, 11 mM glucose) for 5 min at 37° C. Collected supernatants were immediately mixed with 10 μl of 0.1 M perchloric acid (PCA) containing 50 μM EDTA-2Na, and then sonicated for 30 sec and followed by centrifugation at 20,000 g and 0° C. for 15 min. The supernatant (190 μl) was transferred to a new tube and mixed with 1.7 μl of 5 M CH3COONa to adjust the pH to approximately 3.0. After the PSS-HK buffer was collected, the cells were lysed with 200 μl of 5 mM PCA containing 2.5 μM EDTA-2Na. The samples (200 μl) were sonicated and mixed with 2.4 μl of 5 M CH3COONa. All samples were then filtered through 0.45 μm polyvinylidene fluoride (PVDF) micropore filters (Millipore), and the filtrates were analyzed by high-pressure liquid chromatography (HPLC) coupled to an electrochemical detection system (ECD300, Eicom) according to a previous report (Kabayama et al., 2013). The amount of dopamine released from the primary cultured dopamine neurons exposed to highly-concentrated KCl is expressed as a percentage of the total dopamine contained in the cells.
[In Vivo Microdialysis in Freely Moving Mice]
Mice were each anesthetized with isoflurane (Escain; Mylan) via a small-animal anesthetizer (MK-A110; Muromachi) and placed into a stereotaxic frame (Stereotaxic Just for Mouse, Muromachi). A hole was made for implantation of a steel guide cannula (AG-4; Eicom) on the striatum of the right hemisphere (coordinates relative to bregma, AP; +0.6 mm, LR; −2.0 mm, DV; −2.0 mm), and another hole was made to anchor a stabilizing screw. The guide cannula and the stabilizing screw were fixed with dental cement (Unifast3; GC). After the dental cement completely dried, a microdialysis probe (A-I-4-02; Eicom) was inserted into the striatum through the guide. The implantation of microdialysis probes was completed in 3.5 h to 4.5 h after the mice started to be anesthetized. Each mouse inserted with a microdialysis probe was placed onto a paper towel (Kimtowel, Nippon Paper Crecia) in a transparent microdialysis cage (20 cm in length×20 cm in width×21 cm in height) with water and food. On the next day following implantation surgery, the mouse was placed onto a new paper towel (Comfort200, Nippon Paper Crecia) in a transparent microdialysis cage without food and water. To measure basal dopamine release, collection of dialysate was conducted between 10:00 and 11:00 on the next day following the probe-implantation surgery. The microdialysis probe was continually perfused with a Ringer's solution containing 147 mM NaCl, 4.02 mM KCl, 2.25 mM CaCl2 using a syringe pump (ESP-32, Eicom) at a rate of 1 μl min−1. The dialysate was collected at 4° C. automatically at 10 min intervals into a plastic microtube preloaded with 5 μl of 0.1 M CH3COOH/250 μM EDTA-2Na using a refrigerated fraction collector (Refrigerated collector 820, Univentor). The collection of dialysate was conducted 16.5 h to 17.5 h after the implantation of the microdialysis probes. All dialysate samples were stored at 4° C. and analyzed by HPLC on the following day.
[Biopsy of Brain Section]
The brains were collected immediately after decapitation, and 50-μm-thick frozen coronal sections were prepared. Circular tissue punches were collected from 12 substantia nigra sections and 8 striatum sections (4 anterior sections from coordinates, AP; +0.6 mm, and 4 posterior sections from coordinates, AP; +0.6 mm) using disposable biopsy needles (Biopsy Punch; Kai Medical) with a diameter of 1.5 mm. The samples were homogenized in 0.1 M perchloric acid containing 0.1 mM EDTA and centrifuged for 15 min at 20,000×g at 4° C. The supernatant was then filtered through a 0.22 μm polyvinylidene fluoride (PVDF) filter (GV Durapore, Millipore), and the filtrate samples were analyzed by HPLC.
[HPLC]
The samples derived from primary cultured neurons and biopsy of brain sections were analyzed by HPLC (ECD300, Eicom) according to a previously reported protocol (Kabayama et al., 2013). The microdialysis samples were analyzed by HPLC (ECD500, Eicom) according to the manufacturer's notes.
