Genes and uses for pant improvement

Abstract

Transgenic seed for crops with improved traits are provided by trait-improving recombinant DNA where plants grown from such transgenic seed exhibit one or more improved traits as compared to a control plant. Of particular interest are transgenic plants that have increased yield. The present invention also provides recombinant DNA molecules for expression of a protein, and recombinant DNA molecules for expression of mRNA complementary to at least a portion of an mRNA native to the target plant for use in gene suppression to suppress the expression of a protein.

Description

INCORPORATION OF SEQUENCE LISTING

Two copies of the sequence listing (Copy 1 and Copy 2) and a computer readable form (CRF) of the sequence listing, all on CD-ROMs, each containing the file named pa_—01123.rpt, which is 33,475 kilo bytes (measured in MS-WINDOWS) and was created on Mar. 21, 2005, are herein incorporated by reference.

FIELD OF THE INVENTION

Disclosed herein are inventions in the field of plant genetics and developmental biology. More specifically, the present invention provides transgenic seeds for crops, wherein the genome of said seed comprises recombinant DNA, the expression of which results in the production of transgenic plants that have improved trait(s).

BACKGROUND OF THE INVENTION

Transgenic plants with improved traits such as improved yield, environmental stress tolerance, pest resistance, herbicide tolerance, modified seed compositions, and the like are desired by both farmers and consumers. Although considerable efforts in plant breeding have provided significant gains in desired traits, the ability to introduce specific DNA into plant genomes provides further opportunities for generation of plants with improved and/or unique traits. The ability to develop transgenic plants with improved traits depends in part on the identification of genes that are useful in recombinant DNA constructs for production of transformed plants with improved properties.

SUMMARY OF THE INVENTION

This invention provides transgenic seeds, transgenic plants and DNA constructs with trait-improving recombinant DNA from a gene or homolog which has been demonstrated for trait improvement in a model plant. More specifically, such recombinant DNA is from a gene identified in a model plant screen as disclosed herein or homologues of such gene, e.g., from related species or in some cases from a broad range of unrelated species. In particular aspects of the invention the recombinant DNA will express a protein having an amino acid sequence with at least 90% identity to a consensus amino acid sequence in the group consisting of the consensus amino acid sequence of SEQ ID NO:240 and its homologs through SEQ ID NO:478 and its homologs, but excluding SEQ ID NO:391 and its homologs. The amino acid sequences of homologs are SEQ ID NO: 479 through SEQ ID NO: 12463. Tables 2 identifying the sequences of homologs for proteins encoded by the trait-improving genes described supra is provided herein as appendix. In some cases of trait improvement, the recombinant DNA encodes a protein; in other cases, the recombinant DNA suppresses endogenous protein expression. In a broad aspect this invention provides transgenic seed for growing crop plants with improved traits, such crop plants with improved traits and the plant parts including transgenic seed produced by such crop plants. The improved trait provided by the recombinant DNA in the transgenic crop plant of this invention is identified by comparison to a control plant, i.e., a plant without the trait-improving recombinant DNA. In one aspect of the invention, transgenic crop plant grown from the transgenic seed has improved yield, as compared to the yield of a control plant, e.g., a plant without the recombinant DNA that produces the increased yield. Increased yield may be characterized as plant yield increase under non-stress conditions, or by plant yield increase under one or more environmental stress conditions including, but not limited to, water deficit stress, cold stress, heat stress, high salinity stress, shade stress, and low nitrogen availability stress. Still another aspect of the present invention also provides transgenic plants having other improved phenotypes, such as improved plant development, plant morphology, plant physiology or seed composition as compared to a corresponding trait of a control plant. The various aspects of this invention are especially useful for transgenic seed and transgenic plants having improved traits in corn (also know as maize), soybean, cotton, canola (rape), wheat, sunflower, sorghum, alfalfa, barley, millet, rice, tobacco, fruit and vegetable crops, and turfgrass.

The invention also comprises recombinant DNA constructs. In one aspect such recombinant DNA constructs useful for the transgenic seed and transgenic plants of this invention comprise a promoter functional in a plant cell operably linked to a DNA segment for expressing a protein associated with a trait in a model plant or a homologue. In another aspect the recombinant DNA constructs useful for the transgenic seed and transgenic plants of this invention comprise a promoter functional in a plant cell operably linked to a DNA segment for suppressing the level of an endogenous plant protein which is a homologue to a model-plant protein, the suppression of which is associated with an improved trait. Suppression can be effected by any of a variety of methods known in the art, e.g., post transcriptional suppression by anti-sense, sense, dsRNA and the like or by transcriptional suppression.

This invention also provides a method of producing a transgenic crop plant having at least one improved trait, wherein the method comprises providing to a grower of transgenic seeds comprising recombinant DNA for expression or suppression of a trait-improving gene provided herein, and growing transgenic plant from said transgenic seed. Such methods can be used to generate transgenic crop plants having at least one improved traits under one or more environmental stress conditions including, but not limited to, water deficit stress, cold stress, heat stress, high salinity stress, shade stress, and low nitrogen availability stress. In another aspect, such method also can be used to generate transgenic crop plants having improved plant development, plant morphology, plant physiology or seed component phenotype as compared to a corresponding phenotype of a control plant. Of particular interest are uses of such methods to generate transgenic crop plants having increased yield under non-stress condition, or under one or more stress conditions.

One a particular embodiment of this invention provides transgenic seeds comprising trait improving recombinant DNA in its genome for the expression of a bacterial phytochrome protein. Transgenic plants resulting from such invention have improved tolerance to water deficit stress, cold stress and low nitrogen availability stress. In another aspect, transgenic crop plants overexpressing the bacterial phytochrome protein have increased yield under non-stress condition, or under one or more stress conditions.

DETAILED DESCRIPTION OF THE INVENTION

The present invention is directed to transgenic plant seed, wherein the genome of said transgenic plant seed comprises a trait-improving recombinant DNA as provided herein, and transgenic plant grown from such seed possesses an improved trait as compared to the trait of a control plant. In one aspect, the present invention relates to transgenic plants wherein the improved trait is one or more traits including improved drought stress tolerance, improved heat stress tolerance, improved cold stress tolerance, improved high salinity stress tolerance, improved low nitrogen availability stress tolerance, improved shade stress tolerance, improved plant growth and development at the stages of seed imbibition through early vegetative phase, and improved plant growth and development at the stages of leaf development, flower production and seed maturity. Of particular interest are the transgenic plants grown from transgenic seeds provided herein wherein the improved trait is increased seed yield. Recombinant DNA constructs disclosed by the present invention comprise recombinant polynucleotides providing for the production of mRNA to modulate gene expression, imparting improved traits to plants.

As used herein, “gene” refers to chromosomal DNA, plasmid DNA, cDNA, synthetic DNA, or other DNA that encodes a peptide, polypeptide, protein, or RNA molecule, and regions flanking the coding sequences involved in the regulation of expression.

As used herein, “transgenic seed” refers to a plant seed whose genome has been altered by the incorporation of recombinant DNA, e.g., by transformation as described herein. The term “transgenic plant” is used to refer to the plant produced from an original transformation event, or progeny from later generations or crosses of a plant to a transformed plant, so long as the progeny contains the recombinant DNA in its genome. As used herein, “recombinant DNA” refers to a polynucleotide having a genetically engineered modification introduced through combination of endogenous and/or exogenous elements in a transcription unit, manipulation via mutagenesis, restriction enzymes, and the like or simply by inserting multiple copies of a native transcription unit. Recombinant DNA may comprise DNA segments obtained from different sources, or DNA segments obtained from the same source, but which have been manipulated to join DNA segments which do not naturally exist in the joined form. A recombinant polynucleotide may exist outside of the cell, for example as a PCR fragment, or integrated into a genome, such as a plant genome.

As used herein, “trait” refers to a physiological, morphological, biochemical, or physical characteristic of a plant or particular plant material or cell. In some instances, this characteristic is visible to the human eye, such as seed or plant size, or can be measured by biochemical techniques, such as detecting the protein, starch, or oil content of seed or leaves, or by observation of a metabolic or physiological process, e.g., by measuring uptake of carbon dioxide, or by the observation of the expression level of a gene or genes, e.g., by employing Northern analysis, RT-PCR, microarray gene expression assays, or reporter gene expression systems, or by agricultural observations such as stress tolerance, yield, or pathogen tolerance.

As used herein, “control plant” is a plant without trait-improving recombinant DNA. A control plant is used to measure and compare trait improvement in a transgenic plant with such trait-improving recombinant DNA. A suitable control plant may be a non-transgenic plant of the parental line used to generate a transgenic plant herein. Alternatively, control plant may be a transgenic plant that comprises an empty vector or marker gene, but does not contain the recombinant DNA that produces the trait improvement. A control plant may also be a negative segregant progeny of hemizygous transgenic plant. In certain demonstrations of trait improvement, the use of a limited number of control plants can cause a wide variation in the control dataset. To minimize the effect of the variation within the control dataset, a “reference” is used. As use herein a “reference” is a trimmed mean of all data from both transgenic and control plants grown under the same conditions and at the same developmental stage. The trimmed mean is calculated by eliminating a specific percentage, i.e., 20%, of the smallest and largest observation from the data set and then calculating the average of the remaining observation.

As used herein, “trait improvement” refers to a detectable and desirable difference in a characteristic in a transgenic plant relative to a control plant or a reference. In some cases, the trait improvement can be measured quantitatively. For example, the trait improvement can entail at least a 2% desirable difference in an observed trait, at least a 5% desirable difference, at least about a 10% desirable difference, at least about a 20% desirable difference, at least about a 30% desirable difference, at least about a 50% desirable difference, at least about a 70% desirable difference, or at least about a 100% difference, or an even greater desirable difference. In other cases, the trait improvement is only measured qualitatively. It is known that there can be a natural variation in a trait. Therefore, the trait improvement observed entails a change of the normal distribution of the trait in the transgenic plant compared with the trait distribution observed in a control plant or a reference, which is evaluated by statistical methods provided herein. Trait improvement includes, but not limited to, yield increase, including increased yield under non-stress conditions and increased yield under environmental stress conditions. Stress conditions may include, for example, drought, shade, fungal disease, viral disease, bacterial disease, insect infestation, nematode infestation, cold temperature exposure, heat exposure, osmotic stress, reduced nitrogen nutrient availability, reduced phosphorus nutrient availability and high plant density. Many agronomic traits can affect “yield”, including without limitation, plant height, pod number, pod position on the plant, number of internodes, incidence of pod shatter, grain size, efficiency of nodulation and nitrogen fixation, efficiency of nutrient assimilation, resistance to biotic and abiotic stress, carbon assimilation, plant architecture, resistance to lodging, percent seed germination, seedling vigor, and juvenile traits. Other traits that can affect yield include, efficiency of germination (including germination in stressed conditions), growth rate (including growth rate in stressed conditions), ear number, seed number per ear, seed size, composition of seed (starch, oil, protein) and characteristics of seed fill. Also of interest is the generation of transgenic plants that demonstrate desirable phenotypic properties that may or may not confer an increase in overall plant yield. Such properties include improved plant morphology, plant physiology or improved components of the mature seed harvested from the transgenic plant.

As used herein, “yield-limiting environment” refers to the condition under which a plant would have the limitation on yield including environmental stress conditions.

As used herein, “stress condition” refers to the condition unfavorable for a plant, which adversely affect plant metabolism, growth and/or development. A plant under the stress condition typically shows reduced germination rate, retarded growth and development, reduced photosynthesis rate, and eventually leading to reduction in yield.

Specifically, “water deficit stress” used herein preferably refers to the sub-optimal conditions for water and humidity needed for normal growth of natural plants. Relative water content (RWC) can be used as a physiological measure of plant water deficit. It measures the effect of osmotic adjustment in plant water status, when a plant is under stressed conditions. Conditions which may result in water deficit stress include heat, drought, high salinity and PEG induced osmotic stress.

“Cold stress” used herein preferably refers to the exposure of a plant to a temperatures below (two or more degrees Celsius below) those normal for a particular species or particular strain of plant.

As used herein, “sufficient nitrogen growth condition” refers to the growth condition where the soil or growth medium contains or receives enough amounts of nitrogen nutrient to sustain a healthy plant growth and/or for a plant to reach its typical yield for a particular plant species or a particular strain. As used herein, “nitrogen nutrient” means any one or any mix of the nitrate salts commonly used as plant nitrogen fertilizer, including, but not limited to, potassium nitrate, calcium nitrate, sodium nitrate, ammonium nitrate. The term ammonium as used herein means any one or any mix of the ammonium salts commonly used as plant nitrogen fertilizer, e.g., ammonium nitrate, ammonium chloride, ammonium sulfate, etc. One skilled in the art would recognize what constitute such soil, media and fertilizer inputs for most plant species. “Low nitrogen availability stress” used herein refers to a plant growth condition that does not contain sufficient nitrogen nutrient to maintain a healthy plant growth and/or for a plant to reach its typical yield under a sufficient nitrogen growth condition, and preferably refers to a growth condition with 50% or less of the conventional nitrogen inputs.

“Shade stress” used herein preferably refers to limited light availability that triggers the shade avoidance response in plant. Plants are subject to shade stress when localized at lower part of the canopy, or in close proximity of neighboring vegetation. Shade stress may become exacerbated when the planting density exceeds the average prevailing density for a particular plant species. The average prevailing densities per acre of a few other examples of crop plants in the USA in the year 2000 were: wheat 1,000,000-1,500,000; rice 650,000-900,000; soybean 150,000-200,000, canola 260,000-350,000, sunflower 17,000-23,000 and cotton 28,000-55,000 plants per acre (Cheikh, et al., (2003) U.S. Patent Application No. 20030101479).

As used herein, “increased yield” of a transgenic plant of the present invention may be evidenced and measured in a number of ways, including test weight, seed number per plant, seed weight, seed number per unit area (i.e., seeds, or weight of seeds, per acre), bushels per acre, tons per acre, tons per acre, kilo per hectare. For example, maize yield may be measured as production of shelled corn kernels per unit of production area, e.g., in bushels per acre or metric tons per hectare, often reported on a moisture adjusted basis, e.g., at 15.5% moisture. Increased yield may result from improved utilization of key biochemical compounds, such as nitrogen, phosphorous and carbohydrate, or from improved responses to environmental stresses, such as cold, heat, drought, salt, and attack by pests or pathogens. Trait-improving recombinant DNA may also be used to provide transgenic plants having improved growth and development, and ultimately increased yield, as the result of modified expression of plant growth regulators or modification of cell cycle or photosynthesis pathways.

As used herein, “expression” refers to transcription of DNA to produce RNA. The resulting RNA may be without limitation mRNA encoding a protein, antisense RNA that is complementary to an mRNA encoding a protein, or an RNA transcript comprising a combination of sense and antisense gene regions, such as for use in RNAi technology. Expression as used herein may also refer to production of encoded protein from mRNA.

As used herein, “promoter” includes reference to a region of DNA upstream from the start of transcription and involved in recognition and binding of RNA polymerase and other proteins to initiate transcription. A “plant promoter” is a promoter capable of initiating transcription in plant cells whether or not its origin is a plant cell. Exemplary plant promoters include, but are not limited to, those that are obtained from plants, plant viruses, and bacteria which comprise genes expressed in plant cells such as Agrobacterium or Rhizobium. Examples of promoters under developmental control include promoters that preferentially initiate transcription in certain tissues, such as leaves, roots, or seeds. Such promoters are referred to as “tissue preferred”. Promoters which initiate transcription only in certain tissues are referred to as “tissue specific”. A “cell type” specific promoter primarily drives expression in certain cell types in one or more organs, for example, vascular cells in roots or leaves. An “inducible” or “repressible” promoter is a promoter which is under environmental control. Examples of environmental conditions that may effect transcription by inducible promoters include anaerobic conditions, or certain chemicals, or the presence of light. Tissue specific, tissue preferred, cell type specific, and inducible promoters constitute the class of “non-constitutive” promoters. A “constitutive” promoter is a promoter which is active under most conditions. As used herein, “antisense orientation” includes reference to a polynucleotide sequence that is operably linked to a promoter in an orientation where the antisense strand is transcribed. The antisense strand is sufficiently complementary to an endogenous transcription product such that translation of the endogenous transcription product is often inhibited.

As used herein, “operably linked” refers to the association of two or more nucleic acid fragments on a single nucleic acid fragment so that the function of one is affected by the other. For example, a promoter is operably linked with a coding sequence when it is capable of affecting the expression of that coding sequence (i.e., that the coding sequence is under the transcriptional control of the promoter). Coding sequences can be operably linked to regulatory sequences in sense or antisense orientation.

As used herein, “consensus sequence” refers to an artificial, amino acid sequence of conserved parts of the proteins encoded by homologous genes, e.g., as determined by a CLUSTALW alignment of amino acid sequence of homolog proteins.

As used herein, “homolog” refers to a gene related to a second gene by descent from a common ancestral DNA sequence. The term, homolog, may apply to the relationship between genes separated by the event of speciation (see ortholog) or to the relationship between genes separated by the event of genetic duplication (see paralog). Homologs can be from the same or a different organism that performs the same biological function. “Orthologs” refer to a set of homologous genes in different species that evolved from a common ancestral gene by specification. Normally, orthologs retain the same function in the course of evolution; and “paralogs” refer to a set of homologous genes in the same species that have diverged from each other as a consequence of genetic duplication.

Percent identity refers to the extent to which two optimally aligned DNA or protein segments are invariant throughout a window of alignment of components, e.g., nucleotide sequence or amino acid sequence. An “identity fraction” for aligned segments of a test sequence and a reference sequence is the number of identical components which are shared by sequences of the two aligned segments divided by the total number of sequence components in the reference segment over a window of alignment which is the smaller of the full test sequence or the full reference sequence. “Percent identity” (“% identity”) is the identity fraction times 100. “% identity to a consensus amino acid sequence” is 100 times the identity fraction in a window of alignment of an amino acid sequence of a test protein optimally aligned to consensus amino acid sequence of this invention.

As used herein “Arabidopsis” means plants of Arabidopsis thaliana.

Recombinant DNA Constructs

The present invention provides recombinant DNA constructs comprising one or more polynucleotides disclosed herein for imparting one or more improved traits to transgenic plant. Such constructs also typically comprise a promoter operatively linked to said polynucleotide to provide for expression in a target plant. Other construct components may include additional regulatory elements, such as 5′ or 3′ untranslated regions (such as polyadenylation sites), intron regions, and transit or signal peptides. Such recombinant DNA constructs can be assembled using methods known to those of ordinary skill in the art.

In a preferred embodiment, a polynucleotide of the present invention is operatively linked in a recombinant DNA construct to a promoter functional in a plant to provide for expression of the polynucleotide in the sense orientation such that a desired polypeptide is produced. Also provided are embodiments wherein a polynucleotide is operatively linked to a promoter functional in a plant to provide for expression of the polynucleotide in the antisense orientation such that a complementary copy of at least a portion of an mRNA native to the target plant host is produced.

Recombinant constructs prepared in accordance with the present invention may also generally include a 3′ untranslated DNA region (UTR) that typically contains a polyadenylation sequence following the polynucleotide coding region. Examples of useful 3′ UTRs include those from the nopaline synthase gene of Agrobacterium tumefaciens (nos), a gene encoding the small subunit of a ribulose-1,5-bisphosphate carboxylase-oxygenase (rbcS), and the T7 transcript of Agrobacterium tumefaciens. Constructs and vectors may also include a transit peptide for targeting of a gene target to a plant organelle, particularly to a chloroplast, leucoplast or other plastid organelle. For descriptions of the use of chloroplast transit peptides, see U.S. Pat. No. 5,188,642 and U.S. Pat. No. 5,728,925, incorporated herein by reference.

Table 1 provides a list of genes that can provide recombinant DNA that was used in a model plant to discover associate improved traits and that can be used with homologs to define a consensus amino acid sequence for characterizing recombinant DNA in the transgenic seeds, transgenic plants, DNA constructs and methods of this invention.

“NUC SEQ ID NO” refers to a SEQ ID NO. for a particular DNA sequence in the Sequence Listing.

“PEP SEQ ID NO” refers to a SEQ ID NO. in the Sequence Listing for the amino acid sequence of a protein cognate to a particular DNA “construct_id” refers to an arbitrary number used to identify a particular recombinant DNA construct comprising the particular DNA.

“gene” refers to an arbitrary name used to identify the particular DNA.

“orientation” refers to the orientation of the particular DNA in a recombinant DNA construct relative to the promoter.

