Gene encoding alkaline liquefying alpha-amylase

Information

  • Patent Application
  • 20080050807
  • Publication Number
    20080050807
  • Date Filed
    April 22, 2004
    22 years ago
  • Date Published
    February 28, 2008
    18 years ago
Abstract
The present invention provides a DNA fragment encoding alkaline liquefying α-amylase, recombinant DNA containing the DNA fragment, a transformed microorganism harboring the recombinant DNA, as well as a method for producing alkaline liquefying α-amylase using the transformant. The method of the present invention enables mass production of alkaline liquefying α-amylase useful as a detergent component.
Description

BRIEF DESCRIPTION OF THE DRAWINGS


FIG. 1 shows a restriction enzyme map of a fragment of the gene encoding an alkaline liquefying amylase;



FIG. 2 is a chart depicting construction of pAML1OO using a fragment of the gene encoding an alkaline liquefying amylase; FIG. 3 shows nucleotide sequences of primers used.



FIG. 4 is a pH profile of an alkaline liquefying α-amylase produced by Bacillus sp. KSM-AP1378.





BEST MODE FOR CARRYING OUT THE INVENTION

In the present invention, a useful microorganism which serves as an alkaline liquefying α-amylase gene donor may be, for example, Bacillus sp. KSM-AP1378 (FERM BP-3048, deposited Jul. 24, 1989 in Fermentation Research Institute, Agency of Industrial Science and Technology of 1-3, Higashi 1-chome, Tsukuba-shi, Ibaraki, 305 Japan), which is an alkalophilic Bacillus strain. This strain was isolated from the soil in the vicinity of the city of Tochigi in Tochigi Prefecture, Japan by the present inventors and identified as a strain which produces significant amounts of alkaline liquefying α-amylase. This strain was deposited at the Fermentation Research Institute, Agency of Industrial Science and Technology (1-3, Higashi 1-chome, Tsukuba-shi, Ibaraki-ken, 305, Japan) under FERM BP-3048 on Aug. 8, 1990 (originally deposited as P-10886 on Jul. 24, 1989).


In order to obtain chromosomal DNA from a donor microorganism, the method proposed by Marmur, J. (J. Mol. Biol., 3, 208 (1961)) or the method proposed by Saito, H. and Miura, K. (Biochem. Biophys. Acta, 72, 619 (1963)) may be used. Other similar methods may also be used.


DNA fragments comprising the alkaline liquefying α-amylase gene are prepared by cleaving the thus-obtained chromosomal DNA using restriction enzymes. Restriction enzymes which may be used are not particularly limited so long as they do not fragment the gene. The alkaline liquefying α-amylase gene may also be obtained by PCR (Mullis, K. B. and Faloona, F. A., Methods Enzymol., 155, 335 (1987); Saiki, R. K. et al., Science, 239, 487 (1988). For example, the gene may be obtained through the synthesis of primers having sequences corresponding to those on the upstream side of the 5′-terminus and on the downstream side of the 3′-terminus of the essential region based on the nucleotide sequence described in Sequence No. 1, and subsequently conducting PCR using, the chromosomal DNA of an alkaline liquefying α-amylase-producing microorganism as a template. Alternatively, an intact gene may be obtained by first obtaining a fragment of the alkaline liquefying α-amylase gene from an alkaline liquefying α-amylase-producing microorganism using any procedure, followed by PCR which amplifies the upstream and downstream sides of the fragmentary gene.


The thus-prepared genetic fragment is then subjected to cloning. Host/vector systems which may be used are not particularly limited, so far as that host bacterial strains express the alkaline liquefying α-amylase gene of the present invention, that the recombinant DNA molecules can be replicated in the host bacteria, and that the integrated gene can be stably harbored. For example, members of the EK system in which the host is E. coli K-12, and members of the BS system in which the host is Bacillus subtilis Marburg, may be used. Use of the EK system, which encompasses many kinds of vectors and which is extensively studied genetically, provides good results and thus is preferred. Specific examples of host bacteria include HB101, C600, and JM109 of the EK system, and BD170, MI112, and ISW1214 of the BS system. Specific examples of vectors include pBR322 and pUC18 for the EK system, and pUB110 and pHY300PLK for the BS system.


A recombinant plasmid DNA molecule is created by cleaving a vector with a restriction enzyme followed by ligation with the above-mentioned chromosomal or PCR-amplified DNA fragment. The ligation may be achieved, for example, through the use of a DNA ligase.