[Behavior Test]
Rotarod test with a rod (3 cm in diameter) has been generally used for motor skill learning of mice. A previous study demonstrated in a modified rotarod test for mice that a steeper learning curve was obtained by the rotarod test employing a combination of a large drum and slow rotation (9 cm in diameter and 10 rpm) (Shiotsuki et al., 2010). In the present study, rotarod for mice (MK-610A, Muromachi) was equipped with a large rod (9 cm in diameter) covered by anti-slip tapes (Nitoflon adhesive tapes, No. 903UL, 0.13 mm in thickness, Nitto denko). Prior to training sessions, habituation was performed by keeping each mouse on a stationary drum for 3 min on the first day. The habituation was repeated every day for 1 min just before the session. The rotation was set at a slow speed (5 rpm, 2.8 m/min on the surface). The mouse was placed back on the drum immediately after falling, up to 5 times in one session. The test was repeated one session a day for five consecutive days. The latency to falling was recorded manually and the total latencies on the rod before (Day 1) and after (Day 5) training were analyzed by two-way repeated measures ANOVA.
[Protein Sequence Analysis]
Isometric point and net charge at intracellular pH (7.4, 7.03, 6.60) were calculated from the amino-acid sequence of each intrabody including peptide tags using Protein calculator v3.4 developed by Chris Putnam ant the Scrips Research Institute (http://protcalc.sourceforge.net/).
[Statistical Analysis]
All the data are representative of at least three independent experiments. The results are expressed as the mean±SEM. The data were analyzed by two-tailed unpaired t-test, two-tailed non-repeated ANOVA followed by Newman-Keuls post hoc multiple comparison test, or two-way repeated measures ANOVA followed by bonferroni post hoc multiple comparison test with the GraphPad Prism 4.0 program (GraphPad Software). P<0.05 was considered statistically significant.
First, an ScFv gene encoding an antibody specific for the C2A domain of Syt I/II (Syt I/II-C2A) was isolated by using a phage display system. To investigate specificity of isolated scFv-displayed phages, the C2B domain of Syt I/II (Syt I/II-C2B) was used as a negative control. Enzyme-linked immunosorbent assay (ELISA) demonstrated that one of the isolated ScFv-displayed phages (termed scFv-A36) bound to glutathione S-transferase (GST)-Syt II-C2A and did not bind to GST-Syt II-C2B or GST (A of
Because Syt I/II act as major Ca2+ sensor for fast neurotransmitter release in the brain, the inhibitory effect of scFv-A36 on dopamine release was examined next. To express scFv-GFPA36 and scFv-GFPM4, AAV vectors were constructed (termed AAV-scFv-GFPA36 and AAV-scFv-GFPM4, respectively). Primary cultured dopamine neurons at DIV7 prepared from substantia nigra of mouse embryo were infected with the AAV vectors. The cells were fixed and analyzed 7 days after infection with AAV. Both scFv-GFPA36 and scFv-GFPM4 were diffusely expressed without aggregates in the neurons (
There is a positive correlation between the net negative charge of intrabodies at cytoplasmic pH 7.4 and stability of intrabodies at cytoplasm in mammalian cells (Kvam et al., 2010). For example, VHH-H7 intrabody that has a high net negative charge (−5.0) at pH 7.4 is well expressed at cytoplasm with less aggregates in mammalian cells (Kvam et al., 2010). This suggests that the stable intracellular expression of intrabodies can be predicted in a case where the intrabodies have a net negative charge value of less than −5.0 at pH 7.4. In fact, scFv-GFPA36 and scFv-GFPM4 that have the same net negative charge −5.0 at pH 7.4 were stably expressed in primary cultured dopamine neurons for 7 days (
Next, the stability of scFv-A36 and scFv-M4 intrabodies fused with these peptide tags at cytoplasm in mammalian cells was examined. Immunocytochemical analysis revealed that s3Flag-scFv-A36-HA and s3Flag-scFv-M4-HA were diffusely expressed with little aggregate in HeLa cells (B of
Subsequently, the biochemical property of s3Flag-scFvA-36-HA construct was examined. The binding affinity of purified s3Flag-scFv-A36-HA with GST-Syt I-C2A was measured. S3Flag-scFv-A36-HA was purified from E. coli using anti-Flag antibody-conjugated affinity beads. ELISA experiments demonstrated that purified s3Flag-scFv-A36-HA interacted with Syt I-C2A, but not Syt I-C2B (A of