“species” refers to the organism from which the particular DNA was derived.

TABLE 1
Nuc SEQ ID	Pep SEQ ID	construct_id	Gene	orientation	Species
1	240	19867	CGPG4046	Sense	Glycine max
2	241	74518	CGPG6792	Sense	Pseudomonas fluorescens PfO-1
3	242	15816	CGPG2244	Sense	Arabidopsis thaliana
4	243	17918	CGPG2774	Sense	Arabidopsis thaliana
5	244	15306	CGPG1909	AntiSense	Arabidopsis thaliana
6	245	12038	CGPG1087	Sense	Arabidopsis thaliana
7	246	12046	CGPG1106	Sense	Arabidopsis thaliana
8	247	13432	CGPG1525	Sense	Arabidopsis thaliana
9	248	13711	CGPG1114	Sense	Arabidopsis thaliana
10	249	14809	CGPG692	Sense	Arabidopsis thaliana
11	250	14951	CGPG1636	Sense	Arabidopsis thaliana
12	251	15632	CGPG1469	Sense	Arabidopsis thaliana
13	252	16147	CGPG2088	Sense	Arabidopsis thaliana
14	253	16158	CGPG2169	Sense	Arabidopsis thaliana
15	254	16170	CGPG2192	Sense	Arabidopsis thaliana
16	255	16171	CGPG2194	Sense	Arabidopsis thaliana
17	256	16175	CGPG2204	Sense	Arabidopsis thaliana
18	257	17430	CGPG2478	Sense	Arabidopsis thaliana
19	258	17819	CGPG2587	Sense	Arabidopsis thaliana
20	259	17921	CGPG2878	Sense	Arabidopsis thaliana
21	260	17928	CGPG2739	Sense	Arabidopsis thaliana
22	261	18637	CGPG3450	Sense	Arabidopsis thaliana
23	262	18816	CGPG2406	Sense	Arabidopsis thaliana
24	263	19227	CGPG3025	Sense	Arabidopsis thaliana
25	264	19429	CGPG3486	Sense	Arabidopsis thaliana
26	265	70235	CGPG96	Sense	Arabidopsis thaliana
27	266	72634	CGPG4855	Sense	Arabidopsis thaliana
28	267	72752	CGPG5532	Sense	Saccharomyces cerevisiae
29	268	12007	CGPG1089	AntiSense	Arabidopsis thaliana
30	269	12290	CGPG977	AntiSense	Arabidopsis thaliana
31	270	12343	CGPG581	AntiSense	Arabidopsis thaliana
32	271	14348	CGPG1692	AntiSense	Arabidopsis thaliana
33	272	15708	CGPG2167	AntiSense	Arabidopsis thaliana
34	273	17615	CGPG2458	Anti-Sense	Arabidopsis thaliana
35	274	17622	CGPG2454	Anti-Sense	Arabidopsis thaliana
36	275	70714	CGPG1480	Anti-sense	Arabidopsis thaliana
37	276	17925	CGPG2883	Sense	Arabidopsis thaliana
38	277	18541	CGPG2971	Sense	Arabidopsis thaliana
39	278	11425	CGPG628	Sense	Arabidopsis thaliana
40	279	12263	CGPG799	Sense	Arabidopsis thaliana
41	280	12288	CGPG811	Sense	Arabidopsis thaliana
42	281	12910	CGPG985	Sense	Arabidopsis thaliana
43	282	14335	CGPG1685	Sense	Arabidopsis thaliana
44	283	17427	CGPG2475	Sense	Arabidopsis thaliana
45	284	19140	CGPG1758	Sense	Arabidopsis thaliana
46	285	19179	CGPG740	Sense	Arabidopsis thaliana
47	286	19251	CGPG3118	Sense	Arabidopsis thaliana
48	287	19443	CGPG2834	Sense	Arabidopsis thaliana
49	288	19607	CGPG3397	Sense	Arabidopsis thaliana
50	289	19915	CGPG4072	Sense	Glycine max
51	290	70222	CGPG28	Sense	Arabidopsis thaliana
52	291	70464	CGPG3773	Sense	Arabidopsis thaliana
53	292	70474	CGPG3806	Sense	Arabidopsis thaliana
54	293	70484	CGPG3853	Sense	Arabidopsis thaliana
55	294	72474	CGPG4667	Sense	Glycine max
56	295	13047	CGPG1324	ANTI-SENSE	Arabidopsis thaliana
57	296	13304	CGPG1282	ANTI-SENSE	Arabidopsis thaliana
58	297	13474	CGPG1600	ANTI-SENSE	Arabidopsis thaliana
59	298	19252	CGPG3121	SENSE	Arabidopsis thaliana
60	299	12612	CGPG1181	SENSE	Arabidopsis thaliana
61	300	12926	CGPG1299	SENSE	Arabidopsis thaliana
62	301	13230	CGPG1276	SENSE	Arabidopsis thaliana
63	302	14235	CGPG1665	SENSE	Arabidopsis thaliana
64	303	17305	CGPG2261	SENSE	Arabidopsis thaliana
65	304	17470	CGPG2606	SENSE	Arabidopsis thaliana
66	305	17718	CGPG1791	SENSE	Arabidopsis thaliana
67	306	17904	CGPG1912	SENSE	Arabidopsis thaliana
68	307	18280	CGPG3547	SENSE	Arabidopsis thaliana
69	308	18287	CGPG3563	SENSE	Arabidopsis thaliana
70	309	18501	CGPG2237	SENSE	Arabidopsis thaliana
71	310	18877	CGPG3097	SENSE	Arabidopsis thaliana
72	311	19531	CGPG3028	SENSE	Arabidopsis thaliana
73	312	70405	CGPG1672	SENSE	Arabidopsis thaliana
74	313	72136	CGPG5320	SENSE	Glycine max
75	314	72611	CGPG4812	SENSE	Arabidopsis thaliana
76	315	12627	CGPG1003	SENSE	Arabidopsis thaliana
77	316	12813	CGPG825	SENSE	Arabidopsis thaliana
78	317	14945	CGPG1776	SENSE	Arabidopsis thaliana
79	318	15345	CGPG1504	SENSE	Arabidopsis thaliana
80	319	15348	CGPG1514	SENSE	Arabidopsis thaliana
81	320	16325	CGPG2195	SENSE	Arabidopsis thaliana
82	321	16702	CGPG531	SENSE	Arabidopsis thaliana
83	322	16836	CGPG2283	SENSE	Arabidopsis thaliana
84	323	17002	CGPG1926	SENSE	Arabidopsis thaliana
85	324	17012	CGPG2073	SENSE	Arabidopsis thaliana
86	325	17017	CGPG1722	SENSE	Arabidopsis thaliana
87	326	17344	CGPG2404	SENSE	Arabidopsis thaliana
88	327	17426	CGPG2474	SENSE	Arabidopsis thaliana
89	328	17655	CGPG2899	SENSE	Arabidopsis thaliana
90	329	17656	CGPG2714	SENSE	Arabidopsis thaliana
91	330	17906	CGPG2145	SENSE	Arabidopsis thaliana
92	331	18278	CGPG3544	SENSE	Arabidopsis thaliana
93	332	18822	CGPG2398	SENSE	Arabidopsis thaliana
94	333	18881	CGPG3126	SENSE	Arabidopsis thaliana
95	334	19213	CGPG3622	SENSE	Arabidopsis thaliana
96	335	19239	CGPG3197	SENSE	Arabidopsis thaliana
97	336	19247	CGPG3112	SENSE	Arabidopsis thaliana
98	337	19460	CGPG2824	SENSE	Arabidopsis thaliana
99	338	19512	CGPG2898	SENSE	Arabidopsis thaliana
100	339	19533	CGPG3032	SENSE	Arabidopsis thaliana
101	340	19603	CGPG3385	SENSE	Arabidopsis thaliana
102	341	72126	CGPG5310	SENSE	Glycine max
103	342	72437	CGPG5068	SENSE	Arabidopsis thaliana
104	343	72441	CGPG5079	SENSE	Arabidopsis thaliana
105	344	72639	CGPG4861	SENSE	Arabidopsis thaliana
106	345	14825	CGPG1883	Anti-Sense	Arabidopsis thaliana
107	346	17931	CGPG2890	Sense	Arabidopsis thaliana
108	347	18854	CGPG3524	Sense	Arabidopsis thaliana
109	348	12237	CGPG1206	Sense	Arabidopsis thaliana
110	349	13414	CGPG1246	Sense	Arabidopsis thaliana
111	350	16160	CGPG2172	Sense	Arabidopsis thaliana
112	351	16226	CGPG1980	Sense	Arabidopsis thaliana
113	352	16803	CGPG2179	Sense	Arabidopsis thaliana
114	353	18260	CGPG3373	Sense	Arabidopsis thaliana
115	354	18642	CGPG3230	Sense	Arabidopsis thaliana
116	355	18721	CGPG3618	Sense	Arabidopsis thaliana
117	356	19254	CGPG3123	Sense	Arabidopsis thaliana
118	357	70247	CGPG34	Sense	Arabidopsis thaliana
119	358	70650	CGPG4337	Sense	Arabidopsis thaliana
120	359	11787	CGPG951	ANTI-SENSE	Arabidopsis thaliana
120	359	12635	CGPG951	Sense	Arabidopsis thaliana
121	360	13641	CGPG1211	ANTI-SENSE	Arabidopsis thaliana
122	361	14515	CGPG1115	ANTI-SENSE	Arabidopsis thaliana
123	362	14920	CGPG2027	ANTI-SENSE	Arabidopsis thaliana
124	363	15204	CGPG2000	ANTI-SENSE	Arabidopsis thaliana
125	364	15216	CGPG1906	ANTI-SENSE	Arabidopsis thaliana
125	364	19058	CGPG1906	SENSE	Arabidopsis thaliana
126	365	15330	CGPG1237	ANTI-SENSE	Arabidopsis thaliana
127	366	19610	CGPG3419	SENSE	Arabidopsis thaliana
128	367	14338	CGPG1706	SENSE	Arabidopsis thaliana
129	368	17809	CGPG2436	SENSE	Arabidopsis thaliana
130	369	72471	CGPG4648	SENSE	Glycine max
131	370	16403	CGPG1983	SENSE	Arabidopsis thaliana
132	371	17737	CGPG2623	SENSE	Arabidopsis thaliana
133	372	18395	CGPG2994	SENSE	Arabidopsis thaliana
134	373	72772	CGPG2418	SENSE	Arabidopsis thaliana
135	374	19441	CGPG2783	SENSE	Arabidopsis thaliana
136	375	11409	CGPG136	SENSE	Arabidopsis thaliana
137	376	10486	CGPG137	SENSE	Arabidopsis thaliana
138	377	12104	CGPG693	SENSE	Arabidopsis thaliana
139	378	12258	CGPG836	SENSE	Arabidopsis thaliana
140	379	12909	CGPG1195	SENSE	Arabidopsis thaliana
141	380	14310	CGPG1037	SENSE	Arabidopsis thaliana
142	381	14317	CGPG1150	SENSE	Arabidopsis thaliana
143	382	14709	CGPG990	SENSE	Arabidopsis thaliana
144	383	15123	CGPG1730	SENSE	Arabidopsis thaliana
145	384	16013	CGPG978	SENSE	Arabidopsis thaliana
146	385	16185	CGPG2025	SENSE	Arabidopsis thaliana
147	386	16719	CGPG1817	SENSE	Arabidopsis thaliana
148	387	17490	CGPG2638	SENSE	Arabidopsis thaliana
149	388	17905	CGPG2101	SENSE	Arabidopsis thaliana
150	389	18385	CGPG3609	SENSE	Arabidopsis thaliana
151	390	18392	CGPG2989	SENSE	Arabidopsis thaliana
153	392	18531	CGPG3215	SENSE	Arabidopsis thaliana
154	393	18603	CGPG3423	SENSE	Arabidopsis thaliana
155	394	19530	CGPG3026	SENSE	Arabidopsis thaliana
156	395	70202	CGPG3949	SENSE	Glycine max
157	396	72009	CGPG5273	SENSE	Saccharomyces cerevisiae
158	397	72119	CGPG5332	SENSE	Glycine max
159	398	10188	CGPG147	Anti-sense	Arabidopsis thaliana
160	399	10404	CGPG25	Anti-Sense	Arabidopsis thaliana
161	400	11333	CGPG583	Anti-Sense	Arabidopsis thaliana
162	401	11719	CGPG710	Anti-Sense	Arabidopsis thaliana
163	402	13663	CGPG1241	Anti-sense	Arabidopsis thaliana
164	403	13958	CGPG1711	Anti-Sense	Arabidopsis thaliana
165	404	15214	CGPG1904	Anti-Sense	Arabidopsis thaliana
166	405	10483	CGPG447	Sense	Arabidopsis thaliana
167	406	11711	CGPG466	Sense	Arabidopsis thaliana
168	407	11909	CGPG471	Sense	Arabidopsis thaliana
169	408	12216	CGPG1091	Sense	Arabidopsis thaliana
170	409	12236	CGPG1193	Sense	Arabidopsis thaliana
171	410	12256	CGPG824	Sense	Arabidopsis thaliana
172	411	12806	CGPG714	Sense	Arabidopsis thaliana
173	412	12904	CGPG204	Sense	Arabidopsis thaliana
174	413	13212	CGPG1384	Sense	Arabidopsis thaliana
175	414	13232	CGPG1281	Sense	Arabidopsis thaliana
176	415	13912	CGPG1283	Sense	Arabidopsis thaliana
177	416	14327	CGPG1606	Sense	Arabidopsis thaliana
178	417	14704	CGPG1066	Sense	Arabidopsis thaliana
179	418	14714	CGPG1431	Sense	Arabidopsis thaliana
180	419	15142	CGPG1917	Sense	Arabidopsis thaliana
181	420	17450	CGPG2684	Sense	Arabidopsis thaliana
182	421	18607	CGPG3496	Sense	Arabidopsis thaliana
183	422	19409	CGPG2691	Sense	Arabidopsis thaliana
184	423	19412	CGPG2727	Sense	Arabidopsis thaliana
185	424	13005	CGPG724	ANTI-SENSE	Arabidopsis thaliana
186	425	10203	CGPG272	ANTI-SENSE	Arabidopsis thaliana
187	426	11327	CGPG551	ANTI-SENSE	Arabidopsis thaliana
188	427	11814	CGPG1041	ANTI-SENSE	Arabidopsis thaliana
188	427	12018	CGPG1041	SENSE	Arabidopsis thaliana
189	428	13003	CGPG673	ANTI-SENSE	Arabidopsis thaliana
190	429	13949	CGPG1686	ANTI-SENSE	Arabidopsis thaliana
191	430	16416	CGPG2258	ANTI-SENSE	Arabidopsis thaliana
192	431	16438	CGPG1847	ANTI-SENSE	Arabidopsis thaliana
193	432	17124	CGPG2432	ANTI-SENSE	Arabidopsis thaliana
194	433	19132	CGPG1755	ANTI-SENSE	Arabidopsis thaliana
195	434	17922	CGPG2880	SENSE	Arabidopsis thaliana
196	435	19719	CGPG4171	SENSE	Glycine max
197	436	17336	CGPG1732	SENSE	Arabidopsis thaliana
197	436	14274	CGPG1732	ANTI-SENSE	Arabidopsis thaliana
198	437	17735	CGPG2423	SENSE	Arabidopsis thaliana
199	438	19249	CGPG3115	SENSE	Arabidopsis thaliana
200	439	18513	CGPG3485	SENSE	Arabidopsis thaliana
201	440	11517	CGPG224	SENSE	Arabidopsis thaliana
202	441	12363	CGPG981	SENSE	Arabidopsis thaliana
203	442	12922	CGPG1294	SENSE	Arabidopsis thaliana
204	443	15360	CGPG1719	SENSE	Arabidopsis thaliana
205	444	16028	CGPG2047	SENSE	Arabidopsis thaliana
206	445	16648	CGPG2504	SENSE	Agrobacterium tumefaciens
207	446	16705	CGPG1005	SENSE	Arabidopsis thaliana
208	447	16715	CGPG2273	SENSE	Arabidopsis thaliana
209	448	17316	CGPG2146	SENSE	Arabidopsis thaliana
210	449	17331	CGPG1708	SENSE	Arabidopsis thaliana
211	450	17339	CGPG2461	SENSE	Arabidopsis thaliana
212	451	17420	CGPG2465	SENSE	Arabidopsis thaliana
213	452	17446	CGPG2728	SENSE	Arabidopsis thaliana
214	453	17487	CGPG2633	SENSE	Arabidopsis thaliana
215	454	17740	CGPG2605	SENSE	Arabidopsis thaliana
216	455	17752	CGPG2831	SENSE	Arabidopsis thaliana
217	456	18021	CGPG685	SENSE	Arabidopsis thaliana
218	457	18245	CGPG3343	SENSE	Arabidopsis thaliana
219	458	18617	CGPG3521	SENSE	Arabidopsis thaliana
220	459	18734	CGPG3198	SENSE	Arabidopsis thaliana
221	460	18823	CGPG2830	SENSE	Arabidopsis thaliana
222	461	19222	CGPG3017	SENSE	Arabidopsis thaliana
223	462	19430	CGPG3487	SENSE	Arabidopsis thaliana
224	463	12332	CGPG356	AntiSense	Arabidopsis thaliana
225	464	13649	CGPG1544	Anti-Sense	Arabidopsis thaliana
226	465	16113	CGPG2128	AntiSense	Arabidopsis thaliana
227	466	12069	CGPG1188	Sense	Arabidopsis thaliana
228	467	12906	CGPG313	Sense	Arabidopsis thaliana
229	468	13443	CGPG1233	Sense	Arabidopsis thaliana
230	469	14707	CGPG1141	Sense	Arabidopsis thaliana
231	470	15116	CGPG1509	Sense	Arabidopsis thaliana
232	471	16117	CGPG2234	Sense	Arabidopsis thaliana
233	472	16136	CGPG2144	Sense	Arabidopsis thaliana
234	473	19077	CGPG1808	Sense	Arabidopsis thaliana
235	474	19178	CGPG3683	Sense	Sacoharomyces cerevisiae
236	475	70752	CGPG4465	Sense	Arabidopsis thaliana
237	476	70753	CGPG4469	Sense	Arabidopsis thaliana
238	477	70809	CGPG388	Sense	Arabidopsis thaliana
239	478	72091	CGPG5264	Sense	Sacoharomyces cerevisiae

Recombinant DNA

Exemplary DNA for use in the present invention to improve traits in plants are provided herein as SEQ ID NO: 1 through SEQ ID NO: 151 and SEQ ID NO: 153 through SEQ ID NO: 239. A subset of the exemplary DNA includes fragments of the disclosed full polynucleotides consisting of oligonucleotides of at least 15, preferably at least 16 or 17, more preferably at least 18 or 19, and even more preferably at least 20 or more, consecutive nucleotides. Such oligonucleotides are fragments of the larger molecules having a sequence selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 151 and SEQ ID NO: 153 through SEQ ID NO: 239, and find use, for example as probes and primers for detection of the polynucleotides of the present invention.

Also of interest in the present invention are variants of the DNA provided herein. Such variants may be naturally occurring, including DNA from homologous genes from the same or a different species, or may be non-natural variants, for example DNA synthesized using chemical synthesis methods, or generated using recombinant DNA techniques. Degeneracy of the genetic code provides the possibility to substitute at least one base of the protein encoding sequence of a gene with a different base without causing the amino acid sequence of the polypeptide produced from the gene to be changed. Hence, a DNA useful in the present invention may have any base sequence that has been changed from the sequences provided herein by substitution in accordance with degeneracy of the genetic code.

Homologs of the genes providing DNA of demonstrated as useful in improving traits in model plants disclosed herein will generally demonstrate significant identity with the DNA provided herein. DNA is substantially identical to a reference DNA if, when the sequences of the polynucleotides are optimally aligned there is about 60% nucleotide equivalence; more preferably 70%; more preferably 80% equivalence; more preferably 85% equivalence; more preferably 90%; more preferably 95%; and/or more preferably 98% or 99% equivalence over a comparison window. A comparison window is preferably at least 50-100 nucleotides, and more preferably is the entire length of the polynucleotide provided herein. Optimal alignment of sequences for aligning a comparison window may be conducted by algorithms; preferably by computerized implementations of these algorithms (for example, the Wisconsin Genetics Software Package Release 7.0-10.0, Genetics Computer Group, 575 Science Dr., Madison, Wis.). The reference polynucleotide may be a full-length molecule or a portion of a longer molecule. Preferentially, the window of comparison for determining polynucleotide identity of protein encoding sequences is the entire coding region.