Methods for transforming host bacterial strains using a recombinant DNA molecule are not particularly limited. For example, a calcium chloride method (Mandel, M. and Higa, A., J. Mol. Biol., 53, 159 (1970)) may be used in the case of hosts of the EK system, and a protoplast method (Chang, C. and Cohen, S. N., Mol. Gen. Genet., 168, 111 (1978)) may be used in the case of hosts of the BS system. Selection of recombinant microorganisms are performed as follows. First, microorganisms which have been transformed with DNA which contains a vector-derived DNA fragment are selected, using as an index a character which is not inactivated by insertion of exogenous chromosomal DNA fragments, such as resistance to antibiotics coded onto the vector DNA. For example, in a specific case in which pBR322 of the EK system is used as a vector, and a HindIII fragment of chromosomal DNA is inserted into the HindIII cleavage site of pBR322, the tetracycline resistant gene is inactivated, so a primary selection may be conducted by growth of the transformants that confer ampicillin resistance without having a HindIII cleavage site in the ampicillin gene. Subsequently, the selected transformants are transferred onto agar plates containing starch, using, for example, a replica method, and are then cultured so as to form colonies. By staining the starch contained in the starch-containing agar plates using an iodine-containing solution, target recombinant microorganisms can be selected as they decompose starch around the colonies.


The recombinant DNA molecule harbored by the thus-obtained recombinant microorganism can be extracted using standard procedures for preparing plasmids or phage DNAs (Maniatis, T. et al., Molecular Cloning, Cold Spring Harbor Laboratory, New York (1982)). When cleavage patterns obtained through the use of various restriction enzymes are analyzed by electrophoresis, it is confirmed that the recombinant DNA molecule is a ligated product of the vector DNA molecule and a DNA fragment containing the alkaline liquefying α-amylase gene.


The gene encoding an alkaline liquefying α-amylase is contained in a DNA fragment of about 2.1 kb shown in the restriction enzyme map of FIG. 1, and is present in the segment of about 1.6 kb shown by the white bar. The gene has a nucleotide sequence shown as Sequence No.1. In this sequence, the 5′ terminus and 3′ terminus correspond to the left-hand side and the right-hand side, respectively, of the fragment of about 2.1 kb shown as Sequence 1. In this sequence is observed an open reading frame (ORF) starting at the 145th nucleotide, ATG, and coding for a sequence consisting of 516 amino acid residues described in Sequence No. 2. Thirteen bases (13 b) upstream of the ORF, there exists a sequence AAGGAG which is highly complementary to the 3′ terminal sequence of the 16S ribosomal RNA of Bacillus subtilis (McLaughlin, J. R. et al., J. Biol. Chem., 256, 11283 (1981)). On a further upstream region extending nucleotides from 9 to 36, there exists a sequence TTGAAA . . . 16b . . . TATGGT which has high homology with the consensus sequence of a σA-type promoter (Gitt, M. A. et al, J. Biol. Chem., 260, 7178 (1985)). Similarly, another σA-type promoter sequence is found at nucleotides from 95 to 125. The amino acid sequence of the 10 amino acid residues on the amino terminus side in an alkaline liquefying α-amylase purified from a culture of Bacillus sp. KSM-AP1378 coincides with the sequence extending from the 37th amino acid (amino acid Nos. 37-46 in Sequence No. 2) deduced from the nucleotide sequence of the present DNA fragment.


When the nucleotide sequence of the gene of the present invention and a deduced amino acid sequence were compared with those of α-amylase known hitherto, it was confirmed that the present gene includes a novel nucleotide sequenced, with the deduced amino acid sequence encoded by the gene being different from those of other α-amylases such as a liquefying α-amylase produced by Bacillus amylolique (Takkinen, K. et al., J. Biol. Chem., 258, 1007 (1983)), a liquefying α-amylase produced by Bacillus stearothermophilus (Nakajima, R. et al., J. Bacteriol., 163, 401 (1985)), a liquefying α-amylase produced by Bacillus licheniformis (Yuuki, T et al., J. Biochem., 98, 1147 (1985)), or a liquefying α-amylase produced by Bacillus sp. 707 (Tsukamoto, A. et al., Biochem. Biophys. Res. Commun., 151, 25 (1988)).