Next, whether s3Flag-scFv-HA is stably expressed in neurons of mouse brain was investigated. AAV9/3-hSynIp-DIO-s3Flag-scFv-A36 (or M4)-HA was injected to the substantia nigra of right hemisphere in DAT-cre mice. Immunohistochemistry revealed that s3Flag-scFv-A36-HA and s3Flag-scFv-M4-HA were stably expressed at cytoplasm of dopamine neurons in SNc and VTA of right hemispheres 33 days after AAV9/3 vectors injection (A through L of
Parkinson's disease (PD) is a neurodegenerative disorder that is accompanied by motor deficits including tremor, rigidity, slowness of movement, and postural instability. Most characteristic features in patients are loss of dopamine neurons mainly in SNc and a decrease in dopamine concentration in the striatum. Thus, to examine the direct role of striatum dopamine release in motor behavior, open field test and modified rotarod test were performed. AAV9/3-hSynIp-DIO-s3Flag-scFv-A36 (or M4)-HA was bilateral injected into substantia nigra of DAT-cre mice. Four weeks after AAV injection, the mice were subjected to open field test, and 5 or 6 days later, to modified rotarod test. There was no difference of total distance, speed of movement, center of time, and total rearing number between s3Flag-scFv-A36-HA- and s3Flag-scFv-M4-HA-expressing mice (A through D of
Next, anti-Kras monoclonal antibody (Y13-259; SEQ ID NO: 22) was fused with s3Flag and HA to produce s3Flag-scFv-Y13-259-HA (STAND-Y13-259; SEQ ID NO: 23) in a similar manner to the above Examples, and evaluation was made as to whether or not s3Flag-scFv-Y13-259-HA had antitumor activity. Since DNA sequence of Y13-259 was not deposited in the database, a mouse codon-optimized sequence was designed. DNA sequence of STAND-Y13-259 is represented by SEQ ID NO: 24. DNA sequence of myc-Y13-259 is represented by SEQ ID NO: 25. DNA synthesis was outsourced to Genescript.
(1) In Silico Analysis
In designing STAND-Y13-259, in silico analysis was conducted, which demonstrated that fusion of s3Flag tag and HA tag drastically increased the net negative charge of scFv-Y13-259 even at pH 6.6 (A of
(2) Evaluation of Binding Capacity of STAND-Y13-259
Next, the binding affinity between STAND-Y13-259 and GST-Kras was measured by ELISA in a manner described in the above Examples. The measurement confirmed that STAND-Y13-259 also maintained a high Kras-binding activity (B of
(3) Evaluation of Antitumor Activity
Next, the viability of MIA PaCa2 cells infected using lentivirus cell vectors in a manner as described above was measured by MTS analysis 4 days after infection. The measurement indicated that the viability is significantly reduced by the expression of STAND-Y13-259 (E of
To evaluate the performance of other peptide tags, DE2.0 tag and DE5.0 tag were produced, and the stabilization effect of DE2.0 tag and DE5.0 tag was studied. In a similar manner to Example 7, the following fusion proteins containing DE2.0 tag (DEQENDYDEPEVNDENQDYDE (SEQ ID NO: 13)) were produced: DE2.0-Y13-259 (SEQ ID NO: 27) obtained by fusing DE2.0 tag with the N-terminal of an anti-Kras monoclonal antibody-derived peptide (Y13-259; SEQ ID NO: 22); DE2.0-Y13-259-HA (SEQ ID NO: 28) obtained by further fusing HA peptide with the C-terminal of DE2.0-Y13-259; DE2.0-Y13-259-PA (SEQ ID NO: 29) obtained by further fusing PA peptide with the C-terminal of DE2.0-Y13-259; and protein STAND-6E-LYS obtained by fusing DE2.0 tag with both of the N- and C-terminals of scFV sequence (scFv-6E) of an antibody (Barkhordarian et al., 2006: Protein Engineering, Design and Selection, Volume 19, Issue 11, 1 Nov. 2006, Pages 497-502) specifically binding to aggregated and fibrous human α-synuclein. Heat shock cognate protein 70 (HSC70)-binding peptide (MARVKKDQAEPLHRKFERQPPG (SEQ ID NO: 31)) as a functional peptide was further fused with STAND-6E-LYS, at a position downstream of DE2.0 tag on the C-terminal side, and HA peptide was further added to a position downstream of HSC70-binding peptide. The full length of the amino acid sequence of STAND-6E-LYS thus produced is represented by SEQ ID NO: 32.