Recombinant DNA

Proteins useful for imparting improved traits are entire proteins or at least a sufficient portion of the entire protein to impart the relevant biological activity of the protein. The term “protein” also includes molecules consisting of one or more polypeptide chains. Thus, a protein useful in the present invention may constitute an entire protein having the desired biological activity, or may constitute a portion of an oligomeric protein having multiple polypeptide chains. Proteins useful for generation of transgenic plants having improved traits include the proteins with an amino acid sequence provided herein as SEQ ID NO: 240 through SEQ ID NO: 390 and SEQ ID NO: 392 through SEQ ID NO: 478, as well as homologs of such proteins.

Homologs of the proteins useful in the present invention may be identified by comparison of the amino acid sequence of the protein to amino acid sequences of proteins from the same or different plant sources, e.g., manually or by using known homology-based search algorithms such as those commonly known and referred to as BLAST, FASTA, and Smith-Waterman. As used herein, a homolog is a protein from the same or a different organism that performs the same biological function as the polypeptide to which it is compared. An orthologous relation between two organisms is not necessarily manifest as a one-to-one correspondence between two genes, because a gene can be duplicated or deleted after organism phylogenetic separation, such as speciation. For a given protein, there may be no ortholog or more than one ortholog. Other complicating factors include alternatively spliced transcripts from the same gene, limited gene identification, redundant copies of the same gene with different sequence lengths or corrected sequence. A local sequence alignment program, e.g., BLAST, can be used to search a database of sequences to find similar sequences, and the summary Expectation value (E-value) used to measure the sequence base similarity. As a protein hit with the best E-value for a particular organism may not necessarily be an ortholog or the only ortholog, a reciprocal BLAST search is used in the present invention to filter hit sequences with significant E-values for ortholog identification. The reciprocal BLAST entails search of the significant hits against a database of amino acid sequences from the base organism that are similar to the sequence of the query protein. A hit is a likely ortholog, when the reciprocal BLAST's best hit is the query protein itself or a protein encoded by a duplicated gene after speciation. Thus, homolog is used herein to describe protein that are assumed to have functional similarity by inference from sequence base similarity. The relationship of homologs with amino acid sequences of SEQ ID NO: 479 through SEQ ID NO: 12463 to the proteins with amino acid sequences of SEQ ID NO: 240 through SEQ ID NO: 478 is found is found in Table 2 appended.

A further aspect of the invention comprises functional homolog proteins which differ in one or more amino acids from those of a trait-improving protein disclosed herein as the result of one or more of the well-known conservative amino acid substitutions, e.g., valine is a conservative substitute for alanine and threonine is a conservative substitute for serine. Conservative substitutions for an amino acid within the native sequence can be selected from other members of a class to which the naturally occurring amino acid belongs. Representative amino acids within these various classes include, but are not limited to: (1) acidic (negatively charged) amino acids such as aspartic acid and glutamic acid; (2) basic (positively charged) amino acids such as arginine, histidine, and lysine; (3) neutral polar amino acids such as glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine; and (4) neutral nonpolar (hydrophobic) amino acids such as alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, and methionine. Conserved substitutes for an amino acid within a native amino acid sequence can be selected from other members of the group to which the naturally occurring amino acid belongs. For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains is cysteine and methionine. Naturally conservative amino acids substitution groups are: valine-leucine, valine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, aspartic acid-glutamic acid, and asparagine-glutamine. A further aspect of the invention comprises proteins that differ in one or more amino acids from those of a described protein sequence as the result of deletion or insertion of one or more amino acids in a native sequence.

Homologs of the trait-improving proteins disclosed provided herein will generally demonstrate significant sequence identity. Of particular interest are proteins having at least 50% sequence identity, more preferably at least about 70% sequence identity or higher, e.g., at least about 80% sequence identity with an amino acid sequence of SEQ ID NO: 240 through SEQ ID NO: 390 and SEQ ID NO: 392 through SEQ ID NO: 478. Of course useful proteins also include those with higher identity, e.g., 90% to 99% identity. Identity of protein homologs is determined by optimally aligning the amino acid sequence of a putative protein homolog with a defined amino acid sequence and by calculating the percentage of identical and conservatively substituted amino acids over the window of comparison. The window of comparison for determining identity can be the entire amino acid sequence disclosed herein, e.g., the full sequence of any of SEQ ID NO: 479 through SEQ ID NO: 12463.

Genes that are homologous to each other can be grouped into families and included in multiple sequence alignments. Then a consensus sequence for each group can be derived. This analysis enables the derivation of conserved and class-(family) specific residues or motifs that are functionally important. These conserved residues and motifs can be further validated with 3D protein structure if available. The consensus sequence can be used to define the full scope of the invention, e.g., to identify proteins with a homolog relationship. Thus, the present invention contemplates that protein homologs include proteins with an amino acid sequence that has at least 90% identity to such a consensus amino acid sequence sequences.

Promoters

Numerous promoters that are active in plant cells have been described in the literature. These include promoters present in plant genomes as well as promoters from other sources, including nopaline synthase (NOS) promoter and octopine synthase (OCS) promoters carried on tumor-inducing plasmids of Agrobacterium tumefaciens, caulimovirus promoters such as the cauliflower mosaic virus or figwort mosaic virus promoters. For instance, see U.S. Pat. Nos. 5,858,742 and 5,322,938 which disclose versions of the constitutive promoter derived from cauliflower mosaic virus (CaMV35S), U.S. Pat. No. 5,378,619 which discloses a Figwort Mosaic Virus (FMV) 35S promoter, U.S. Pat. No. 6,437,217 which discloses a maize RS81 promoter, U.S. Pat. No. 5,641,876 which discloses a rice actin promoter, U.S. Pat. No. 6,426,446 which discloses a maize RS324 promoter, U.S. Pat. No. 6,429,362 which discloses a maize PR-1 promoter, U.S. Pat. No. 6,232,526 which discloses a maize A3 promoter, U.S. Pat. No. 6,177,611 which discloses constitutive maize promoters, U.S. Pat. No. 6,433,252 which discloses a maize L3 oleosin promoter, U.S. Pat. No. 6,429,357 which discloses a rice actin 2 promoter and intron, U.S. Pat. No. 5,837,848 which discloses a root specific promoter, U.S. Pat. No. 6,084,089 which discloses cold inducible promoters, U.S. Pat. No. 6,294,714 which discloses light inducible promoters, U.S. Pat. No. 6,140,078 which discloses salt inducible promoters, U.S. Pat. No. 6,252,138 which discloses pathogen inducible promoters, U.S. Pat. No. 6,175,060 which discloses phosphorus deficiency inducible promoters, U.S. Patent Application Publication 2002/0192813A1 which discloses 5′, 3′ and intron elements useful in the design of effective plant expression vectors, U.S. patent application Ser. No. 09/078,972 which discloses a coixin promoter, U.S. patent application Ser. No. 09/757,089 which discloses a maize chloroplast aldolase promoter, and U.S. patent application Ser. No. 10/739,565 which discloses water-deficit inducible promoters, all of which are incorporated herein by reference. These and numerous other promoters that function in plant cells are known to those skilled in the art and available for use in recombinant polynucleotides of the present invention to provide for expression of desired genes in transgenic plant cells.

Furthermore, the promoters may be altered to contain multiple “enhancer sequences” to assist in elevating gene expression. Such enhancers are known in the art. By including an enhancer sequence with such constructs, the expression of the selected protein may be enhanced. These enhancers often are found 5′ to the start of transcription in a promoter that functions in eukaryotic cells, but can often be inserted in the forward or reverse orientation 5′ or 3′ to the coding sequence. In some instances, these 5′ enhancing elements are introns. Deemed to be particularly useful as enhancers are the 5′ introns of the rice actin 1 and rice actin 2 genes. Examples of other enhancers that can be used in accordance with the invention include elements from the CaMV 35S promoter, octopine synthase genes, the maize alcohol dehydrogenase gene, the maize shrunken 1 gene and promoters from non-plant eukaryotes.

In some aspects of the invention it is preferred that the promoter element in the DNA construct be capable of causing sufficient expression to result in the production of an effective amount of a polypeptide in water deficit conditions. Such promoters can be identified and isolated from the regulatory region of plant genes that are over expressed in water deficit conditions. Specific water-deficit-inducible promoters for use in this invention are derived from the 5′ regulatory region of genes identified as a heat shock protein 17.5 gene (HSP17.5), an HVA22 gene (HVA22), a Rab17 gene and a cinnamic acid 4-hydroxylase (CA4H) gene (CA4H) of Zea maize. Such water-deficit-inducible promoters are disclosed in U.S. application Ser. No. 10/739,565, incorporated herein by reference.

In other aspects of the invention, sufficient expression in plant seed tissues is desired to effect improvements in seed composition. Exemplary promoters for use for seed composition modification include promoters from seed genes such as napin (U.S. Pat. No. 5,420,034), maize L3 oleosin (U.S. Pat. No. 6,433,252), zein Z27 (Russell et al., (1997) Transgenic Res. 6(2):157-166), globulin 1 (Belanger et al., (1991) Genetics 129:863-872), glutelin 1 (Russell (1997) supra), and peroxiredoxin antioxidant (Per1) (Stacy et al., (1996) Plant Mol. Biol. 31(6):1205-1216).

In still other aspects of the invention, preferential expression in plant green tissues is desired. Promoters of interest for such uses include those from genes such as SSU (Fischhoff et al., (1992) Plant Mol. Biol. 20:81-93), aldolase and pyruvate orthophosphate dikinase (PPDK) (Taniguchi et al., (2000) Plant Cell Physiol. 41(1):42-48).

Gene Overexpression

“Gene overexpression” used herein in reference to a polynucleotide or polypeptide indicates that the expression level of a target protein, in a transgenic plant or in a host cell of the transgenic plant, exceeds levels of expression in a non-transgenic plant. In a preferred embodiment of the present invention, a recombinant DNA construct comprises the polynucleotide of interest in the sense orientation relative to the promoter to achieve gene overexpression, which is identified as such in Table 1.

Gene Suppression

Gene suppression includes any of the well-known methods for suppressing transcription of a gene or the accumulation of the mRNA corresponding to that gene thereby preventing translation of the transcript into protein. Posttranscriptional gene suppression is mediated by transcription of integrated recombinant DNA to form double-stranded RNA (dsRNA) having homology to a gene targeted for suppression. This formation of dsRNA most commonly results from transcription of an integrated inverted repeat of the target gene, and is a common feature of gene suppression methods known as anti-sense suppression, co-suppression and RNA interference (RNAi). Transcriptional suppression can be mediated by a transcribed dsRNA having homology to a promoter DNA sequence to effect what is called promoter trans suppression.

More particularly, posttranscriptional gene suppression by inserting a recombinant DNA construct with anti-sense oriented DNA to regulate gene expression in plant cells is disclosed in U.S. Pat. No. 5,107,065 (Shewmaker et al.) and U.S. Pat. No. 5,759,829 (Shewmaker et al.). Transgenic plants transformed using such anti-sense oriented DNA constructs for gene suppression can comprise integrated DNA arranged as an inverted repeats that result from insertion of the DNA construct into plants by Agrobacterium-mediated transformation, as disclosed by Redenbaugh et al., in “Safety Assessment of Genetically Engineered Flavr Savr™ Tomato, CRC Press, Inc. (1992). Inverted repeat insertions can comprise a part or all of the T-DNA construct, e.g., an inverted repeat of a complete transcription unit or an inverted repeat of transcription terminator sequence. Screening for inserted DNA comprising inverted repeat elements can improve the efficiency of identifying transformation events effective for gene silencing whether the transformation construct is a simple anti-sense DNA construct which must be inserted in multiple copies or a complex inverted repeat DNA construct (e.g., an RNAi construct) which can be inserted as a single copy.

Posttranscriptional gene suppression by inserting a recombinant DNA construct with sense-oriented DNA to regulate gene expression in plants is disclosed in U.S. Pat. No. 5,283,184 (Jorgensen et al.,) and U.S. Pat. No. 5,231,020 (Jorgensen et al.,). Inserted T-DNA providing gene suppression in plants transformed with such sense constructs by Agrobacterium is organized predominately in inverted repeat structures, as disclosed by Jorgensen et al., Mol. Gen. Genet., 207:471-477 (1987). See also Stam et al. The Plant Journal, 12(1), 63-82 (1997) who used segregation studies to support Jorgensen's finding that gene silencing is mediated by multimeric transgene T-DNA loci in which the T-DNAs are arranged in inverted repeats. Screening for inserted DNA comprising inverted repeat elements can improve the gene silencing efficiency when transforming with simple sense-orientated DNA constructs. Gene silencing efficiency can also be improved by screening for single insertion events when transforming with an RNAi construct containing inverted repeat elements

As disclosed by Redenbaugh et al., gene suppression can be achieved by inserting into a plant genome recombinant DNA that transcribes dsRNA. Such a DNA insert can be transcribed to an RNA element having the 3′ region as a double stranded RNA. RNAi constructs are also disclosed in EP 0426195 A1 (Goldbach et al., 1991) where recombinant DNA constructs for transcription into hairpin dsRNA for providing transgenic plants with resistance to tobacco spotted wilt virus. Double-stranded RNAs were also disclosed in WO 94/01550 (Agrawal et al.,) where anti-sense RNA was stabilized with a self-complementary 3′ segment. Agrawal et al., referred to U.S. Pat. No. 5,107,065 for using such self-stablized anti-sense RNAs for regulating gene expression in plant cells; see International Publication No. 94/01550. Other double-stranded hairpin-forming elements in transcribed RNA are disclosed in International Publication No. 98/05770 (Werner et al.,) where the anti-sense RNA is stabilized by hairpin forming repeats of poly(CG) nucleotides. See also U.S. Patent Application Publication No. 2003/0175965 A1 (Lowe et al.,) which discloses gene suppression using and RNAi construct comprising a gene coding sequence preceded by inverted repeats of 5′UTR. See also U.S. Patent Application Publication No. 2002/0048814 A1 (Oeller) where RNAi constructs are transcribed to sense or anti-sense RNA which is stabilized by a poly(T)-poly(A) tail. See also U.S. Patent Application Publication No. 2003/0018993 A1 (Gutterson et al.,) where sense or anti-sense RNA is stabilized by an inverted repeat of a of the 3′ untranslated region of the NOS gene. See also U.S. Patent Application Publication No. 2003/0036197 A1 (Glassman et al.,) where RNA having homology to a target is stabilized by two complementary RNA regions.

Gene silencing can also be effected by transcribing RNA from both a sense and an anti-sense oriented DNA, e.g., as disclosed by Shewmaker et al., in U.S. Pat. No. 5,107,065 where in Example 1 a binary vector was prepared with both sense and anti-sense aroA genes. See also U.S. Pat. No. 6,326,193 where gene targeted DNA is operably linked to opposing promoters.

Gene silencing can also be affected by transcribing from contiguous sense and anti-sense DNA. In this regard see Sijen et al. The Plant Cell, Vol. 8, 2277-2294 (1996) discloses the use of constructs carrying inverted repeats of a cowpea mosaic virus gene in transgenic plants to mediate virus resistance. Such constructs for posttranscriptional gene suppression in plants by double-stranded RNA are also disclosed in International Publication No. WO 99/53050 (Waterhouse et al.,), International Publication No. WO 99/49029 (Graham et al.), U.S. patent application Ser. No. 10/465,800 (Fillatti), U.S. Pat. No. 6,506,559 (Fire et al.). See also U.S. application Ser. No. 10/393,347 (Shewmaker et al.,) that discloses constructs and methods for simultaneously expressing one or more recombinant genes while simultaneously suppressing one or more native genes in a transgenic plant. See also U.S. Pat. No. 6,448,473 (Mitsky et al.,) that discloses multi-gene suppression vectors for use in plants. All of the above-described patents, applications and international publications disclosing materials and methods for posttranscriptional gene suppression in plants are incorporated herein by reference.

Transcriptional suppression such as promoter trans suppression can be affected by a expressing a DNA construct comprising a promoter operably linked to inverted repeats of promoter DNA for a target gene. Constructs useful for such gene suppression mediated by promoter trans suppression are disclosed by Mette et al. The EMBO Journal, Vol. 18, No. 1, pp. 241-148, 1999 and by Mette et al. The EMBO Journal, Vol. 19, No. 19, pp. 5194-5201-148, 2000, both of which are incorporated herein by reference.

Suppression can also be achieved by insertion mutations created by transposable elements may also prevent gene function. For example, in many dicot plants, transformation with the T-DNA of Agrobacterium may be readily achieved and large numbers of transformants can be rapidly obtained. Also, some species have lines with active transposable elements that can efficiently be used for the generation of large numbers of insertion mutations, while some other species lack such options. Mutant plants produced by Agrobacterium or transposon mutagenesis and having altered expression of a polypeptide of interest can be identified using the polynucleotides of the present invention. For example, a large population of mutated plants may be screened with polynucleotides encoding the polypeptide of interest to detect mutated plants having an insertion in the gene encoding the polypeptide of interest.

Gene Stacking

The present invention also contemplates that the trait-improving recombinant DNA provided herein can be used in combination with other recombinant DNA to create plants with a multiple desired traits. The combinations generated can include multiple copies of any one or more of the recombinant DNA constructs.

These stacked combinations can be created by any method, including but not limited to cross breeding of transgenic plants, or multiple genetic transformation.

Plant Transformation Methods

Numerous methods for transforming plant cells with recombinant DNA are known in the art and may be used in the present invention. Two commonly used methods for plant transformation are Agrobacterium-mediated transformation and microprojectile bombardment. Microprojectile bombardment methods are illustrated in U.S. Pat. No. 5,015,580 (soybean); U.S. Pat. No. 5,550,318 (corn); U.S. Pat. No. 5,538,880 (corn); U.S. Pat. No. 5,914,451 (soybean); U.S. Pat. No. 6,160,208 (corn); U.S. Pat. No. 6,399,861 (corn) and U.S. Pat. No. 6,153,812 (wheat) and Agrobacterium-mediated transformation is described in U.S. Pat. No. 5,159,135 (cotton); U.S. Pat. No. 5,824,877 (soybean); U.S. Pat. No. 5,591,616 (corn); and U.S. Pat. No. 6,384,301 (soybean), all of which are incorporated herein by reference. For Agrobacterium tumefaciens based plant transformation system, additional elements present on transformation constructs will include T-DNA left and right border sequences to facilitate incorporation of the recombinant polynucleotide into the plant genome.

In general it is preferred to introduce heterologous DNA randomly, i.e., at a non-specific location, in the genome of a target plant line. In special cases it may be useful to target heterologous DNA insertion in order to achieve site-specific integration, e.g., to replace an existing gene in the genome, to use an existing promoter in the plant genome, or to insert a recombinant polynucleotide at a predetermined site known to be active for gene expression. Several site specific recombination systems exist which are known to function implants include cre-lox as disclosed in U.S. Pat. No. 4,959,317 and FLP-FRT as disclosed in U.S. Pat. No. 5,527,695, both incorporated herein by reference.

Transformation methods of this invention are preferably practiced in tissue culture on media and in a controlled environment. “Media” refers to the numerous nutrient mixtures that are used to grow cells in vitro, that is, outside of the intact living organism. Recipient cell targets include, but are not limited to, meristem cells, callus, immature embryos and gametic cells such as microspores, pollen, sperm and egg cells. It is contemplated that any cell from which a fertile plant may be regenerated is useful as a recipient cell. Callus may be initiated from tissue sources including, but not limited to, immature embryos, seedling apical meristems, microspores and the like. Cells capable of proliferating as callus are also recipient cells for genetic transformation. Practical transformation methods and materials for making transgenic plants of this invention, e.g., various media and recipient target cells, transformation of immature embryos and subsequent regeneration of fertile transgenic plants are disclosed in U.S. Pat. Nos. 6,194,636 and 6,232,526 and U.S. patent application Ser. No. 09/757,089, which are incorporated herein by reference.