An example of a preferred recombinant DNA molecule containing the entire region of the alkaline liquefying α-amylase gene is plasmid pAML100 (FIG. 2). This recombinant plasmid has a size of 4.4 kb and formed of a fragment containing a 1.8 kb fragment which contains the alkaline liquefying α-amylase gene and pUC19. An example of a preferred recombinant microorganism harboring the recombinant DNA molecule is an E. coli HB101 (pAML100) strain. This strain was obtained by transforming E. coli HB101 strain with the recombinant plasmid pAML100 using a standard transformation method. When this strain is cultured using a medium routinely employed for culturing E. coli, it produces an alkaline liquefying α-amylase. The optimum reaction pH of the thus-produced enzyme is pH 8-9. This agrees well with the activity-pH relationship profile determined for the alkaline liquefying α-amylase produced by the gene donor bacterial strain, Bacillus sp. KSM-AP1378 (FIG. 4).


The DNA fragments of the present invention are not necessarily limited only to those encoding the amino acid sequences shown in the below-described sequence listing, so far as they encode a protein exhibiting the enzymatic activity of interest, and they encompass DNA fragments encoding an amino acid sequence in which one or more amino acids are substituted, added, deleted, inverted, or inserted. An example of such DNA is one encoding an amino acid sequence equivalent to the amino acid sequence described in Sequence No. 2 from which up to 32 amino acids on the N-terminal side have been deleted.


In order to produce an alkaline liquefying α-amylase using the transformed microorganism of the present invention, a transformed microorganism harboring the aforementioned DNA fragment of the present invention is subjected to culturing. Alternatively, the DNA fragment may be integrated in a variety of expression vectors to obtain transformed microorganisms- with enhanced expression ability, followed by culturing of the resultant transformants. Moreover, the transformed microorganisms may be cultured under different conditions depending on the identity of the microorganisms. Thus, culture conditions suited for the host may be used. In order to collect an alkaline liquefying α-amylase from the resultant culture, a routine method (such as the method described in W094/26881) may be used.


The DNA fragments of the present invention may be further used as probes for the isolation of homologous alkaline liquefying α-amylase genes from other organisms.


EXAMPLES

The present invention will next be described in more detail by way of examples, which should not be construed as limiting the invention thereto. Concentrations in the Examples are all on a basis of % by weight.


Example 1

Bacillus sp. KSM-AP1378 producing an alkaline liquefying α-amylase was inoculated in 5 ml of medium A (Table 1) and subjected to shaking culture at 30° C. for 24 hours. One ml of the culture was inoculated in 100 ml of the same medium, followed by shaking culture at 30° C. for a further 12 hours. Subsequently, cells were collected by centrifugation and about 1 mg of chromosomal DNA was obtained in accordance with a method proposed by Saito and Miura (Saito, H. and Miura K., Biochim Biophys. Acta, 72, 619 (1963)).









TABLE 1





Composition of medium A


















Soluble starch
 1.0%



Polypepton
 1.0%



Yeast extract
 0.5%



KH2PO4
 0.1%



Na2HPO4•12H2O
0.25%



MgSO4•7H2O
0.02%



CaCl2•2H2O
0.02%



FeSO4•7H2O
0.001% 



MnCl2•4H2O
0.0001% 



Na2CO3
1.0% (separately




sterilized)










Example 2

It is known that many members of the amylase family possess I-IV regions where amino acid sequences are conserved at a high level (Nakajima, R. et al., Appl. Microbiol. Biotechnol., 23, 355 (1986)). Therefore, primers 1 and 2 (FIGS. 1 and 3) corresponding to regions II and IV were synthesized based on the amino acid sequence of region II and the amino acid sequence of region IV, which are particularly conserved regions among regions I through IV of known alkaline liquefying α-amylases. Using the thus-synthesized primers and chromosomal DNA of KSM-AP1378 (which served as template), PCR was conducted (one cycle=94° C.×1 min.+42° C.×1 min.+60° C.×2 min., 30 cycles). A gene fragment of approximately 0.3 kb (fragment A) shown in FIG. 1 was obtained, and the nucleotide sequence of this fragment was determined. As a result, it was found that the present fragment was coded with an amino acid sequence exhibiting a non-negligible level of homology with the amino acid sequence extending from region II through region IV of known liquefying amylase.