As a fusion protein containing DE5.0 tag (DDDEDEDDEDEDEDEDEDEDED (SEQ ID NO: 33)), DE5.0-6E (amino acid sequence: SEQ ID NO: 35, base sequence: SEQ ID NO: 36) was produced by fusing DE5.0 tag with the N-terminal of scFv-6E and further fusing T7 tag (SEQ ID NO: 34: MASMTGGQQMG) with the C-terminal of scFv-6E. All of the DNA encoding these fusion proteins were human codon-optimized, and were synthesized by GenScript.
Note that DNA sequences of DE2.0-Y13-259-HA and STAND-6E-LYS are represented by SEQ ID NO: 30 and SEQ ID NO: 37, respectively.
cagctgttggagtctgggggaggcttggtacagcctggggggtccctgagactctcctgtgcagcctctggattcacctttagcagc
tatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctcatatattgctagtggtggtgatactacaaattac
gcagactccgtgaagggccggttcaccatctccagagacaattccaagaacacgctgtatctgcaaatgaacagcctgagagccgag
gacacggccgtatattactgtgcgaaaggtgcttctgcttttgactactggggccagggaaccctggtcaccgtctcgagcggtgga
ggcggttcaggcggaggtggcagcggcggtggcgggtcgacggacatccagatgacccagtctccatcctccctgtctgcatctgta
ggagacagagtcaccatcacttgccgggcaagtcagagcattagcagctatttaaattggtatcagcagaaaccagggaaagcccct
aagctcctgatctatgctgcatcctatttgcaaagtggggtcccatcaaggttcagtggcagtggatctgggacagatttcactctc
accatcagcagtctgcaacctgaagattttgcaacttactactgtcaacagagttctaatgatccttatacgttcggccaagggacc
aaggtggaaatcaaacggagatctatggatgaacaggagaacgattatgatgagccagaagtgaacgacgagaaccaggattatgat
gactacgct
tga
MDEQENDYDEPEVNDENQDYDEGSAEVQLLESGGGLVOPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSYIASGGDTTNYAD
SVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGASAFDYWGQGTLVTVSSGGGGSGGGGSGGGGSTDIQMTQSPSSLSASVGD
RVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASYLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSSNDPYTFGQGTKV
cttctcgagtctggcggcgggttggtgcagcctggaggatccctgagattatcctgtgcagctagcgggttcactttctcgtcctat
gccatgtcatgggttcgccaagctcccggcaaagggttggagtgggtgagctacattgccagtggaggcgatactaccaattacgcg
gacagtgtgaagggtaggtttaccattagccgggataacagcaagaacactctctacctgcagatgaactctctgagagcggaggat
acagccgtgtactattgcgcaaaaggcgcatccgctttcgactattggggtcaaggcactctcgtaaccgtgtctagtggcggaggt
ggttcagggggcggcggatcaggagggggaggcagtacagatatccagatgacacagagtccctcctctctgtccgcttctgtcggc
ctgctgatctatgccgcctcctacctacagagcggtgttccaagccgcttttcaggcagcgggtctgggacagatttcactctgacc
atatcctcgcttcagccagaggactttgcaacctactattgccagcagtcctcaaatgacccgtatacctttggacaagggaccaag
DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGASAFDYWGQGTLVTVSSGGGGSGGGGSGGGGSTDIQMTQSPSSLSASVG
DRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASYLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSSNDPYTFGQGTK
From in silico analysis, it was found that a drastic increase in the net negative charge of scFv-Y13-259 is caused also by fusion of only DE2.0 tag (A of
DE2.0-Y13-259-HA-encoding DNA was introduced into MIA PaCa2 cells with use of a lentivirus vector. The introduction confirmed expression of DE2.0-Y13-259-HA in the cells without aggregates, and thus confirmed stronger binding of DE2.0-Y13-259-HA to endogenous Kras in the cells than STAND-Y13-259 (A of