In practice DNA is introduced into only a small percentage of target cells in any one experiment. Marker genes are used to provide an efficient system for identification of those cells that are stably transformed by receiving and integrating a transgenic DNA construct into their genomes. Preferred marker genes provide selective markers that confer resistance to a selective agent, such as an antibiotic or herbicide. Potentially transformed cells are exposed to the selective agent. In the population of surviving cells will be those cells where, generally, the resistance-conferring gene has been integrated and expressed at sufficient levels to permit cell survival. Cells may be tested further to confirm stable integration of the exogenous DNA. Useful selective marker genes include those conferring resistance to antibiotics such as kanamycin (nptII), hygromycin B (aph IV) and gentamycin (aac3 and aacC4) or resistance to herbicides such as glufosinate (bar or pat) and glyphosate (EPSPS). Examples of such selectable are illustrated in U.S. Pat. Nos. 5,550,318; 5,633,435; 5,780,708 and 6,118,047, all of which are incorporated herein by reference. Screenable markers which provide an ability to visually identify transformants can also be employed, e.g., a gene expressing a colored or fluorescent protein such as a luciferase or green fluorescent protein (GFP) or a gene expressing a beta-glucuronidase or uidA gene (GUS) for which various chromogenic substrates are known. It is also contemplated that combinations of screenable and selectable markers will be useful for identification of transformed cells. See PCT publication WO 99/61129 which discloses use of a gene fusion between a selectable marker gene and a screenable marker gene, e.g., an NPTII gene and a GFP gene.

Cells that survive exposure to the selective agent, or cells that have been scored positive in a screening assay, may be cultured in regeneration media and allowed to mature into plants. Developing plantlets can be transferred to soil less plant growth mix, and hardened off, e.g., in an environmentally controlled chamber at about 85% relative humidity, 600 ppm CO₂, and 25-250 microeinsteins m⁻² s⁻¹ of light, prior to transfer to a greenhouse or growth chamber for maturation. Plants are preferably matured either in a growth chamber or greenhouse. Plants are regenerated from about 6 wk to 10 months after a transformant is identified, depending on the initial tissue. During regeneration, cells are grown to plants on solid media at about 19 to 28° C. After regenerating plants have reached the stage of shoot and root development, they may be transferred to a greenhouse for further growth and testing. Plants may be pollinated using conventional plant breeding methods known to those of skill in the art and seed produced.

Progeny may be recovered from transformed plants and tested for expression of the exogenous recombinant polynucleotide. Useful assays include, for example, “molecular biological” assays, such as Southern and Northern blotting and PCR; “biochemical” assays, such as detecting the presence of RNA, e.g., double stranded RNA, or a protein product, e.g., by immunological means (ELISAs and Western blots) or by enzymatic function; plant part assays, such as leaf or root assays; and also, by analyzing the phenotype of the whole regenerated plant.

Discovery of Trait-Improving Recombinant DNA

To identify recombinant DNA that confer improved traits to plants, Arabidopsis thaliana was transformed with a candidate recombinant DNA construct and screened for an improved trait.

Arabidopsis thaliana is used a model for genetics and metabolism in plants. Arabidopsis has a small genome, and well documented studies are available. It is easy to grow in large numbers and mutants defining important genetically controlled mechanisms are either available, or can readily be obtained. Various methods to introduce and express isolated homologous genes are available (see Koncz, et al., eds. Methods in Arabidopsis Research. et al., (1992), World Scientific, New Jersey, N.J., in “Preface”).

A two-step screening process was employed which comprised two passes of trait characterization to ensure that the trait modification was dependent on expression of the recombinant DNA, but not due to the chromosomal location of the integration of the transgene. Twelve independent transgenic lines for each recombinant DNA construct were established and assayed for the transgene expression levels. Five transgenic lines with high transgene expression levels were used in the first pass screen to evaluate the transgene's function in T2 transgenic plants. Subsequently, three transgenic events, which had been shown to have one or more improved traits, were further evaluated in the second pass screen to confirm the transgene's ability to impart an improved trait. The following Table 3 summarizes the improved traits that have been confirmed as provided by a recombinant DNA construct.

In particular Table3 reports

“PEP SEQ ID NO” which is the amino acid sequence of the protein cognate to the DNA in the recombinant DNA construct corresponding to a protein sequence of a SEQ ID NO. in the Sequence Listing;

“construct_id” is an arbitrary name for the recombinant DNA describe more particularly in Table 1;

“annotation” refers to a description of the top hit protein obtained from an amino acid sequence query of each PEP SEQ ID NO to GenBank database of the National Center for Biotechnology Information (ncbi). More particularly, “gi” is the GenBank ID number for the top BLAST hit;

“description” refers to the description of the top BLAST hit;

“e-value” provides the expectation value for the BLAST hit;

“identity” refers to the percentage of identically matched amino acid residues along the length of the portion of the sequences which is aligned by BLAST between the sequence of interest provided herein and the hit sequence in GenBank;

“traits” identifies by two letter code the confirmed improvement in a transgenic plant provided by the recombinant DNA. The codes for improved traits are:

“CK” which indicates cold tolerance improvement identified under a cold shock tolerance screen;

“CS” which indicates cold tolerance improvement identified by a cold germination tolerance screen;

“DS” which indicates drought tolerance improvement identified by a drought stress tolerance screen;

“PEG” which indicates osmotic stress tolerance improvement identified by a PEG induced osmotic stress tolerance screen;

“HS” which indicates heat stress tolerance improvement identified by a heat stress tolerance screen;

“SS” which indicates high salinity stress tolerance improvement identified by a salt stress tolerance screen;

“LN” which: indicates nitrogen use efficiency improvement identified by a low nitrogen tolerance screen.

“LL” which indicates attenuated shade avoidance response identified by a shade tolerance screen under a low light condition;

“PP” which indicates improved growth and development at early stages identified by an early plant growth and development screen;

“SP” which indicates improved growth and development at late stages identified by a late plant growth and development screen provided herein.