Example 3

Using fragment A as a probe, chromosomal DNA of XbaI-digested KSM-AP1378 was subjected to Southern hybridization. As a result, it was confirmed that there was a band which hybridized at the location of approximately 1.0 kb. An amplified fragment of approximately 0.7 kb (fragment B) was obtained by an inverse PCR method (Triglia, T. et al., Nucleic Acids Res., 16, 81 (1988)) using primers synthesized from the terminal sequences of fragment A (on the side of region II: primer 3; on the side of region IV: primer 4) and DNAs which had been obtained by intramolecularly ligating XbaI-digested KSM-AP1378 chromosomal DNA (FIG. 1) as template. The nucleotide sequence of fragment B was determined, which revealed that the present fragment contained a stretch, approximately 0.6 kb region downstream from region IV. The present fragment contained a termination codon for the ORF, which was deduced to be attributed to alkaline liquefying α-amylase.


Example 4

A primer was designed and synthesized based on the N-terminal amino acid sequence (7 amino acids) of alkaline liquefying α-amylase from the KSM-AP1378 strain (FIG. 3). Using the resultant primer (primer 5) in combination with the aforementioned primer 3 (FIG. 3) and, as a template, chromosomal DNA of KSM-AP1378, PCR was conducted to obtain a fragment of approximately 0.7 kb (fragment C, FIG. 1), thereby determining its nucleotide sequence.


Example 5

A primer containing 21 bases, stretching directly downstream of the nucleotide sequence encoding N-terminal amino acid sequence of the purified enzyme, was synthesized (primer 6). Using primers 6 and 7 (FIGS. 1 and 3) and DNAs which had been obtained by intramolecularly ligating HindIII-digested KSM-AP1378 chromosomal DNA (FIG. 1) as templates, an inverse PCR method was performed, obtaining a 1.2 kb fragment in which an upstream 0.8 kb fragment (fragment D) and a downstream PstI-HindIII 0.4 kb fragment had been ligated at the HindIII site. The nucleotide sequence of the fragment D region was determined, which revealed the presence of a signal sequence composed of 31 amino acids, MKLHNRIISVLLTLLLAVAVLFPYMTEPAQA (from No. 1 to No. 31 of Sequence No. 2), a deduced SD sequence composed of AAGGAG (nucleotides 127-132; McLaughlin, J. R. et al., J. Biol. Chem., 260, 7178 (1985)), and two kinds of deduced promoter sequences (−35 sequences, TTGAAA; −10 sequence, TATGGT, and −35 sequence, TTGACT; −10 sequence, TAAATT).


Example 6

Using primer A located at approximately 0.1 kb upstream of the promoter sequence, primer B located 79 b downstream of the termination codon, and chromosomal DNA of KSM-AP1378 as templates, a stretch of approximately 1.8 kb between the primers was amplified by PCR. The resultant amplified fragment was inserted into the SmaI site of pUC19, and then introduced into E. coli HB101. The transformant was allowed to grow on an LB agar medium containing 0.4% Starch azure and 15 μg/ml ampicillin. Colonies which had formed transparent halos around them were isolated as an E. coli strain that produced liquefying α-amylase. A recombinant plasmid was prepared from this transformant, and a restriction enzyme map of the plasmid was made. In the map, it was confirmed that an approximately 1.8 kb DNA fragment (fragment E) shown in FIG. 1 was contained. This recombinant plasmid was designated plasmid pAML100 (FIG. 2).


Example 7

The recombinant E. coli obtained in Example 6 was subjected to shaking culture for 12 hours in 5 ml of an LB liquid medium containing 50 μg/ml of ampicillin. One (1) ml of the culture was inoculated to 100 ml of an LB medium (containing ampicillin), followed by shaking-culture at 37° C. for 24 hours. Cells collected by centrifugal separation were suspended in Tris-HCl buffer (pH 8.0), and were disrupted by sonication. After the cells were sonicated, cell debris was removed by centrifugal separation, and the resultant supernatant was used as a cell-free extract. As a control, the cell-free extract of HB101 (PUC19) strain was separately prepared in a similar manner. α-amylase activities in these extracts were measured by first causing a reaction, at 50° C. for 15 minutes, in a reaction mixture containing 50 mM glycine-NaCl-NaOH buffer (pH 10) and soluble starch, and then by quantitatively determining the produced reducing sugar by the 3,5-dinitrosalicylic acid method (WO94/26881). One unit of enzymatic activity was defined as the amount of protein that produced a quantity per minute of reducing sugar equivalent to 1 μmol of glucose. As a result, α-amylase activity was detected in the cell-free extract of strain HB101 (pAML100 ). The optimum working pH of α-amylase was found to fall within the pH range between 8 and 9. This result coincides well with the optimum pH of liquefying α-amylase produced by Bacillus sp. KSM-AP1378 (FIG. 4). For the measurement of enzymatic activities, the buffers shown in Table 2 below were used (each at 40 mM).