STAND-6E-LYS-encoding DNA and DE5.0-6E-encoding DNA were cloned into pEF-BOS vector, which is a mammalian expression vector, to produce expression vectors (STAND-6E-LYS expression vector; pEF-BOS-STAND-6E-LYS, DE5.0-6E expression vector; pEF-BOS-DE5.0-6E). STAND-6E-LYS expression vector and DE5.0-6E expression vector were introduced into HeLa cells with use of Lipofectamin2000, cultured for 18 hours, and then fixed with 4% PFA. STAND-6E-LYS and DE5.0-6E were subjected to staining with HA antibody and T7 antibody, respectively. It was confirmed that both STAND-6E-LYS and DE5.0-6E were expressed in the cells without aggregates (
Subsequently, the effect of STAND-6E-LYS on α-synuclein aggregation was examined. α-synuclein aggregation assay was performed with use of α-synuclein Fibril (Tarutani et al., 2018: Acta Neuropathol Commun. 2018 Apr. 18; 6(1): 29.), which was obtained by subjecting human recombinant α-synuclein purified from E. coli to sonication to make human recombinant α-synuclein fibrous and aggregated. Human-derived SHSYSY cells were used in the assay. HSC70-binding peptide integrated into STAND-6E-LYS consists of HSC70-binding motif (VKKDQ (SEQ ID NO. 38)) and HSC70-binding consensus motif (KFERQ (SEQ ID NO. 39)) of α-synuclein. It has been demonstrated in vitro and in vivo that fusion between a peptide binding to mutant huntingtin protein and a HSC70-binding peptide allows degradation of mutant huntingtin protein by chaperon-mediated autophagy (CMA) to be promoted. Provision of a peptide (including scFv) capable of specifically binding to a target molecule would thus enable CMA-dependent degradation of the target protein molecule. pEGFP-α-synuclein vector expressing a protein (EGFP-synuclein) obtained by fusing the full length of human α-synuclein with green fluorescence protein EGFP was constructed, and was introduced by gene delivery into SHSYSY cells together with STAND-6E-LYS expression vector, with use of XtremGENE9 (Sigma). Six hours later, Fibril protein was introduced into the cells with use of MultiFectam (Promega), cultured for 3 days, and then fixed with 4% PFA. Then, STAND-6E-LYS was detected with use of anti-HA antibody, and staining was carried out using anti-phosphorylated α-synuclein antibody (Mouse, WAKO). The gene delivery and protein introduction by XtremeGENE9 and MultiFectam were performed according to the manufacturers' standard protocols. The occurrence ratio of the number of cells in which GFP-synuclein was aggregated into dots and the occurrence ratio of phosphorylated synuclein positive cells were measured to quantify aggregates caused by Fibril.
In approximately 14% of cells into which a control vector had been introduced, Fibril caused EGFP-synuclein to be localized into dots. It was found that these dots of synuclein were co-stained by anti-PSer129-synuclein antibody which detects phosphorylation of the 129th amino acid of α-synuclein, which phosphorylation is a marker of the brain of a patient with Parkinson's disease (
These results indicated that the present invention was extremely effective for causing an antigen-binding peptide to be intracellularly expressed without aggregates and thus maintaining the function of the antigen-binding peptide.
The present invention is applicable, for example, to various research and to medical science such as diagnosis and treatment.
| Number | Date | Country | Kind |
|---|---|---|---|
| 2017-124596 | Jun 2017 | JP | national |
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/JP2018/024197 | 6/26/2018 | WO | 00 |