TABLE 3
PEP
SEQ
ID	construct—	Annotation
NO	id	e-value	identity	gi	Description	traits
240	19867	2.00E−72	47	15226242	(NM_128336) hypothetical	CK	CS
					protein [Arabidopsis thaliana]
241	74518	0	100	17980436	bacteriophytochrome	DS	LN	PEG	PP	CK	CS
					[Pseudomonas fluorescens]
242	15816	1.00E−101	100	18414706	(NM_120565) expressed protein	CK
					[Arabidopsis thaliana]
					dbj|BAB08987.1
243	17918	5.00E−78	81	15232662	(AB017071) zinc finger protein-	SS	CK
					like; Ser/Thr protein kinase-like
					protein [Arabidopsis thaliana]
244	15306	1.00E−121	57	15227057	(NM_126342) predicted by	CS
					genefinder and genscan
					[Arabidopsis thaliana]
245	12038	2.00E−47	100	18413298	auxin-regulated protein	PP	CS
					[Arabidopsis thaliana]
					gi|30681325|ref|NP_849354.1
246	12046					CS
247	13432	1.00E−79	53	18396732	(NM_111270) expressed protein	CS
					[Arabidopsis thaliana]
					gb|AAF05858.1
248	13711	1.00E−33	84	15232724	expressed protein [Arabidopsis	CS
					thaliana] gi|11280688|pir||T45643
					hypothetical protein
249	14809	1.00E−142	100	15230177	AF488576_1 (AF488576)	CS
					putative bHLH transcription factor
					[Arabidopsis thaliana]
250	14951	1.00E−146	100	4056434	(AC005990) Similar to	PP	CS
					OBP32pep protein gb|U37698
					from Arabidopsis thaliana
251	15632	0	89	9758356	(AB013396) eukaryotic initiation	CS
					factor 4, eIF4-like protein
					[Arabidopsis thaliana]
252	16147	0	100	11890406	(AF197940) SAM: phosphoethanolamine	CS
					N-
					methyltransferase [Arabidopsis
					thaliana] g
253	16158	1.00E−68	100	18412355	(NM_106587) expressed protein	CS
					[Arabidopsis thaliana]
254	16170	2.00E−82	91	15224757	(NM_127488) putative small heat	CS
					shock protein [Arabidopsis
					thaliana]
255	16171	4.00E−92	72	18401372	(NM_128284) expressed protein	CS
					[Arabidopsis thaliana]
256	16175	1.00E−157	85	15240715	(NM_126137) putative protein	CS
					[Arabidopsis thaliana]
257	17430	1.00E−155	90	13878155	(AF370340) putative	CS
					mitochondrial dicarboxylate
					carrier protein [Arabidopsis
					thaliana]
258	17819	100E−140	95	15236507	(NM_116915) hypothetical	SS	CS
					protein [Arabidopsis thaliana]
					emb|CAB77971.1
259	17921	1.00E−110	74	18415982	(NM_118393) HSP associated	CS
					protein like [Arabidopsis thaliana]
260	17928	1.00E−74	100	15231105	(NM_115730) transcriptional	PP	CS
					coactivator - like protein
					[Arabidopsis thaliana]
261	18637	1.00E−128	87	15233509	(NM_118226) putative protein	CS
					[Arabidopsis thaliana]
262	18816	0	94	18398254	(NM_102942) expressed protein	LL	CS
					[Arabidopsis thaliana]
263	19227	1.00E−164	96	15219482	(NM_106009) MAP kinase,	CS
					putative [Arabidopsis thaliana]
264	19429	0	100	15237038	(NM_118860) GH3 like protein	CS
					[Arabidopsis thaliana]
265	70235	2.00E−94	100	15234243	(NM_117229) phospholipid	PP	CS
					hydroperoxide glutathione
					peroxidase [Arabidopsis thaliana]
266	72634	4.00E−52	86	30699033	GAST1-related protein	CS
					[Arabidopsis thaliana]
267	72752	0	100	6319971	(NC_001136) phosphotyrosine-	PP	CS
					specific protein phosphatase;
					Ptp1p [Saccharomyces
					cerevisiae]
268	12007	1.00E−119	76	15236117	(NM_118746) uncharacterized	HS
					protein [Arabidopsis thaliana]
269	12290	5.00E−66	92	18396460	(NM_111186) expressed protein	HS
					[Arabidopsis thaliana]]
270	12343	1.00E−111	61	18414724	(NM_120571) expressed protein	HS
					[Arabidopsis thaliana]
					gb|AAF61902.1|AF208051_1
					(AF208051) small heat shock-like
					protein
271	14348	0	100	15234254	(NM_118912) putative protein	HS
					[Arabidopsis thaliana] pir||T05878
					isp4 protein homolog
					T29A15.220
272	15708	7.00E−71	87	18394214	(NM_101391) expressed protein	HS
					[Arabidopsis thaliana]
273	17615	100E−108	85	18414711	(NM_120567) expressed protein	CS	HS
					[Arabidopsis thaliana]
274	17622	0	93	15238837	(NM_121852) putative protein	HS
					[Arabidopsis thaliana]
275	70714	0	94	7446439	probable serine/threonine-	HS
					specific protein kinase (EC 2.7.1.- )
					F17I5.140 - Arabidopsis
					thaliana emb|CAA19877.1|
					(AL031032) protein kinase-like
					protein [Arabidopsis thaliana]
276	17925	100E−157	82	18405518	(NM_129646) expressed protein	HS	CK
					[Arabidopsis thaliana] pir||T00747
					RING-H2 finger protein RHC1a
277	18541	1.00E−128	83	15237100	(NM_119735) hypothetical	HS	CS
					protein [Arabidopsis thaliana]
278	11425	1.00E−155	100	18405364	(AB024028) 20S proteasome	HS
					beta subunit; multicatalytic
					endopeptidase [Arabidopsis
					thaliana]
279	12263	9.00E−39	100	15241279	small zinc finger-related protein	HS
					[Arabidopsis thaliana]
					gi|12230183|sp|Q9XGY4|IM08_ARATH
					Mitochondrial import inner
					membrane translocase subunit
					Tim8
280	12288	0	97	7488126	AAB01678.1| (U27590) Fe(II)	HS
					transport protein [Arabidopsis
					thaliana]
281	12910	0	90	17065456	(AY062804) A6 anther-specific	HS
					protein [Arabidopsis thaliana]
282	14335	0	93	15229692	(NM_111953) omega-3 fatty acid	LL	HS
					desaturase, chloroplast precursor
					[Arabidopsis thaliana]
283	17427	0	100	13878127	(AF370326) putative 2-	HS
					nitropropane dioxygenase
					[Arabidopsis thaliana]
284	19140	0	100	15223458	(NM_104489) SAR DNA binding	HS
					protein, putative [Arabidopsis
					thaliana]
					gb|AAF02835.1|AC009894_6
					(AC009894) nucleolar protein
					[Arabidopsis thaliana]
					gb|AAG40838.1|AF302492_1
					(AF302492) NOP56-like protein
					[Arabidopsis thaliana]
285	19179	7.00E−97	92	18390408	(NM_100335) expressed protein	PP	SS	HS
					[Arabidopsis thaliana]
					gb|AAB80630.1| (AC002376)
					Strong similarity to Triticum ABA
					induced membrane protein
					(gb|U80037)
286	19251	0	100	21553584	(AY085451) putative 3-	HS
					isopropylmalate dehydrogenase
					[Arabidopsis thaliana]
287	19443	1.00E−171	100	15220490	(NM_102700) zinc finger protein,	HS
					putative [Arabidopsis thaliana]
					gb|AAG51745.1|AC068667_24
					(AC068667) zinc finger protein,
					putative; 86473-88078
					[Arabidopsis thaliana]
288	19607	0	90	15239867	(NM_124313) xylosidase	HS
					[Arabidopsis thaliana]
289	19915	2.00E−87	50	15229221	(NM_111278) NAM-like protein	SP	HS
					(no apical meristem) [Arabidopsis
					thaliana]
290	70222	0	97	15240523	(NM_124341) amino acid	DS	PP	HS
					permease 6 (emb|CAA65051.1)
					[Arabidopsis thaliana]
291	70464	1.00E−106	92	15233481	(NM_118221) putative protein	HS
					[Arabidopsis thaliana]
292	70474	1.00E−148	99	20127049	(AF488587) putative bHLH	HS
					transcription factor [Arabidopsis
					thaliana]
293	70484	0	93	18418491	(NM_119632) putative protein	CS	PP	HS
					[Arabidopsis thaliana]
294	72474	1.00E−129	81	14150732	(AF374475) hypersensitive-	PP	HS
					induced response protein [Oryza
					sativa]
295	13047	1.00E−170	86	15237573	(NM_123481) purine permease-	LL
					like protein [Arabidopsis thaliana]
					dbj|BAB09718.1| (AB010072)
					purine permease-like protein
					[Arabidopsis thaliana]
296	13304	0	92	15227905	(NM_127337) putative	LL
					senescence-associated protein
					12 [Arabidopsis thaliana]
297	13474	0	97	2318131	(AF014824) histone deacetylase	LL
					[Arabidopsis thaliana]
298	19252	3.00E−85	100	18397475	(NM_111486) putative dual-	PP	LL	SS	HS	CS
					specificity protein phosphatase
					[Arabidopsis thaliana]
299	12612	7.00E−84	67	18397426	(NM_111472) expressed protein	LL
					[Arabidopsis thaliana]
300	12926	2.00E−08	63	18407064	expressed protein [Arabidopsis	LL
					thaliana] gi|25408990|pir||
301	13230	3.00E−68	83	15233017	(NM_111160) unknown protein	LL
					[Arabidopsis thaliana]
302	14235	1.00E−142	82	18402650	(NM_103835) expressed protein	LL
					[Arabidopsis thaliana]
303	17305	0	100	15222179	(NM_100550) sugar kinase,	LL
					putative [Arabidopsis thaliana]
304	17470	1.00E−138	76	15219110	AAD17313.1| (AF123310) NAC	LL
					domain protein NAM [Arabidopsis
					thaliana]
305	17718	2.00E−91	91	15228362	(NM_114694) putative protein	LL
					[Arabidopsis thaliana]
306	17904	0	97	18399578	(NM_112070) expressed protein	LL
					[Arabidopsis thaliana]
307	18280	0	97	18398767	AAM66940.1| (AY088617)	DS	LL
					membrane-associated salt-
					inducible protein like [Arabidopsis
					thaliana]
308	18287	1.00E−148	100	15223439	(NM_100045)	LL
					polyphosphoinositide binding
					protein, putative [Arabidopsis
					thaliana]
309	18501	0	94	18418838	(NM_121863) putative protein	LL
					[Arabidopsis thaliana]
					gb|AAG35778.1|AF280057_1
					(AF280057) tonneau 2
					[Arabidopsis thaliana]
310	18877	1.00E−85	100	18408502	(NM_105311) calmodulin-related	LL
					protein [Arabidopsis thaliana]
311	19531	0	98	15241970	(NM_125674) 1-deoxy-D-xylulose	LL
					5-phosphate reductoisomerase
					(DXR) [Arabidopsis thaliana]
312	70405	0	85	18390592	(NM_100475) expressed protein	SS	LL
					[Arabidopsis thaliana]
313	72136	2.00E−37	66	123379	HMG1/2-like protein (SB11	LL
					protein) gi|99914|pir||S22309
					high mobility group protein HMG-
					1 - soybean
					gi|18645|emb|CAA41200.1|
					HMG-1 like protein gene [Glycine
					max]
314	72611	1.00E−102	82	6721504	(AP001072) hypothetical protein	LL
					[Oryza sativa (japonica cultivar-
					group)]
315	12627	0	100	15236663	(NM_118524) UDPglucose 4-	LN
					epimerase - like protein
					[Arabidopsis thaliana]
316	12813	0	96	2454184	(U80186) pyruvate	LN
					dehydrogenase E1 beta subunit
					[Arabidopsis thaliana]
317	14945	100E−122	92	18400517	(NM_112338) expressed protein	LN
					[Arabidopsis thaliana]
					dbj|BAB02642.1| (AP002061)
					MtN3-like protein
318	15345	0	97	15237392	(NM_123987) ornithine	LN
					aminotransferase [Arabidopsis
					thaliana]
319	15348	0	81	18414239	(NM_117530) expressed protein	LN
					[Arabidopsis thaliana]
320	16325	1.00E−105	100	15225174	(NM_128763) putative alanine	LN
					acetyl transferase [Arabidopsis
					thaliana] gb|AAD15401.1
321	16702	0	77	18408943	(NM_105480) expressed protein	LN
					[Arabidopsis thaliana]
					sp|Q9M647|IAR1_ARATH IAA-
					alanine resistance protein 1
322	16836	0	100	11692854	AF327534_1 (AF327534)	LN
					putative adenosine
					triphosphatase [Arabidopsis
					thaliana]
323	17002	1.00E−138	56	18414140	(NM_117486) Expressed protein	LN
					[Arabidopsis thaliana]
					gb|AAK68800.1| (AY042860)
					Unknown protein [Arabidopsis
					thaliana]
324	17012	3.00E−79	100	18398187	(NM_127222) actin	LN
					depolymerizing factor 5
					[Arabidopsis thaliana]
325	17017	1.00E−155	86	11358585	nuclear envelope membrane	LN
					protein-like - Arabidopsis thaliana
326	17344	3.00E−49	100	18424201	SKP1 family [Arabidopsis	PP	LN
					thaliana]
					gi|9759236|dbj|BAB09760.1|
					contains similarity to elongin
					C˜gene_id: MNC17.5
					[Arabidopsis thaliana]
					gi|15028385|gb|AAK76669.1|
					putative elongin protein]
327	17426	0	95	15238801	(NM_124151) farnesyl	LN
					diphosphate synthase precursor
					(gb|AAB49290.1) [Arabidopsis
					thaliana]
328	17655	1.00E−129	86	15227472	(NM_129758) putative C2H2-type	LN
					zinc finger protein [Arabidopsis
					thaliana]
329	17656	1.00E−135	74	15233081	(NM_115995) putative DNA-	LN
					binding protein [Arabidopsis
					thaliana]
330	17906	1.00E−129	100	18378887	(NM_100065) expressed protein	PP	LN
					[Arabidopsis thaliana]
331	18278	0	95	15220147	(NM_103617) Cyclin, putative	LN
					[Arabidopsis thaliana]
332	18822	0	92	15232759	(NM_111813) putative protein	LN
					kinase [Arabidopsis thaliana]
333	18881	0	100	18401029	(NM_112485) putative L-	LN
					asparaginase [Arabidopsis
					thaliana]
334	19213	2.00E−70	91	18408726	(NM_105394) expressed protein	LN
					[Arabidopsis thaliana]
335	19239	1.00E−59	100	15235876	DNA-directed RNA polymerase	LN
					subunit-related [Arabidopsis
					thaliana] gi|25313101|pir||A85078
336	19247	1.00E−81	53	9711883	(AP002524) hypothetical	LN
					protein˜similar to Drosophila
					melanogaster chromosome 3L,
					CG10171 gene product [Oryza
					sativa (japonica cultivar-group)]
337	19460	1.00E−146	80	15238816	(NM_121850) AP2-domain DNA-	LN
					binding protein-like [Arabidopsis
					thaliana]
338	19512	0	85	15237502	(NM_124046) bHLH protein-like	LN
					[Arabidopsis thaliana]
339	19533	0	99	18395911	(NM_102409) expressed protein	LN
					[Arabidopsis thaliana]
340	19603	0	87	18403383	(NM_113143) expressed protein	LN
					[Arabidopsis thaliana]
					dbj|BAB01784.1| (AB022215)
					hydroxyproline-rich glycoprotein
					[Arabidopsis thaliana]
341	72126	5.00E−78	53	12005328	(AF239956) unknown [Hevea	LN
					brasiliensis]
342	72437	8.00E−89	92	11994756	(AP001313) kinetechore (Skp1p-	LN
					like) protein-like [Arabidopsis
					thaliana]
343	72441	5.00E−95	84	15218602	(NM_100157) ribosomal protein	LN
					L19, putative [Arabidopsis
					thaliana]
344	72639	2.00E−73	91	18403896	(NM_104101) expressed protein	LN
					[Arabidopsis thaliana]
345	14825	0	93	15242814	(NM_120445) protein kinase-like	PEG
					protein [Arabidopsis thaliana]
346	17931	1.00E−136	68	15242003	(NM_125688) Dof zinc finger	PEG	CS
					protein-like [Arabidopsis
					thaliana]
347	18854	1.00E−164	79	18423918	(NM_125077) nucleosome	PEG	HS
					assembly protein [Arabidopsis
					thaliana]
348	12237	1.00E−21	76	18398176	expressed protein [Arabidopsis	PEG
					thaliana]
					gi|12322743|gb|AAG51367.1|AC012562—
					28
349	13414	2.00E−69	92	12324443	(AC012329) unknown protein;	PEG
					50647-51606 [Arabidopsis
					thaliana]
350	16160	1.00E−176	87	18415888	(NM_118352) putative protein	PEG
					[Arabidopsis thaliana]
351	16226	1.00E−138	96	9294682	(AP001305) contains similarity to	HS	PEG
					RNA polymerase transcriptional
					regulation
					mediator˜gene_id: MHC9.3
					[Arabidopsis thaliana]
352	16803	1.00E−146	90	18394201	(NM_101382) expressed protein	PEG
					[Arabidopsis thaliana]
					gb|AAD39643.1|AC007591_8
					(AC007591) Contains a
					PF|00175 Oxidoreductase
					FAD/NADH-binding domain.
353	18260	0	100	15219795	(NM_100349) putative K+	PEG
					channel, beta subunit
					[Arabidopsis thaliana]
354	18642	2.00E−68	71	15235819	(NM_118411) predicted protein	PP	PEG
					[Arabidopsis thaliana]
355	18721	3.00E−21	53	18408611	glycine-rich protein [Arabidopsis	PEG
					thaliana]
					gi|12597766|gb|AAG60079.1|AC013288—
					13
356	19254	0	96	18398480	(NM_111769) expressed protein	PEG
					[Arabidopsis thaliana]
357	70247	0	95	15238559	(NM_122954) glutamate-	CS	DS	HS	PP	PEG
					ammonia ligase (EC 6.3.1.2)
					precursor, chloroplast (clone
					lambdaAtgsl1) (pir||S18600)
					[Arabidopsis thaliana]
358	70650	1.00E−83	57	18399283	(NM_127582) expressed protein	PP	PEG
					[Arabidopsis thaliana]
359	12635	0	97	15231953	(NM_111700) putative non-	HS
					phototropic hypocotyl
					[Arabidopsis thaliana]
359	11787	0	97	15231953	(NM_111700) putative non-	PP
					phototropic hypocotyl
					[Arabidopsis thaliana]
360	13641	1.00E−42	87	15218189	dynein light chain-related	PP
					[Arabidopsis thaliana]
					gi|25405535|pir||E96562
361	14515	0	71	15128395	(AP003255) contains ESTs	PP
					AU100655(C11462), C26007(CC11462)
					˜similar to Arabidopsis
					thaliana chromosome 3,
					F24B22.150˜unknown protein
					[Oryza sativa (japonica cultivar-
					group)]
362	14920	0	100	4239819	(AB010875) PHR1 [Arabidopsis	PP
					thaliana]
363	15204	0	96	15230379	(NM_112829) putative tyrosine	PP
					phosphatase [Arabidopsis
					thaliana]
364	19058	0	96	18396298	(NM_102496) expressed protein	LN
					[Arabidopsis thaliana]
364	15216	0	96	18396298	(NM_102496) expressed protein	PP
					[Arabidopsis thaliana]
365	15330	5.00E−68	59	18400296	(NM_112272) expressed protein	PP
					[Arabidopsis thaliana]
366	19610	0	100	18409509	(NM_115079) expressed protein	PP	CS
					[Arabidopsis thaliana]
367	14338	0	100	15222967	(NM_103926) sterol delta7	PP	HS	CS
					reductase [Arabidopsis thaliana]
					sp
368	17809	0	100	15242240	(NM_124576) sorbitol	PP	HS
					dehydrogenase-like protein
					[Arabidopsis thaliana]
369	72471	3.00E−83	52	18395821	(NM_111011) expressed protein	DS	PP	HS
					[Arabidopsis thaliana]
370	16403	1.00E−176	73	15237042	(NM_117178) 98b like protein	PP	LL	LN
					[Arabidopsis thaliana] p
371	17737	0	86	15240924	(NM_122624) RING-H2 zinc	PP	LN
					finger protein-like [Arabidopsis
					thaliana]
372	18395	0	84	18401775	(NM_128415) putative AP2	SS	PP	LN
					domain transcription factor
					[Arabidopsis thaliana]
373	72772	0	100	15226228	(NM_128328) putative	HS	SP	PP	LN
					cytochrome P450 [Arabidopsis
					thaliana]
374	19441	0	85	9294477	(AB018114) RING finger protein-	PP	PEG
					like [Arabidopsis thaliana]
375	10486	1.00E−99	100	15237535	(NM_120465) Terminal flower1	PP
					(TFL1) [Arabidopsis thaliana]
376	11409	1.00E−133	100	68888	trichome differentiation protein	CS	LN	SS	PP
					GL1 - Arabidopsis thaliana
377	12104	1.00E−132	92	15230178	AF488577_1 (AF488577)	PP
					putative bHLH transcription factor
					[Arabidopsis thaliana]
378	12258	1.00E−22	59	21554390	arabinogalactan-protein	PP
					[Arabidopsis thaliana]
379	12909	0	100	18398696	(NM_111831) expressed protein	PP
					[Arabidopsis thaliana]
380	14310	0	96	15226784	(NM_129655) unknown protein	PP
					[Arabidopsis thaliana]
381	14317	0	100	18395560	(NM_126399) expressed protein	PP
					[Arabidopsis thaliana]
382	14709	0	91	15219676	(NM_100303) putative beta-	PP
					ketoacyl-CoA synthase
					[Arabidopsis thaliana] pir||T00951
					probable 3-oxoacyl-[acyl-carrier-
					protein] synthase (EC 2.3.1.41)
					F20D22.1
383	15123	0	97	15238451	(NM_120596) putative protein	PP
					[Arabidopsis thaliana]
384	16013	4.00E−91	85	15241799	(NM_125629) ripening-related	PP
					protein-like [Arabidopsis
					thaliana]
385	16185	0	95	18420375	(NM_120069) cysteine	PP
					proteinase RD19A [Arabidopsis
					thaliana]
386	16719	0	100	18401703	(NM_103632) expressed protein	PP
					[Arabidopsis thaliana]
387	17490	8.00E−93	92	18405248	(NM_104392) expressed protein	PP
					[Arabidopsis thaliana]
388	17905	8.00E−75	69	18404002	(NM_113306) PHD-finger protein,	PP
					putative [Arabidopsis thaliana]
389	18385	1.00E−117	100	15223626	(NM_104559) integral membrane	PP
					protein, putative [Arabidopsis
					thaliana]
390	18392	0	95	15227193	(NM_127194) putative	SS	PP
					homeodomain transcription factor
					[Arabidopsis thaliana]
392	18531	1.00E−142	100	15242792	(NM_125746) putative protein	PP
					[Arabidopsis thaliana]
393	18603	0	94	18415840	(NM_118332) alcohol	PP
					dehydrogenase like protein
					[Arabidopsis thaliana]
394	19530	0	96	15242217	(NM_122138) Ruv DNA-helicase-	PP
					like protein [Arabidopsis thaliana]
395	70202	0	61	15241293	(NM_121408) putative protein	HS	PP
					[Arabidopsis thaliana]
396	72009	0	91	6319543	(NC_001134) Amino acid	PP
					transport protein for valine,
					leucine, isoleucine, and tyrosine;
					Tat1p [Saccharomyces
					cerevisiae]
397	72119	3.00E−70	57	126078	LATE EMBRYOGENESIS	PP
					ABUNDANT PROTEIN D-34
					(LEA D-34)
398	10188	0	92	15228011	(NM_129846) putative	DS
					cytochrome P450 [Arabidopsis
					thaliana]
399	10404	1.00E−151	94	99713	homeotic protein agamous -	DS
					Arabidopsis thaliana
400	11333	1.00E−145	100	7207994	(AF083220) proliferating cellular	DS
					nuclear antigen [Arabidopsis
					thaliana]
401	11719	0	87	15240257	(NM_126126) cyclin D3-like	DS
					protein [Arabidopsis thaliana]
402	13663	1.00E−152	94	15227497	(NM_129769) unknown protein	DS
					[Arabidopsis thaliana]
403	13958	0	96	15222885	(NM_101226)	SP	DS
					aminoalcoholphosphotransferase
					[Arabidopsis thaliana]
404	15214	0	92	15223772	(NM_106341) Tub family protein,	DS
					putative [Arabidopsis thaliana]
405	10483	2.00E−86	100	15223944	(NM_100757) superoxidase	SP	DS
					dismutase [Arabidopsis thaliana]
406	11711	0	100	15234217	(NM_119505) 2-dehydro-3-	DS
					deoxyphosphoheptonate aldolase
					[Arabidopsis thaliana]
407	11909	1.00E−126	88	99735	L-ascorbate peroxidase (EC	DS
					1.11.1.11) precursor -
					Arabidopsis thaliana (fragment)
408	12216	0	100	15236949	(NM_118837) putative protein	DS
					[Arabidopsis thaliana]
409	12236	2.00E−55	100	15231278	pollen specific protein-related	DS
					[Arabidopsis thaliana]
410	12256	0	100	2317731	(AF013628) reversibly	DS
					glycosylated polypeptide-2
					[Arabidopsis thaliana]
411	12806	1.00E−157	86	15235640	(NM_119926) putative protein	DS
					[Arabidopsis thaliana]
412	12904	0	96	15239631	BAA97512.1| (AB026634) 3′(2′),	SP	DS
					5′-bisphosphate nucleotidase
					protein-like protein [Arabidopsis
					thaliana]
413	13212	4.00E−74	93	15236917	(AL161566) putative protein	DS
					[Arabidopsis thaliana]
414	13232	5.00E−30	60	15223263	expressed protein [Arabidopsis	DS
					thaliana] gi|7485996|pir||T00711
415	13912	9.00E−68	100	18406846	O64644|SP18_ARATH Probable	DS
					Sin3 associated polypeptide
					[Arabidopsis thaliana]
416	14327	0	92	15221444	(NM_102795) putative GTP-	DS
					binding protein [Arabidopsis
					thaliana]
417	14704	3.00E−71	46	17228240	(NC_003272) hypothetical protein	DS
					[Nostoc sp. PCC 7120]
418	14714	0	94	15219541	(NM_106032) ethylene-	DS
					insensitive3-like3 (EIL3)
					[Arabidopsis thaliana]
419	15142	0	74	15235217	(NM_118107) putative protein	SP	DS
					[Arabidopsis thaliana]
420	17450	1.00E−169	100	15232066	AAF26152.1|AC008261_9	DS
					(AC008261) putative homeobox-
					leucine zipper protein, HAT7
					[Arabidopsis thaliana]
421	18607	1.00E−151	94	15221373	(NM_105503) putative	DS
					transcription factor [Arabidopsis
					thaliana]
422	19409	0	73	15241667	(NM_120281) putative	DS
					homeodomain protein
					[Arabidopsis thaliana]
423	19412	0	96	15228826	(NM_116132) putative protein	DS
					[Arabidopsis thaliana]
424	13005	0	99	15239405	(NM_122447) cyclin 3a	SP	SS	PEG
					[Arabidopsis thaliana]
					gb|AAC98445.1| (AC006258)
					cyclin 3a [Arabidopsis thaliana]
425	10203	0	81	18405485	(NM_104444) expressed protein	SP
					[Arabidopsis thaliana]
426	11327	0	92	12643807	Protein farnesyltransferase alpha	SP
					subunit (CAAX
					farnesyltransferase alpha
					subunit) (RAS proteins
					prenyltransferase alpha) (FTase-
					alpha)[Arabidopsis thaliana]
427	12018	1.00E−175	96	18404664	(NM_129374) expressed protein	LL
					[Arabidopsis thaliana]
427	11814	1.00E−175	96	18404664	(NM_129374) expressed protein	SP
					[Arabidopsis thaliana]
428	13003	1.00E−169	85	18394319	(NM_101474) expressed protein	SP
					[Arabidopsis thaliana]
429	13949	1.00E−160	85	18399097	(NM_103124) expressed protein	SP
					[Arabidopsis thaliana]
430	16416	1.00E−161	94	15236283	(NM_116570) putative	SP
					chloroplast protein import
					component [Arabidopsis thaliana]
431	16438	1.00E−167	78	18403775	(AC004667) expressed protein	SP
					[Arabidopsis thaliana]
					gb|AAM62820.1| (AY085599)
					zinc finger protein Glo3-like
					[Arabidopsis thaliana]
432	17124	0	100	15221491	(NM_104934) similar to fiavin-	SP
					containing monooxygenase
					(sp|P36366); similar to ESTs
					gb|R30018, gb|H36886,
					gb|N37822, and gb|T88100
					[Arabidopsis thaliana]
433	19132	0	92	18396094	(NM_111084) expressed protein	SP
					[Arabidopsis thaliana]
434	17922	1.00E−134	83	7485939	AAC13593.1| (AF058914)	LL	SP	CS
					contains similarity to Arabidopsis
					thaliana DNA-damage-
					repair/tolerance resistance
					protein DRT111 (SW: P42698)
435	19719	1.00E−141	72	6692816	(AB036735) allyl alcohol	PEG	SP	HS
					dehydrogenase [Nicotiana
					tabacum]
436	14274	8.00E−90	100	18407428	(NM_130339) expressed protein	SP
					[Arabidopsis thaliana]
436	17336	8.00E−90	100	18407428	(NM_130339) expressed protein	SP	LL
					[Arabidopsis thaliana]
437	17735	1.00E−108	91	18404601	(NM_129353) expressed protein	SP	LL
					[Arabidopsis thaliana]
438	19249	5.00E−43	100	21553354	glycine-rich RNA binding protein	PP	SP	LN
					7 [Arabidopsis thaliana]
439	18513	0	96	15226492	(NM_130274) putative protein	SP	PP	SS
					kinase [Arabidopsis thaliana]
					pir||T02181 protein kinase
					homolog F14M4.11
440	11517	1.00E−153	85	18412044	(NM_106509) expressed protein	SP
					[Arabidopsis thaliana]
441	12363	0	100	15242458	(NM_123934) GDSL-motif	SP
					lipase/hydrolase-like protein
					[Arabidopsis thaliana]
442	12922	7.00E−81	100	18403216	(NM_128881) expressed protein	SP
					[Arabidopsis thaliana]
443	15360	1.00E−152	89	18398108	(NM_111674) expressed protein	SP
					[Arabidopsis thaliana]
444	16028	0	100	15232435	(NM_115274) peptide transport -	SP
					like protein [Arabidopsis thaliana]
445	16648	1.00E−134	100	15891409	NP_534027.1| (NC_003305) 3-	SP
					oxoacyl-(acyl-carrier-protein)
					reductase [Agrobacterium
					tumefaciens str. C58 (U.
					Washington)]
446	16705	0	95	15236458	(NM_116899) nodulin-like protein	SP
					[Arabidopsis thaliana]
447	16715	0	96	15238198	(NM_120537) putative protein	SP
					[Arabidopsis thaliana]
448	17316	1.00E−124	95	18378907	(NM_100079) expressed protein	SP
					[Arabidopsis thaliana]
449	17331	0	85	15220100	(NM_106680) putative sulfate	SP
					transporter [Arabidopsis thaliana]
450	17339	2.00E−79	100	15228208	(NM_114633) putative protein	SP
					[Arabidopsis thaliana]
451	17420	1.00E−124	94	15229782	(NM_114248) glutathione	SP
					transferase-like protein
					[Arabidopsis thaliana]
452	17446	1.00E−144	88	15230344	(NM_115620) AP2 transcription	SP
					factor - like protein [Arabidopsis
					thaliana]
453	17487	1.00E−71	78	15218649	(NM_102603) ethylene-	SP
					responsive element binding
					factor, putative [Arabidopsis
					thaliana]
454	17740	0	97	15232593	(NM_114527) scarecrow-like	SP
					protein [Arabidopsis thaliana]
455	17752	1.00E−176	94	9755372	(AC000107) F17F8.3	SP
					[Arabidopsis thaliana]
456	18021	0	96	7262677	(AC012188) Contains similarity to	SP
					MYB-Related Protein B from
					Gallus gallus g [Arabidopsis
					thaliana]
457	18245	1.00E−168	86	15239503	(NM_122484) GATA transcription	SP
					factor - like [Arabidopsis thaliana]
458	18617	3.00E−69	94	18424873	(NM_125879) expressed protein	SP
					[Arabidopsis thaliana]
459	18734	0	96	15237253	(NM_121609) UVB-resistance	SP
					protein-like [Arabidopsis thaliana]
460	18823	0	82	15222227	AAM62510.1| (AY085278)	SP
					homeodomain protein BELL1,
					putative [Arabidopsis thaliana]
461	19222	0	100	18390636	(NM_100509) expressed protein	PP	SP
					[Arabidopsis thaliana]
462	19430	0	95	18405149	(NM_129533) expressed protein	SP
					[Arabidopsis thaliana]
463	12332	1.00E−113	84	15221408	(NM_106142) myb-related	SS
					transcription activator, putative
					[Arabidopsis thaliana]
464	13649	1.00E−127	92	11281134	hypothetical protein F9G14.50 -	SS
					Arabidopsis thaliana
465	16113	0	97	15217485	AAD18098.1| (AC006416)	SS
					Identical to gb|Y10557 g5bf gene
					from Arabidopsis thaliana
					putative RNA-binding protein
					[Arabidopsis thaliana]
466	12069	1.00E−63	100	18410081	(NM_105902) expressed protein	SS
					[Arabidopsis thaliana]
467	12906	0	98	5915825	Cytochrome P450 71B2	SS
					dbj|BAA28537.1| (D78605)
					cytochrome P450
					monooxygenase [Arabidopsis
					thaliana]
468	13443	1.00E−111	100	18409105	(NM_114908) expressed protein	SS
					[Arabidopsis thaliana]
469	14707	0	96	13122288	(AB047808) proteasel (pfpl)-like	SS
					protein [Arabidopsis thaliana]
470	15116	1.00E−167	100	15242465	(NM_121002) inorganic	SS
					pyrophosphatase - like protein
					[Arabidopsis thaliana]
471	16117	1.00E−90	78	15227349	(NM_129704) calmodulin-like	SS
					protein [Arabidopsis thaliana]
472	16136	1.00E−115	92	15222919	(NM_101236) unknown protein	SS
					[Arabidopsis thaliana]
473	19077	8.00E−98	70	15221874	(NM_101737) hypothetical	HS	PP	SS
					protein [Arabidopsis thaliana]
474	19178	0	95	6321456	(NC_001139) gamma-	CK	HS	PEG	PP	SS
					aminobutyrate (GABA)
					transaminase (4-aminobutyrate
					aminotransferase); Uga1p
					[Saccharomyces cerevisiae]
475	70752	4.00E−46	100	15224299	trypsin inhibitor - related	SS
					[Arabidopsis thaliana]
					gi|3287862|sp|O22867|ITI5_ARATH
476	70753	4.00E−86	100	15231204	(NM_112176) DnaJ protein,	SS
					putative [Arabidopsis thaliana]
477	70809	6.00E−70	48	20503004	(AC098693) Hypothetical protein	LL	PP	SS
					[Oryza sativa (japonica cultivar-
					group)]
478	72091	1.00E−177	94	6322655	(NC_001143) Interacts with and	LL	LN	SS
					may be a positive regulator of
					GLC7 which encodes type1
					protein phosphatase; Sds22p
					[Saccharomyces cerevisiae]

Trait Improvement Screens

DS-Improvement of drought tolerance identified by soil drought stress tolerance screen: Drought or water deficit conditions impose mainly osmotic stress on plants. Plants are particularly vulnerable to drought during the flowering stage. The drought condition in the screening process disclosed in Example 1B started from the flowering time and was sustained to the end of harvesting. The present invention provides recombinant DNA that can improve the plant survival rate under such sustained drought condition. Exemplary recombinant RNA for conferring such drought tolerance are identified as such in Table 3. Such recombinant RNA may find particular use in generating transgenic plants that are tolerant to the drought condition imposed during flowering time and in other stages of the plant life cycle. As demonstrated from the model plant screen, in some embodiments of transgenic plants with trait-improving recombinant DNA grown under such sustained drought condition can also have increased total seed weight per plant in addition to the increased survival rate within a transgenic population, providing a higher yield potential as compared to control plants.