TABLE 2









pH 3.5-5.5:
Acetate buffer



pH 5.5-8.5:
Tris-maleic acid buffer



pH 8.5-10.5:
Glycine-NaCl—NaOH buffer



pH 10.5-11.0:
Na2CO3—NaHCO3 buffer










Industrial Applicability

According to the present invention, it is possible to obtain a gene encoding for alkaline liquefying α-amylase exhibiting the maximum activity in the alkaline pH range as well as a microorganism harboring such gene. Use of them facilitates mass production of alkaline liquefying-α-amylase.

Claims
  • 1. An isolated DNA molecule encoding a protein exhibiting alkaline liquefying α-amylase activity at a pH optimum of 8-9 and possessing an amino acid sequence obtained by modifying an amino acid sequence described in SEQ ID NO: 2 in a manner in which one or more amino acids are substituted, deleted, or inserted without changing the enzymological properties of the protein having said amino acid sequence described in SEQ ID NO:2 and the protein hydrolyzes 1,4-α-glucosidic linkages in starches, amylose, amylopectin, and degradation products thereof and in amylose forms: glucose (G1), maltose (G2), maltotriose (G3), maltotetrose (G4), maltopentose (G5) and maltohexose (G6) and does not hydrolyze pullulan.
  • 2. The DNA molecule of claim 1, further comprising a nucleotide sequence for regulating expression of said isolated DNA molecule.
  • 3. A recombinant DNA molecule comprising the isolated DNA molecule of claim 1.
  • 4. A recombinant DNA molecule comprising the isolated DNA molecule of claim 2.
  • 5. The DNA molecule of claim 1, wherein said encoded protein has an isolectric point higher than 8.5 when measured by isoelectric focusing electrophoresis.
  • 6. The DNA molecule of claim 1, wherein said encoded protein: acts in a pH range of 5.0 to 11.0, with an optimum pH in the range of 8.0 to 9.0;is stable in a pH range of 5.0 to 10.5 and retains at least 50% of activity after treatment at 40° C. for 30 minutes;acts in a temperature range of 20° C. to 80° C., with an optimum temperature in the range of 45° C. to 55° C.;is stable at temperatures of 50° C. or lower when treated for 30 minutes in a glycine-salt-sodium hydroxide buffer having pH 8.5;has a molecular weight of 50,000±5000 when measured by sodium dodecyl sulfate polyacrylamide gel electrophoresis;has an isoelectric point of approximately 9.2 when measured by isoelectric focusing electrophoresis;is stable in the presence of K+, Na+, Ca2+, Mg2+, Mn2+, Ba2+, Fe2+, Fe3+, or A13+; andis substantially free of inhibition by surfactants selected from the group consisting of sodium linear alkylbenzene sulfonates, sodium alkylsulfonate esters, sodium polyoxyethylene alkylsulfate esters, sodium alkylsulfonates, soaps and polyoxyethylene alkyl ethers.
  • 7. An isolated DNA molecule encoding a protein exhibiting alkaline liquefying α-amylase activity at a pH optimum of 8-9 comprising at least one nucleotide sequence that is selected from the group consisting of SEQ ID NO: 10, SEQ ID NO: 7, SEQ ID NO: 3, SEQ ID NO: 6 and SEQ ID NO: 9.
  • 8. An isolated DNA molecule encoding a protein exhibiting alkaline liquefying α-amylase activity at a pH optimum of 8-9 comprising at least one nucleotide sequence that is the reverse complement of a sequence selected from the group consisting of SEQ ID NO: 8, SEQ ID NO: 4 and SEQ ID NO: 11.
  • 9. An isolated DNA molecule encoding a protein exhibiting alkaline liquefying α-amylase activity at a pH optimum of 8-9 comprising at least one nucleotide sequence selected from the group consisting of SEQ ID NO: 10, SEQ ID NO: 7, SEQ ID NO: 3, SEQ ID NO: 6 and SEQ ID NO: 9, and also comprising at least one nucleotide sequence that is the reverse complement of a sequence selected from the group consisting of SEQ ID NO: 8, SEQ ID NO: 4 and SEQ ID NO: 11.
Priority Claims (2)
Number Date Country Kind
147257/1995 Jun 1995 JP national
PCT/JP96/01647 Jun 1996 JP national
Continuations (1)
Number Date Country
Parent 08952741 Nov 1997 US
Child 10829331 US