PEG-Improvement of drought tolerance identified by PEG induced osmotic stress tolerance screen: Various drought levels can be artificially induced by using various concentrations of polyethylene glycol (PEG) to produce different osmotic potentials (Pilon-Smits et a. (1995) Plant Physiol. 107:125-130). Several physiological characteristics have been reported as being reliable indications for selection of plants possessing drought tolerance. These characteristics include the rate of seed germination and seedling growth. The traits can be assayed relatively easily by measuring the growth rate of seedling in PEG solution. Thus, a PEG-induced osmotic stress tolerance screen is a useful surrogate for drought tolerance screen. As demonstrated from the model plant screen, embodiments of transgenic plants with trait-improving recombinant DNA identified in a PEG-induced osmotic stress tolerance screen can survive better drought conditions providing a higher yield potential as compared to control plants.

SS-Improvement of drought tolerance identified by high salinity stress tolerance screen: Three different factors are responsible for salt damages: (1) osmotic effects, (2) disturbances in the mineralization process, (3) toxic effects caused by the salt ions, e.g., inactivation of enzymes. While the first factor of salt stress results in the wilting of the plants that is similar to drought effect, the ionic aspect of salt stress is clearly distinct from drought. The present invention provides genes that help plants to maintain biomass, root growth, and/or plant development in high salinity conditions, which are identified as such in Table 3. Since osmotic effect is one of the major component of salt stress, which is common to the drought stress, trait-improving recombinant DNA identified in a high salinity stress tolerance screen can provide transgenic crops with improved drought tolerance.

HS-Improvement of Drought Tolerance Identified by Heat Stress Tolerance Screen: Heat and drought stress often occur simultaneously, limiting plant growth. Heat stress can cause the reduction in photosynthesis rate, inhibition of leaf growth and osmotic potential in plants. Thus, genes identified by the present invention as heat stress tolerance conferring genes may also impart improved drought tolerance to plants.

CK and CS-Improvement of tolerance to cold stress: Low temperature may immediately result in mechanical constraints, changes in activities of macromolecules, and reduced osmotic potential. In the present invention, two screening conditions, i.e., cold shock tolerance screen (CK) and cold germination tolerance screen (CS), were set up to look for transgenic plants that display visual growth advantage at lower temperature. In cold germination tolerance screen, the transgenic Arabidopsis plants were exposed to a constant temperature of 8° C. from planting until day 28 post planting. The recombinant nucleotides identified by such screen as cold stress tolerance conferring genes are particular useful for the production of transgenic plant that can germinate more robustly in a cold temperature as compared to the wild type plants. In cold shock tolerance screen, the transgenic plants were first grown under the normal growth temperature of 22° C. until day 8 post planting, and subsequently were placed under 8° C. until day 28 post planting. In some preferred embodiments, transgenic plants transformed with the recombinant DNA constructs comprising SEQ ID NO: 1 or SEQ ID NO: 2 display more robust growth in both cold tolerance screens.

Improvement of tolerance to multiple stresses: Different kinds of stresses often lead to identical or similar reaction in the plants. Genes that are activated or inactivated as a reaction to stress can either act directly in a way the genetic product reduces a specific stress, or they can act indirectly by activating other specific stress genes. By manipulating the activity of such regulatory genes, i.e., multiple stress tolerance genes, the plant can be enabled to react to different kinds of stresses. For examples, SEQ ID NO: 37, SEQ ID NO: 38 and SEQ ID NO: 128 can be used to improve both heat stress tolerance and cold stress tolerance in plants. Of particular interest, plants transformed with SEQ ID NO: 59 can resist heat stress, salt stress and cold stress. In addition to these multiple stress tolerance genes, the stress tolerance conferring genes provided by the present invention may be used in combinations to generate transgenic plants that can resist multiple stress conditions.

PP-Improvement of Early Plant Growth and Development.

It has been known in the art that to minimize the impact of disease on crop profitability, it is important to start the season with healthy vigorous plants. This means avoiding seed and seedling diseases, leading to increased nutrient uptake and increased yield potential. Traditionally early planting and applying fertilizer are the methods used for promoting early seedling vigor. In early development stage, plant embryos establish only the basic root-shoot axis, a cotyledon storage organ(s), and stem cell populations, called the root and shoot apical meristems, which continuously generate new organs throughout post-embryonic development. “Early growth and development” used herein encompasses the stages of seed imbibition through the early vegetative phase. The present invention provides genes that are useful to produce transgenic plants that have advantages in one or more processes including, but not limited to, germination, seedling vigor, root growth and root morphology under non-stressed conditions. The transgenic plants starting from a more robust seedling are less susceptible to the fungal and bacterial pathogens that attach germinating seeds and seedling. Furthermore, seedlings with advantage in root growth are more resistant to drought stress due to extensive and deeper root architecture. Therefore, the genes conferring the growth advantage in early stages to plants may also be used to generate transgenic plants that are more resistant to various stress conditions due to improved early plant development. The present invention provides such exemplary genes that confer both the stress tolerance and growth advantages to plants, identified as such in Table 3, e.g., SEQ ID NO: 128 which can improve the plant early growth and development and impart heat and cold tolerance to plants.

SP-Improvement of Late Plant Growth and Development

“Late growth and development” used herein encompasses the stages of leaf development, flower production, and seed maturity. In certain embodiments, transgenic plants produced using genes that confer growth advantages to plants provided by the present invention, identified as such in Table 3, exhibit at least one phenotypic characteristics including, but not limited to, increased rosette radius, increased rosette dry weight, seed dry weight, silique dry weight, and silique length. On one hand, the rosette radius and rosette dry weight are used as the indexes of photosynthesis capacity, and thereby plant source strength and yield potential of a plant. On the other hand, the seed dry weight, silique dry weight and silique length are used as the indexes for plant sink strength, which are considered as the direct determinants of yield.

LL-Improvement of Tolerance to Shade Stress

The effects of light on plant development are especially prominent at the seedling stage. Under normal light conditions with unobstructed direct light, a plant seeding develops according to a characteristic photomorphogenic pattern, in which plants have open and expanded cotyledons and short hypocotyls. Then the plant's energy is devoted to cotyledon and leaf development while longitudinal extension growth is minimized. Under low light condition where light quality and intensity are reduced by shading, obstruction or high population density, a seedling displays a shade-avoidance pattern, in which the seedling displays a reduced cotyledon expansion, and hypocotyls extension is greatly increased. As the result, a plant under low light condition increases significantly its stem length at the expanse of leaf, seed or fruit and storage organ development, thereby adversely affecting of yield. The present invention provides recombinant nucleotides that enable plants to have an attenuated shade avoidance response so that the source of plant can be contribute to reproductive growth efficiently, resulting higher yield as compared to the wild type plants. One skilled in the art can recognize that transgenic plants generated by the present invention may be suitable for a higher density planting, thereby resulting increased yield per unit area. In some preferred embodiments, the present invention provides transgenic plants that have attenuated low light response and advantage in the flower bud formation.

LN-Improvement of Tolerance to Low Nitrogen Availability Stress

Nitrogen is a key factor in plant growth and crop yield. The metabolism, growth and development of plants are profoundly affected by their nitrogen supply. Restricted nitrogen supply alters shoot to root ratio, root development, activity of enzymes of primary metabolism and the rate of senescence (death) of older leaves. All field crops have a fundamental dependence on inorganic nitrogenous fertilizer. Since fertilizer is rapidly depleted from most soil types, it must be supplied to growing crops two or three times during the growing season. Improved nitrogen use efficiency by plants should enable crops cultivated under low nitrogen availability stress condition resulted from low fertilizer input or poor soil quality.

According to the present invention, transgenic plants generated using the recombinant nucleotides, which confer improved nitrogen use efficiency, identified as such in Table 3, exhibit one or more desirable traits including, but not limited to, increased seedling weight, increased number of green leaves, increased number of rosette leaves, increased root length and advanced flower bud formation. One skilled in the art may recognize that the transgenic plants with improved nitrogen use efficiency, established by the present invention may also have altered amino acid or protein compositions, increased yield and/or better seed quality. The transgenic plants of the present invention may be productively cultivated under nitrogen nutrient deficient conditions, i.e., nitrogen-poor soils and low nitrogen fertilizer inputs that would cause the growth of wild type plants to cease or to be so diminished as to make the wild type plants practically useless. The transgenic plants also may be advantageously used to achieve earlier maturing, faster growing, and/or higher yielding crops and/or produce more nutritious foods and animal feedstocks when cultivated using nitrogen non-limiting growth conditions.

Stacked Traits

The present invention also encompasses transgenic plants with stacked engineered traits, e.g., a crop having an improved phenotype resulting from expression of a trait-improving recombinant DNA, in combination with herbicide and/or pest resistance traits. For example, genes of the current invention can be stacked with other traits of agronomic interest, such as a trait providing herbicide resistance, for example a RoundUp Ready trait, or insect resistance, such as using a gene from Bacillus thuringensis to provide resistance against lepidopteran, coliopteran, homopteran, hemiopteran, and other insects. Herbicides for which resistance is useful in a plant include glyphosate herbicides, phosphinothricin herbicides, oxynil herbicides, imidazolinone herbicides, dinitroaniline herbicides, pyridine herbicides, sulfonylurea herbicides, bialaphos herbicides, sulfonamide herbicides and gluphosinate herbicides. To illustrate that the production of transgenic plants with herbicide resistance is a capability of those of ordinary skill in the art, reference is made to U.S. patent application publications 2003/0106096A1 and 2002/0112260A1 and U.S. Pat. Nos. 5,034,322; 5,776,760, 6,107,549 and 6,376,754, all of which are incorporated herein by reference. To illustrate that the production of transgenic plants with pest resistance is a capability of those of ordinary skill in the art reference is made to U.S. Pat. Nos. 5,250,515 and 5,880,275 which disclose plants expressing an endotoxin of Bacillus thuringiensis bacteria, to U.S. Pat. No. 6,506,599 which discloses control of invertebrates which feed on transgenic plants which express dsRNA for suppressing a target gene in the invertebrate, to U.S. Pat. No. 5,986,175 which discloses the control of viral pests by transgenic plants which express viral replicase, and to U.S. Patent Application Publication 2003/0150017 A1 which discloses control of pests by a transgenic plant which express a dsRNA targeted to suppressing a gene in the pest, all of which are incorporated herein by reference.

Once one recombinant DNA has been identified as conferring an improved trait of interest in transgenic Arabidopsis plants, several methods are available for using the sequence of that recombinant DNA and knowledge about the protein it encodes to identify homologs of that sequence from the same plant or different plant species or other organisms, e.g., bacteria and yeast. Thus, in one aspect, the invention provides methods for identifying a homologous gene with a DNA sequence homologous to any of SEQ ID NO: 1 through SEQ ID NO: 151 and SEQ ID NO: 153 through SEQ ID NO: 239, or a homologous protein with an amino acid sequence homologous to any of SEQ ID NO: 240 through SEQ ID NO: 390 and SEQ ID NO: 392 through SEQ ID NO: 478. In another aspect, the present invention provides the protein sequences of identified homologs for a sequence listed as SEQ ID NO: 240 through SEQ ID NO: 390 and SEQ ID NO: 392 through SEQ ID NO: 478. In yet another aspect, the present invention also includes linking or associating one or more desired traits, or gene function with a homolog sequence provided herein.

The trait-improving recombinant DNA and methods of using such trait-improving recombinant DNA for generating transgenic plants with improved traits provided by the present invention are not limited to any particular plant species. Indeed, the plants according to the present invention may be of any plant species, i.e., may be monocotyledonous or dicotyledonous. Preferably, they will be agricultural useful plants, i.e., plants cultivated by man for purposes of food production or technical, particularly industrial applications. Of particular interest in the present invention are corn and soybean plants. The recombinant DNA constructs optimized for soybean transformation and corn transformation are provide by the present invention. Other plants of interest in the present invention for production of transgenic plants having improved traits include, without limitation, cotton, canola, wheat, sunflower, sorghum, alfalfa, barley, millet, rice, tobacco, fruit and vegetable crops, and turfgrass.

In certain embodiments, the present invention contemplates to use an orthologous gene in generating the transgenic plants with similarly improved traits as the transgenic Arabidopsis counterpart. Improved physiological properties in transgenic plants of the present invention may be confirmed in responses to stress conditions, for example in assays using imposed stress conditions to detect improved responses to drought stress, nitrogen deficiency, cold growing conditions, or alternatively, under naturally present stress conditions, for example under field conditions. Biomass measures may be made on greenhouse or field grown plants and may include such measurements as plant height, stem diameter, root and shoot dry weights, and, for corn plants, ear length and diameter.

Trait data on morphological changes may be collected by visual observation during the process of plant regeneration as well as in regenerated plants transferred to soil. Such trait data includes characteristics such as normal plants, bushy plants, taller plants, thicker stalks, narrow leaves, striped leaves, knotted phenotype, chlorosis, albino, anthocyanin production, or altered tassels, ears or roots. Other improved traits may be identified by measurements taken under field conditions, such as days to pollen shed, days to silking, leaf extension rate, chlorophyll content, leaf temperature, stand, seedling vigor, internode length, plant height, leaf number, leaf area, tillering, brace roots, stay green, stalk lodging, root lodging, plant health, bareness/prolificacy, green snap, and pest resistance. In addition, trait characteristics of harvested grain may be confirmed, including number of kernels per row on the ear, number of rows of kernels on the ear, kernel abortion, kernel weight, kernel size, kernel density and physical grain quality.

To confirm hybrid yield in transgenic corn plants expressing genes of the present invention, it may be desirable to test hybrids over multiple years at multiple locations in a geographical location where maize is conventionally grown, e.g., in Iowa, Ill. or other locations in the Midwestern United States, under “normal” field conditions as well as under stress conditions, e.g., under drought or population density stress.

Transgenic plants can be used to provide plant parts according to the invention for regeneration or tissue culture of cells or tissues containing the constructs described herein. Plant parts for these purposes can include leaves, stems, roots, flowers, tissues, epicotyl, meristems, hypocotyls, cotyledons, pollen, ovaries, cells and protoplasts, or any other portion of the plant which can be used to regenerate additional transgenic plants, cells, protoplasts or tissue culture. Seeds of transgenic plants are provided by this invention can be used to propagate more plants containing the trait-improving recombinant DNA constructs of this invention. These descendants are intended to be included in the scope of this invention if they contain a trait-improving recombinant DNA construct of this invention, whether or not these plants are selfed or crossed with different varieties of plants.

The various aspects of the invention are illustrated by means of the following examples which are in no way intended to limit the full breath and scope of claims.

EXAMPLES

Example 1

Identification of Recombinant DNA that Confers Improved Trait(s) to Plants

A. Expression Constructs for Arabidopsis Plant Transformation

Each gene of interest was amplified from a genomic or cDNA library using primer specific to sequences upstream and downstream of coding region. Transformation vectors were prepared to constitutively transcribe DNA in either sense orientation (for enhanced protein expression) or anti-sense orientation (for endogenous gene suppression) under the control of an enhanced Cauliflower Mosaic Virus 35S promoter (U.S. Pat. No. 5,359,142) directly or indirectly (Moore et al., PNAS 95:376-381, 1998; Guyer et al., Genetics 149: 633-639, 1998; International patent application NO. PCT/EP98/07577). The transformation vectors also contain a bar gene as a selectable marker for resistance to glufosinate herbicide. The transformation of Arabidopsis plants was carried out using the vacuum infiltration method known in the art (Bethtold et al., Methods Mol. Biol. 82:259-66, 1998). Seeds harvested from the plants, named as T1 seeds, were subsequently were grown in a glufosinate-containing selective medium to select for plants which were actually transformed and which produced T2 transgenic seed. For first pass screening T2 seeds from five independent transgenic lines of Arabidopsis were

B. Soil Drought Tolerance Screen

This example describes a soil drought tolerance screen to identify Arabidopsis plants transformed with recombinant DNA that wilt less rapidly and/or produce higher seed yield when grown in soil under drought conditions

T2 seeds were sown in flats filled with Metro/Mix® 200 (The Scotts® Company, USA). Humidity domes were added to each flat and flats were assigned locations and placed in climate-controlled growth chambers. Plants were grown under a temperature regime of 22° C. at day and 20° C. at night, with a photoperiod of 16 hours and average light intensity of 170 μmol/m²/s. After the first true leaves appeared, humidity domes were removed. The plants were sprayed with glufosinate herbicide and put back in the growth chamber for 3 additional days. Flats were watered for 1 hour the week following the herbicide treatment. Watering was continued every seven days until the flower bud primordia became apparent, at which time plants were watered for the last time.

To identify drought tolerant plants, plants were evaluated for wilting response and seed yield. Beginning ten days after the last watering, plants were examined daily until 4 plants/line had wilted. In the next six days, plants were monitored for wilting response. Five drought scores were assigned according to the visual inspection of the phenotypes: 1 for healthy, 2 for dark green, 3 for wilting, 4 severe wilting, and 5 for dead. A score of 3 or higher was considered as wilted.

At the end of this assay, seed yield measured as seed weight per plant under the drought condition was characterized for the transgenic plants and their controls and analyzed as a quantitative response according to example 1M. Two approaches were used for statistical analysis on the wilting response. First, the risk score was analyzed for wilting phenotype and treated as a qualitative response according to the example 1L. Alternatively, the survival analysis was carried out in which the proportions of wilted and non-wilted transgenic and control plants were compared over each of the six days under scoring and an overall log rank test was performed to compare the two survival curves using S-PLUS statistical software (S-PLUS 6, Guide to statistics, Insightful, Seattle, Wash., USA). Table 4 provides a list of recombinant DNA constructs that improve drought tolerance in transgenic plants.

	TABLE 4
	Survival Anaysis
	of wilt response
		Wilt Response	Seed	diff
Pep		Risk score	Weight/plant	time
SEQ	Construct—		RS	p-			p-		to	p-
ID	id	Orientation	mean	value	c	delta	value	c	wilting	value	c
241	74518	SENSE	−0.131	0.985	/	1.26	0	S	0	1	/
290	70222	SENSE	−0.032	0.726	/	0.461	0.001	S	−0.63	0.21	/
307	18280	SENSE	−0.066	0.937	/	0.402	0.004	S	0	1	/
357	70247	SENSE	0.11	0.169	T	0.336	0.006	S	−0.57	0.134	/
369	72471	SENSE	0.16	0.038	S	−0.053	0.546	/	0.16	0.226	/
398	10188	ANTI-SENSE	0.133	0.004	S	0.68	0	S	0.24	0.297	/
399	10404	ANTI-SENSE	0.13	0.068	T	0.2	0.271	/	0.57	0.083	T
400	11333	ANTI-SENSE	0.266	0.007	S	0.291	0.293	/	0.77	0.131	T
401	11719	ANTI-SENSE	0.56	0.006	S	−0.088	0.751	/	0	1	/
402	13663	ANTI-SENSE	0.123	0.024	S	−0.198	0.763	/	0.04	0.852	/
403	13958	ANTI-SENSE	0.526	0.001	S	0.518	0.08	T	0	1	/
404	15214	ANTI-SENSE	0.018	0.208	/	0.19	0.243	/	0.06	0.815	/
405	10483	SENSE	0.313	0.012	S	−0.095	0.795	/	0.28	0.358	/
406	11711	SENSE	0.346	0.005	S	0.218	0.009	S	0.3	0.371	/
407	11909	SENSE	0.094	0.021	S	0.002	0.493	/	0.26	0.767	/
408	12216	SENSE	0.623	0	S	−0.195	0.714	/	2.55	0.007	S
409	12236	SENSE	0.233	0.019	S	0.32	0.026	S	0.29	0.124	T
410	12256	SENSE	0.254	0.001	S	0.133	0.245	/	0.09	0.869	/
411	12806	SENSE	0.198	0.016	S	0.689	0.018	S	0.16	0.696	/
412	12904	SENSE	0.292	0.033	S	−1.195	0.992	/	0.81	0.023	S
413	13212	SENSE	0.24	0.006	S	0.676	0.01	S	0.25	0.559	/
414	13232	SENSE	0.166	0.134	T	−0.044	0.568	/	0.81	0.105	T
415	13912	SENSE	0.3	0	S	−0.084	0.74	/	0.91	0.054	T
416	14327	SENSE	0.181	0.008	S	−0.423	0.831	/	0.75	0.021	S
417	14704	SENSE	0.174	0.01	S	0.26	0.003	S	0.92	0.538	/
418	14714	SENSE	0.313	0.007	S	−0.283	0.987	/	0.3	0.702	/
419	15142	SENSE	0.28	0	S	−0.498	0.871	/	0.29	0.196	T
420	17450	SENSE	0.117	0.102	T	0.238	0.079	T	−0.05	0.834	/
421	18607	SENSE	0.161	0.013	S	−0.167	0.782	/	0.64	0.034	S
422	19409	SENSE	0.177	0.032	S	0.33	0.119	T	0.36	0.298	/
423	19412	SENSE	0.501	0.001	S	−0.006	0.515	/	0.15	0.84	/
S: represents that the transgenic plants showed statistically significant trait improvement as compared to the reference (p < 0.05, p value, of the delta of a quantitative response or of the risk score of a qualitative response, is the probability that the observed difference
# between the transgenic plants and the reference occur by chance)
T: represents that the transgenic plants showed a trend of trait improvement as compared to the reference, preferably with p < 0.2,
/: represents the transgenic plants didn't show any alteration or had unfavorable change in traits examined compared to the reference in the current dataset

C. Heat Stress Tolerance Screen

Under high temperatures, Arabidopsis seedlings become chlorotic and root growth is inhibited. This example sets forth the heat stress tolerance screen to identify Arabidopsis plants transformed with the gene of interest that are more resistant to heat stress based on primarily their seedling weight and root growth under high temperature. T2 seeds were plated on ½×MS salts, 1/% phytagel, with 10 μg/ml glufosinate (7 per plate with 2 control seeds; 9 seeds total per plate). Plates were placed at 4° C. for 3 days to stratify seeds. Plates were then incubated at room temperature for 3 hours and then held vertically for 11 additional days at temperature of 34° C. at day and 20° C. at night. Photoperiod was 16 h. Average light intensity was ˜140 μmol/m²/s. After 14 days of growth, plants were scored for glufosinate resistance, root length, final growth stage, visual color, and seedling fresh weight. A photograph of the whole plate was taken on day 14.

Visual assessment was carried out to evaluate the robustness of the growth based on the leave size and rosette size.

The seedling weight and root length were analyzed as quantitative responses according to example 1M. The final grow stage at day 14 was scored as success if 50% of the plants had reached 3 rosette leaves and size of leaves are greater than 1 mm (Boyes, et al., (2001) The Plant Cell 13, 1499-1510). The growth stage data was analyzed as a qualitative response according to example 1L. Table 5 provides a list of recombinant DNA constructs that improve heat tolerance in transgenic plants.

TABLE 5
Pep		seedling weight	Root Length	growth stage
SEQ	Construct—			p-			p-		RS	p-
ID	id	Orientation	delta	value	c	delta	value	c	mean	value	c
268	12007	ANTI-SENSE	1.283	0	S	0.221	0.018	S	0.844	0.044	S
269	12290	ANTI-SENSE	0.92	0.002	S	−0.09	0.683	/	0.4	0.14	T
270	12343	ANTI-SENSE	1.186	0	S	0.008	0.478	/	−0.066	0.818	/
271	14348	ANTI-SENSE	0.917	0	S	0.047	0.352	/	0.034	0.314	/
272	15708	ANTI-SENSE	1.12	0	S	0.122	0.092	T	0.467	0.016	S
273	17615	ANTI-SENSE	1.134	0	S	0.176	0.084	T	0.541	0.102	T
274	17622	ANTI-SENSE	0.728	0	S	−0.142	0.874	/	0.875	0.002	S
275	70714	ANTI-SENSE	1.029	0	S	0.032	0.355	/	−0.003	0.515	/
276	17925	SENSE	0.969	0	S	−0.027	0.588	/	0.22	0.215	/
277	18541	SENSE	0.977	0	S	−0.012	0.559	/	0.982	0.028	S
278	11425	SENSE	1.255	0	S	0.152	0.096	T	0.516	0.005	S
279	12263	SENSE	0.869	0.003	S	−0.023	0.552	/	0.481	0.113	T
280	12288	ANTI-SENSE	1.256	0	S	0.086	0.314	/	0.968	0.036	S
281	12910	SENSE	1.067	0.105	T	0.097	0.274	/	−0.417	1	/
282	14335	SENSE	1.107	0	S	0.16	0	S	−0.024	0.804	/
283	17427	SENSE	0.837	0	S	−0.069	0.706	/	0.569	0.087	T
284	19140	SENSE	0.894	0	S	0.111	0.131	T	1.794	0	S
285	19179	SENSE	1.039	0	S	−0.095	0.742	/	0.614	0.063	T
286	19251	SENSE	0.77	0	S	−0.061	0.771	/	0.543	0.027	S
287	19443	SENSE	1.115	0	S	0.042	0.369	/	0.537	0.078	T
288	19607	SENSE	0.939	0	S	0.024	0.381	/	0.095	0.215	/
289	19915	SENSE	1.336	0.057	T	0.19	0.299	/	0.07	0	S
290	70222	SENSE	0.778	0.004	S	−0.078	0.677	/	1.153	0.015	S
291	70464	SENSE	1.039	0	S	0.026	0.411	/	0.806	0.04	S
292	70474	SENSE	1.026	0	S	0.094	0.207	/	1.145	0.03	S
293	70484	SENSE	1.511	0	S	0.236	0.004	S	0.688	0.016	S
294	72474	SENSE	0.816	0	S	0.095	0.229	/	1.149	0.01	S
298	19252	SENSE	0.571	0.111	T	0.02	0.416	/	1.27	0.022	S
347	18854	SENSE	0.854	0	S	−0.14	0.896	/	0.595	0.148	T
351	16226	SENSE	1.372	0	S	0.244	0.009	S	0.112	0.017	S
357	70247	SENSE	1.146	0	S	0.124	0.114	T	0.953	0.029	S
359	12635	SENSE	0.702	0.109	T	0.587	0.001	S	0.637	0.06	T
367	14338	SENSE	0.888	0	S	0.036	0.326	/	0.17	0.077	T
368	17809	SENSE	0.838	0.002	S	0.033	0.308	/	0.619	0.04	S
369	72471	SENSE	1.051	0.001	S	0.067	0.227	/	1.531	0.005	S
373	72772	SENSE	1.364	0	S	0.299	0.002	S	0.648	0.045	S
395	70202	SENSE	1.159	0	S	−0.116	0.941	/	0.339	0.159	T
435	19719	SENSE	1.184	0	S	0.032	0.411	/	1.433	0.018	S
473	19077	SENSE	1.405	0	S	0.026	0.369	/	0.61	0.013	S
474	19178	SENSE	1.381	0	S	0.267	0.008	S	1.54	0.006	S
S: represents the transgenic plants showed statistically significant trait improvement as compared to the reference (p < 0.05)
T: represents the transgenic plants showed a trend of trait improvement as compared to the reference, preferably with p < 0.2
/: represents the transgenic plants didn't show any alteration or had unfavorable change in traits examined compared to the reference in the current dataset

D. Salt Stress Tolerance Screen

This example sets forth the high salinity stress screen to identify Arabidopsis plants transformed with the gene of interest that are tolerant to high levels of salt based on their rate of development, root growth and chlorophyll accumulation under high salt conditions.

T2 seeds were plated on glufosinate selection plates containing 90 mM NaCl and grown under standard light and temperature conditions. All seedlings used in the experiment were grown at a temperature of 22° C. at day and 20° C. at night, a 16-hour photoperiod, an average light intensity of approximately 120 mmol/m². On day 11, plants were measured for primary root length. After 3 more days of growth (day 14), plants were scored for transgenic status, primary root length, growth stage, visual color, and the seedlings were pooled for fresh weight measurement. A photograph of the whole plate was also taken on day 14.

Visual assessment was carried out to evaluate the robustness of the growth based on the leave size and rosette size.

The seedling weight and root length were analyzed as quantitative responses according to example 1M. The final growth stage at day 14 was scored as success if 50% of the plants reached 3 rosette leaves and size of leaves are greater than 1 mm (Boyes, D. C., et al., (2001), The Plant Cell 13, 1499/1510). The growth stage data was analyzed as a qualitative response according to example 1L.

TABLE 6
a list of recombinant nucleotides that improve high salinity tolerance in plants
		Seedling Weight	Root Length at	Root Length at
Pep		at day 14	day 11	day 14	Growth Stage
SEQ	Construct		p-			p-			p-		RS	p-
ID	id	delta	value	c	delta	value	c	delta	value	c	mean	vallue	c
243	17918	0.749	0.001	S	0.007	0.945	/	0.054	0.348	/	0.107	0.152	T
258	17819	0.713	0.026	S	0.281	0.09	T	0.29	0.01	S	1.565	0.025	S
285	19179	0.939	0	S	0.228	0.044	S	0.269	0.001	S	1.561	0.034	S
298	19252	0.831	0.003	S	0.327	0.016	S	0.334	0.001	S	1.5	0.028	S
312	70405	0.266	0.096	T	0.051	0.628	/	0.202	0.014	S	−0.201	0.766	/
372	18395	0.506	0.008	S	0.27	0.033	S	0.24	0.007	S	0.653	0.016	S
376	11409	0.834	0.004	S	0.305	0.007	S	0.329	0.001	S	0.712	0.073	T
390	18392	0.767	0	S	0.325	0.005	S	0.181	0.034	S	0.698	0.109	T
424	13005	0.787	0.003	S	0.228	0.021	S	0.161	0.12	T	1.079	0.013	S
439	18513	0.779	0.019	S	0.377	0.013	S	0.298	0.002	S	0.679	0.069	T
463	12332	0.292	0.604	/	0.204	0.22	/	0.057	0.829	/	0.538	0.188	T
464	13649	0.418	0.03	S	0.062	0.493	/	0.147	0.1	T	1.39	0.028	S
465	16113	0.108	0.305	/	0.168	0.221	/	0.138	0.076	T	1.09	0.068	T
466	12069	0.708	0.043	S	0.162	0.091	T	0.165	0.354	/	0.306	0.074	T
467	12906	0.764	0.05	T	0.185	0.039	S	0.175	0.01	S	1.212	0.009	S
468	13443	0.113	0.629	/	−0.061	0.542	/	−0.001	0.993	/	0.658	0.096	T
469	14707	0.388	0.159	T	0.088	0.452	/	−0.094	0.564	/	0.366	0.012	S
470	15116	0.576	0.02	S	0.362	0.01	S	0.221	0.063	T	1.414	0.027	S
471	16117	0.038	0.789	/	0.02	0.87	/	−0.003	0.98	/	0.599	0.224	/
472	16136	0.465	0.001	S	0.297	0	S	0.172	0.007	S	1.911	0.005	S
473	19077	0.525	0.02	S	0.23	0.006	S	0.214	0	S	0.299	0.116	T
474	19178	0.398	0.22	/	0.231	0.106	T	0.219	0.046	S	0.456	0.213	/
475	70752	0.273	0.379	/	0.122	0.387	/	0.096	0.417	/	−0.022	0.519	/
476	70753	0.21	0.459	/	−0.015	0.864	/	0.116	0.286	/	0.489	0.128	T
477	70809	0.802	0.007	S	0.233	0	S	0.348	0	S	2.24	0.009	S
478	72091	0.608	0.014	S	0.115	0.249	/	0.152	0.091	T	0.398	0.267	/
S: represents the transgenic plants showed statistically significant trait improvement as compared to the reference (p < 0.05)
T: represents the transgenic plants showed a trend of trait improvement as compared to the reference, preferably with p < 0.2
/: represents the transgenic plants didn't show any alteration or had unfavorable change in traits examined compared to the reference in the current dataset

E. Polyethylene Glycol (PEG) Induced Osmotic Stress Tolerance Screen

There are numerous factors, which can influence seed germination and subsequent seedling growth, one being the availability of water. Genes, which can directly affect the success rate of germination and early seedling growth, are potentially useful agronomic traits for improving the germination and growth of crop plants under drought stress. In this assay, PEG was used to induce osmotic stress on germinating transgenic lines of Arabidopsis thaliana seeds in order to screen for osmotically resistant seed lines.

T2 seeds were plated on glufosinate selection plates containing 3% PEG and grown under standard light and temperature conditions. Seeds were plated on each plate containing 3% PEG, ½×MS salts, 1% phytagel, and 10 μg/ml glufosinate. Plates were placed at 4° C. for 3 days to stratify seeds. On day 11, plants were measured for primary root length. After 3 more days of growth, i.e., at day 14, plants were scored for transgenic status, primary root length, growth stage, visual color, and the seedlings were pooled for fresh weight measurement. A photograph of the whole plate was taken on day 14. Visual assessment was carried out to evaluate the robustness of the growth based on the leave size and rosette size.

Seedling weight and root length were analyzed as quantitative responses according to example 1M. The final growth stage at day 14 was scored as success or failure based on whether the plants reached 3 rosette leaves and size of leaves are greater than 1 mm. The growth stage data was analyzed as a qualitative response according to example 1L.

TABLE 7
a list of recombinant nucleotides that improve osmotic stress tolerance in plants
		Seedling Weight at	Root Length at	Root Length at
Pep		day14	day 11	day14	Growth Stage
SEQ			p-			p-			p-		RS	p-
ID	Construct	delta	value	c	delta	value	c	delta	value	c	mean	value	c
241	74518	0.53	0.018	S	0.217	0.024	S	0.51	0.001	S	4	0	S
345	14825	0.414	0.181	T	0.271	0.053	T	0.102	0.34	/	2.105	0.01	S
346	17931	0.295	0.425	/	0.124	0.574	/	0.116	0.454	/	2.069	0.085	T
347	18854	0.484	0.015	S	0.342	0.011	S	0.159	0.073	T	1.023	0.238	/
348	12237	0.371	0.165	T	0.325	0.001	S	0.297	0.003	S	2.191	0.017	S
349	13414	0.137	0.311	/	0.241	0.069	T	0.265	0.045	S	2.461	0.027	S
350	16160	0.303	0.044	S	0.242	0.035	S	0.077	0.512	/	3.381	0.001	S
351	16226	0.367	0.047	S	0.132	0.224	/	0.097	0.276	/	4	0	S
352	16803	0.382	0.036	S	0.125	0.489	/	0.224	0.023	S	4	0	S
353	18260	0.183	0.315	/	0.125	0.315	/	0.146	0.143	T	3.362	0.002	S
354	18642	0.076	0.674	/	0.199	0.09	T	0.199	0.029	S	3.056	0.002	S
355	18721	0.336	0.104	T	0.177	0.145	T	0.109	0.228	/	2.281	0.02	S
356	19254	0.334	0.242	/	0.155	0.227	/	0.153	0.183	T	0.905	0.129	T
357	70247	0.45	0.138	T	0.334	0.008	S	0.169	0.07	T	2.692	0.013	S
358	70650	0.215	0.121	T	0.105	0.114	T	0.092	0.255	/	2.749	0.011	S
374	19441	0.413	0.017	S	0.256	0.003	S	0.098	0.085	T	2.324	0.04	S
424	13005	0.685	0.008	S	0.395	0.002	S	0.226	0.013	S	3.787	0	S
435	19719	0.306	0.04	S	0.135	0.051	T	−0.028	0.426	/	−0.338	0.598	/
474	19178	0.515	0.02	S	0.21	0.059	T	0.169	0.08	T	3.53	0	S
S: represents the transgenic plants showed statistically significant trait improvement as compared to the reference (p < 0.05)
T: represents the transgenic plants showed a trend of trait improvement compared to the reference, preferably with p < 0.2
/: represents the transgenic plants didn't show any alteration or had unfavorable change in traits examined compared to the reference in the current dataset

F. Cold Shock Tolerance Screen

This example set forth a screen to identify Arabidopsis plants transformed with the genes of interest that are more tolerant to cold stress subjected during day 8 to day 28 after seed planting. During these crucial early stages, seedling growth and leaf area increase were measured to assess tolerance when Arabidopsis seedlings were exposed to low temperatures. Using this screen, genetic alterations can be found that enable plants to germinate and grow better than wild type plants under sudden exposure to low temperatures.

T2 seeds were tested. Eleven seedlings from each line plus one control line were plated together on a plate containing ½× Gamborg Salts with 0.8 Phytagel™, 1% Phytagel, and 0.3% Sucrose. Plates were then oriented horizontally and stratified for three days at 4° C. At day three, plates were removed from stratification and exposed to standard conditions (16 hr photoperiod, 22° C. at day and 20° C. at night) until day 8. At day eight, plates were removed from standard conditions and exposed to cold shock conditions (24 hr photoperiod, 8° C. at both day and night) until the final day of the assay, i.e., day 28. Rosette areas were measured at day 8 and day 28, which were analyzed as quantitative responses according to example 1M.

TABLE 8
a list of recombinant nucleotides that improve cold shock stress tolerance in plants
				difference in
				rosette area
		rosette area at	rosette area at	between day 28
Pep		day 8	day 28	and day 8
SEQ				p-			p-			p-
ID	Construct_id	Orientation	delta	value	c	delta	value	c	delta	value	c
240	19867	SENSE	−0.032	0.603	/	0.15	0.309	/	0.426	0.064	T
241	74518	SENSE	0.184	0.192	T	0.653	0.001	S	0.796	0	S
242	15816	SENSE	0.366	0.027	S	0.592	0.002	S	0.666	0.004	S
243	17918	SENSE	0.594	0	S	0.982	0	S	1.325	0	S
276	17925	SENSE	0.479	0.001	S	0.693	0	S	0.872	0	S
474	19178	SENSE	0.23	0.083	T	0.435	0.026	S	0.435	0.103	T
S: represents the transgenic plants showed statistically significant trait improvement as compared to the reference (p < 0.05)
T: represents the transgenic plants showed a trend of trait improvement compared to the reference, preferably with p < 0.2
/: represents the transgenic plants didn't show any alteration or had unfavorable change in traits examined compared to the reference in the current dataset.

G. Cold Germination Tolerance Screen

This example sets forth a screen to identify Arabidopsis plants transformed with the genes of interests are resistant to cold stress based on their rate of development, root growth and chlorophyll accumulation under low temperature conditions.

T2 seeds were plated and all seedlings used in the experiment were grown at 8° C. Seeds were first surface disinfested using chlorine gas and then seeded on assay plates containing an aqueous solution of ½× Gamborg's B/5 Basal Salt Mixture (Sigma/Aldrich Corp., St. Louis, Mo., USA G/5788), 1% Phytagel™ (Sigma-Aldrich, P-8169), and 10 ug/ml BASTA™ (Bayer Crop Science, Frankfort, Germany), with the final pH adjusted to 5.8 using KOH. Test plates were held vertically for 28 days at a constant temperature of 8° C., a photoperiod of 16 hr, and average light intensity of approximately 100 mmol/m²/s. At 28 days post planting, root length was measured, growth stage was observed, the visual color was assessed, and a whole plate photograph was taken.

Visual assessment was carried out to evaluate the robustness of the growth based on the leave size and rosette size.

The root length at day 28 was analyzed as a quantitative response according to example 1M. The growth stage at day 7 was analyzed as a qualitative response according to example 1L.

TABLE 9
a list of recombinant nucleotides that improve cold stress tolerance
in plants
		Root Length	Growth Stage
Pep		at day 28	at day 28
SEQ	Construct—	Orien-		p-		RS	p-
ID	id	tation	delta	value	c	mean	value	c
240	19867	SENSE	0.071	0.292	/	1.954	0.103	T
241	74518	SENSE	0.278	0.031	S	4	0	S
244	15306	ANTI-	0.176	0.142	T	1.582	0.067	T
		SENSE
245	12038	SENSE	0.045	0.188	T	2.271	0.022	S
246	12046	SENSE	0.177	0.125	T	3.513	0	S
247	13432	SENSE	0.182	0.015	S	1.108	0.078	T
248	13711	SENSE	0.15	0.022	S	2.357	0.012	S
249	14809	SENSE	−0.034	0.631	/	1.95	0.047	S
250	14951	SENSE	0.237	0.053	T	3.387	0.001	S
251	15632	SENSE	0.003	0.481	/	0.49	0.275	/
252	16147	SENSE	0.176	0.016	S	3.284	0.003	S
253	16158	SENSE	0.084	0.235	/	1.432	0.138	T
254	16170	SENSE	0.066	0.354	/	1.995	0.088	T
255	16171	SENSE	−0.178	0.842	/	−0.671	0.732	/
256	16175	SENSE	−0.054	0.7	/	1.231	0.184	T
257	17430	SENSE	0.254	0.135	T	2.776	0.009	S
258	17819	SENSE	0.221	0.028	S	−0.475	0.922	/
259	17921	SENSE	−0.151	0.912	/	1.291	0.179	T
260	17928	SENSE	0.368	0.028	S	2.599	0.003	S
261	18637	SENSE	0.158	0.225	/	1.143	0.164	T
262	18816	SENSE	0.206	0.075	T	3.038	0.002	S
263	19227	SENSE	0.198	0.058	T	3.068	0.002	S
264	19429	SENSE	0.258	0.062	T	2.582	0.006	S
265	70235	SENSE	0.175	0.065	T	2.584	0.006	S
266	72634	SENSE	0.169	0.064	T	2.835	0.001	S
267	72752	SENSE	0.292	0.019	S	2.816	0.002	S
273	17615	ANTI-	0.317	0.006	S	2.239	0.022	S
		SENSE
277	18541	SENSE	0.321	0.072	T	2.631	0.014	S
293	70484	SENSE	0.2	0.018	S	2.61	0.016	S
298	19252	SENSE	0.391	0.002	S	1.041	0.084	T
346	17931	SENSE	0.096	0.059	T	1.213	0.142	T
357	70247	SENSE	0.299	0.006	S	2.607	0.005	S
366	19610	SENSE	0.33	0.079	T	4	0	S
367	14338	SENSE	0.223	0.071	T	1.125	0.087	T
376	11409	SENSE	0.193	0	S	1.831	0.024	S
434	17922	SENSE	0.238	0.029	S	3.109	0.002	S
S: represents the transgenic plants showed statistically significant trait improvement as compared to the reference (p < 0.05)
T: represents the transgenic plants showed a trend of trait improvement as compared to the reference, preferably with p < 0.2
/: represents the transgenic plants didn't show any alteration or had unfavorable change in traits examined compared to the reference in the current dataset

H. Shade Tolerance-Low Light Screen

Plants undergo a characteristic morphological response in shade that includes the elongation of the petiole, a change in the leaf angle, and a reduction in chlorophyll content. While these changes may confer a competitive advantage to individuals, in a monoculture the shade avoidance response is thought to reduce the overall biomass of the population. Thus, genetic alterations that prevent the shade avoidance response may be associated with higher yields. Genes that favor growth under low light conditions may also promote yield, as inadequate light levels frequently limit yield. This protocol describes a screen to look for Arabidopsis plants that show an attenuated shade avoidance response and/or grow better than control plants under low light intensity. Of particular interest, we were looking for plants that didn't extend their petiole length, had an increase in seedling weight relative to the reference and had leaves that were more close to parallel with the plate surface.

T2 seeds were plated on glufosinate selection plates with ½MS medium. Seeds were sown on ½×MS salts, 1% Phytagel, 10 ug/ml BASTA. Plants were grown on vertical plates at a temperature of 22° C. at day, 20° C. at night and under low light (approximately 30 uE/m²/s, far/red ratio (655/665/725/735) ˜0.35 using PLAQ lights with GAM color filter #680). Twenty-three days after seedlings were sown, measurements were recorded including seedling status, number of rosette leaves, status of flower bud, petiole leaf angle, petiole length, and pooled fresh weights. A digital image of the whole plate was taken on the measurement day. Seedling weight and petiole length were analyzed as quantitative responses according to example 1M. The number of rosette leaves, flowering bud formation and leaf angel were analyzed as qualitative responses according to example 1L.

TABLE 10
a list of recombinant nucleotides that improve shade tolerance in plants
		flowerbud			Number of
		formation	leaf angle	petiole length	rosette leaves	seedling weight
Pep		at day 23	atday 23	at day 23	at day 23	at day 23
SEQ	Construct—	RS	p-		RS	p-			p-		RS	p-			p-
ID	id	mean	value	c	mean	value	c	delta	value	c	mean	value	c	delta	value	c
262	18816	3.007	0.003	S	0.738	0.003	S	0.046	0.561	/	−0.383	0.929	/	0.171	0.011	S
282	14335	1.81	0.029	S	0.404	0.032	S	0.204	0.301	/	−0.043	0.814	/	0.39	0.093	T
295	13047	2.261	0.006	S	0.482	0.106	T	−0.097	0.31	/	1.655	0.088	T	0.463	0.022	S
296	13304	−0.118	0.643	/	−0.164	0.861	/	−0.228	0.106	T	1.214	0.068	T	0.244	0.421	/
297	13474	−0.319	0.583	/	0.419	0.062	T	−0.051	0.153	T	0.633	0.032	S	0.223	0.002	S
298	19252	−2	0.962	/	0.239	0.257	/	0.099	0.242	/	1.153	0.056	T	0.497	0	S
299	12612	−0.627	0.975	/	−0.094	0.766	/	−0.037	0.341	/	0.61	0.092	T	−0.304	0.298	/
300	12926	0.827	0.15	T	−0.278	1	/	−0.02	0.51	/	0.489	0.218	/	−0.374	0.279	/
301	13230	−0.228	0.954	/	−0.05	0.668	/	0.057	0.33	/	1.83	0.025	S	0.33	0.124	T
302	14235	−0.511	1	/	0.084	0.271	/	−0.324	0.045	S	−0.205	0.848	/	−0.536	0.016	/
303	17305	0.056	0.374	/	0.036	0.226	/	−0.055	0.59	/	0.788	0.143	T	−0.058	0.761	/
304	17470	0.319	0.344	/	0.231	0.112	T	−0.218	0.24	/	1.314	0.052	T	0.094	0.612	/
305	17718	−1.438	0.985	/	0.005	0.486	/	−0.148	0.016	S	1.793	0.027	S	0.033	0.728	/
306	17904	0.965	0.105	T	0.252	0.071	T	−0.15	0.359	/	1.01	0.027	S	−0.022	0.844	/
307	18280	−0.176	0.626	/	0.284	0.258	/	−0.056	0.547	/	1.35	0.037	S	0.269	0.086	T
308	18287	−2.441	0.941	/	0.078	0.348	/	−0.022	0.785	/	1.193	0.05	T	0.292	0.056	T
309	18501	−0.087	1	/	−0.326	1	/	−0.254	0.05	T	0.23	0.438	/	−0.303	0.789	/
310	18877	0.181	0.414	/	0.016	0.41	/	−0.119	0.372	/	0.351	0.212	/	0.076	0.604	/
311	19531	4	0	S	0.04	0.379	/	−0.142	0.344	/	−0.253	0.809	/	0.001	0.998	/
312	70405	−0.931	0.991	/	−0.114	0.957	/	−0.186	0.038	S	0.674	0.188	T	0.13	0.177	T
313	72136	−1.001	1	/	1.063	0.08	T	−0.621	0.008	S	0.775	0.014	S	−1.081	0.018	/
314	72611	−0.476	0.834	/	0.868	0.121	T	−0.262	0.102	T	1.728	0.044	S	−0.365	0.23	/
370	16403	2.223	0.01	S	0.132	0.144	T	−0.157	0.484	/	−1.052	0.999	/	0.148	0.766	/
427	12018	1.283	0.059	T	0.309	0.254	/	−0.006	0.959	/	0.663	0.14	T	−0.643	0.017	/
434	17922	1.171	0.136	T	−0.046	0.58	/	0.057	0.624	/	−0.042	0.614	/	0.317	0.056	T
436	17336	−0.987	1	/	−0.297	1	/	−0.11	0.079	T	1.082	0.074	T	−0.121	0.636	/
437	17735	−3.705	1	/	−0.016	0.524	/	−0.135	0.084	T	0.882	0.022	S	0.014	0.9	/
477	70809	−1.333	0.913	/	0.184	0.173	T	0.102	0.256	/	0.236	0.148	T	0.449	0.046	S
478	72091	1.908	0.006	S	0.009	0.422	/	0.251	0.004	/	−0.056	1	/	0.413	0.083	T
S: represents the transgenic plants showed statistically significant trait improvement as compared to the reference (p < 0.05)
T: represents the transgenic plants showed a trend of trait improvement as compared to the reference, preferably with p < 0.2
/: represents the transgenic plants didn't show any alteration or had unfavorable change in traits examined compared to the reference in the current dataset.

I. Early Plant Growth and Development Screen

This example sets forth a plate based phenotypic analysis platform for the rapid detection of phenotypes that are evident during the first two weeks of growth. In this screen, we were looking for genes that confer advantages in the processes of germination, seedling vigor, root growth and root morphology under non-stressed growth conditions to plants. The transgenic plants with advantages in seedling growth and development were determined by the seedling weight and root length at day 14 after seed planting.

T2 seeds were plated on glufosinate selection plates and grown under standard conditions (˜100 uE/m²/s, 16 h photoperiod, 22° C. at day, 20° C. at night). Seeds were stratified for 3 days at 4° C. Seedlings were grown vertically (at a temperature of 22° C. at day 20° C. at night). Observations were taken on day 10 and day 14. Both seedling weight and root length at day 14 were analyzed as quantitative responses according to example 1M.

TABLE 11
a list recombinant nucleotides that improve early plant growth and
development
		Root Length	Seedling Weight
Pep		at day14	at day14
SEQ	Construct—	Orien-		p-			p-
ID	id	tation	delta	value	c	delta	value	c
241	74518	SENSE	0.216	0.01	S	0.454	0.049	S
245	12038	SENSE	0.101	0.046	S	0.629	0.003	S
250	14951	SENSE	0.15	0.072	T	0.138	0.378	/
260	17928	SENSE	0.062	0.22	/	0.246	0.069	T
265	70235	SENSE	0.079	0.519	/	0.414	0.026	S
267	72752	SENSE	0.301	0.001	S	0.789	0.002	S
285	19179	SENSE	0.216	0.024	S	0.603	0.01	S
290	70222	SENSE	0.047	0.468	/	0.394	0.014	S
293	70484	SENSE	0.068	0.364	/	0.444	0.024	S
294	72474	SENSE	0.241	0.051	T	0.183	0.564	/
298	19252	SENSE	0.065	0.392	/	0.316	0.054	T
326	17344	SENSE	0.042	0.565	/	0.223	0.066	T
330	17906	SENSE	0.11	0.152	T	0.419	0.011	S
354	18642	SENSE	0.1	0.247	/	0.257	0.043	S
357	70247	SENSE	−0.04	0.842	/	0.237	0.134	T
358	70650	SENSE	0.121	0.077	T	0.135	0.442	/
359	11787	ANTI-	−0.083	0.784	/	0.167	0.365	/
		SENSE
360	13641	ANTI-	0.092	0.15	T	0.336	0.053	T
		SENSE
361	14515	ANTI-	0.051	0.616	/	0.351	0.038	S
		SENSE
362	14920	ANTI-	0.08	0.358	/	0.101	0.739	/
		SENSE
363	15204	ANTI-	0.203	0.015	S	0.076	0.811	/
		SENSE
364	15216	ANTI-	0.316	0.023	S	0.632	0.073	T
		SENSE
365	15330	ANTI-	0.084	0.428	/	0.435	0.002	S
		SENSE
366	19610	SENSE	0.192	0.011	S	0.523	0.008	S
367	14338	SENSE	0.145	0.155	T	0.589	0.072	T
368	17809	SENSE	0.014	0.928	/	−0.121	0.753	/
369	72471	SENSE	0.07	0.023	S	0.407	0.048	S
370	16403	SENSE	0.199	0.027	S	0.6	0.003	S
371	17737	SENSE	0.049	0.472	/	0.242	0.073	T
372	18395	SENSE	0.219	0.001	S	0.58	0.002	S
373	72772	SENSE	0.224	0.023	S	0.442	0.106	T
374	19441	SENSE	0.271	0	S	0.482	0.019	S
375	10486	SENSE	0.191	0.03	S	0.343	0.052	T
376	11409	SENSE	0.258	0.034	S	0.468	0.006	S
377	12104	SENSE	0.1	0.379	/	0.489	0.009	S
378	12258	SENSE	0.16	0.05	T	0.392	0.137	T
379	12909	SENSE	0.139	0.267	/	0.322	0.261	/
380	14310	SENSE	0.544	0	S	0.764	0.026	S
381	14317	SENSE	0.134	0.18	T	0.117	0.64	/
382	14709	SENSE	0.206	0.009	S	0.389	0.117	T
383	15123	SENSE	0.026	0.872	/	0.27	0.348	/
384	16013	SENSE	0.046	0.622	/	0.464	0.01	S
385	16185	SENSE	0.191	0.045	S	0.145	0.596	/
386	16719	SENSE	0.019	0.872	/	0.424	0.088	T
387	17490	SENSE	0.186	0.026	S	0.272	0.102	T
388	17905	SENSE	0.239	0.004	S	0.346	0.196	T
389	18385	SENSE	0.287	0.003	S	0.687	0.003	S
390	18392	SENSE	0.088	0.338	/	0.504	0.012	S
392	18531	SENSE	0.313	0.015	S	0.627	0	S
393	18603	SENSE	0.212	0	S	0.165	0.187	T
394	19530	SENSE	0.106	0.137	T	0.342	0.025	S
395	70202	SENSE	0.218	0.056	T	0.279	0.223	/
396	72009	SENSE	0.191	0.054	T	0.328	0.043	S
397	72119	SENSE	0.236	0	S	0.259	0.008	S
438	19249	SENSE	0.054	0.375	/	0.222	0.048	S
439	18513	SENSE	0.204	0.044	S	0.193	0.322	/
461	19222	SENSE	0.255	0.072	T	0.622	0.034	S
473	19077	SENSE	−0.049	0.669	/	0.2	0.227	/
474	19178	SENSE	0.303	0	S	0.592	0.001	S
477	70809	SENSE	0.128	0.093	T	0.224	0.185	T
For other responses:
S: represents the transgenic plants showed statistically significant trait improvement as compared to the reference (p < 0.05)
T: represents the transgenic plants showed a trend of trait improvement as compared to the reference, preferably with p < 0.2
/: represents the transgenic plants didn't show any alteration or had unfavorable change in traits examined compared to the reference in the current dataset

J. Late Plant Growth and Development Screen

This example sets forth a soil based phenotypic platform to identify genes that confer advantages in the processes of leaf development, flowering production and seed maturity to plants.

Arabidopsis plants were grown on a commercial potting mixture (Metro Mix 360, Scotts Co., Marysville, Ohio) consisting of 30-40% medium grade horticultural vermiculite, 35-55% sphagnum peat moss, 10-20% processed bark ash, 1-15% pine bark and a starter nutrient charge. Soil was supplemented with Osmocote time-release fertilizer at a rate of 30 mg/ft³. T2 seeds were imbibed in 1% agarose solution for 3 days at 4° C. and then sown at a density of ˜5 per 2½ pot. Thirty-two pots were ordered in a 4 by 8 grid in standard greenhouse flat. Plants were grown in environmentally controlled rooms under a 16 h day length with an average light intensity of ˜200 μmoles/m²/s. Day and night temperature set points were 22° C. and 20° C., respectively. Humidity was maintained at 65%. Plants were watered by sub-irrigation every two days on average until mid-flowering, at which point the plants were watered daily until flowering was complete.

Application of the herbicide glufosinate was performed to select T2 individuals containing the target transgene. A single application of glufosinate was applied when the first true leaves were visible. Each pot was thinned to leave a single glufosinate-resistant seedling ˜3 days after the selection was applied.

The rosette radius was measured at day 25. The silique length was measured at day 40. The plant parts were harvested at day 49 for dry weight measurements if flowering production was stopped. Otherwise, the dry weights of rosette and silique were carried out at day 53. The seeds were harvested at day 58. All measurements were analyzed as quantitative responses according to example 1M.

TABLE 12
a list of recombinant nucleotides that improve late plant growth and development
		Rosette Dry	Rosette	Seed Dry	Silique Dry	Silique
Pep		Weight	Radius	Weight	Weight	Length
SEQ	construct—		p-			p-			p-			p-			p-
ID	id	delta	value	c	delta	value	c	delta	value	c	delta	value	c	delta	value	c
289	19915	0.234	0.027	S	0.2	0.002	S	0.214	0.142	T	0.165	0.138	T	−0.172	0.863	/
373	72772	0.194	0.291	/	0.022	0.068	T	0.259	0.003	S	0.102	0.343	/	−0.223	0.889	/
403	13958	−0.065	0.797	/	−0.279	0.863	/	0.146	0.041	S	0.092	0.177	T	0.009	0.158	T
405	10483	−0.073	0.946	/	0.302	0.002	S	0.288	0.022	T	0.592	0	S	0.137	0	S
412	12904	0.048	0.131	T	0.149	0.003	S	0.349	0.002	S	0.061	0.066	T	−0.045	0.961	/
419	15142	−0.211	0.945	/	0.074	0.076	T	0.284	0.002	S	−0.088	0.984	/	0.014	0.374	/
424	13005	−0.175	0.954	/	0.091	0.014	S	0.629	0.013	S	0.169	0.106	T	−0.031	0.627	/
425	10203	0.2	0.036	S	−0.023	0.587	/	−0.757	0.922	/	−0.059	0.756	/	0.018	0.15	T
426	11327	−0.046	0.747	/	0.056	0.138	T	0.327	0.08	T	−0.109	0.94	/	0.009	0.142	T
427	11814	−0.127	0.799	/	−0.085	0.866	/	0.397	0.016	S	−0.184	0.91	/	0.05	0.236	/
428	13003	0.004	0.47	/	−0.018	0.589	/	0.78	0.003	S	−0.168	0.939	/	−0.264	0.94	/
429	13949	−0.009	0.538	/	−0.309	0.953	/	0.719	0.008	S	−0.214	0.995	/	0.002	0.476	/
430	16416	0.396	0.001	S	0.099	0.03	S	−0.654	0.999	/	0.034	0.187	T	0.013	0.13	T
431	16438	−0.501	0.802	/	−0.516	0.9	/	0.63	0.021	S	−0.968	0.842	/	−0.461	0.905	/
432	17124	−0.226	0.898	/	−0.022	0.618	/	0.702	0.012	S	−0.479	0.942	/	−0.055	0.99	/
433	19132	0.149	0.133	T	0	0.5	/	−0.229	0.965	/	0.198	0.019	S	−0.232	0.974	/
434	17922	0.206	0.012	S	−0.002	0.52	/	0.541	0.037	S	−0.017	0.757	/	0.028	0.3	/
435	19719	0.301	0.016	S	0.074	0.178	T	−0.395	0.988	/	0.112	0.246	/	−0.031	0.608	/
436	14274	0.03	0.411	/	0.131	0.087	T	0.429	0.009	S	−0.086	0.948	/	−0.181	0.968	/
436	17336	0.425	0.021	S	−0.129	0.934	/	−0.343	0.949	/	0.09	0.143	T	0.018	0.443	/
437	17735	−0.377	0.995	/	−0.194	0.977	/	0.663	0.024	S	−0.315	1	/	−0.024	0.648	/
438	19249	−0.284	0.977	/	−0.166	0.768	/	0.337	0.046	S	−0.101	0.796	/	0.053	0.076	T
439	18513	0.194	0.202	/	0.096	0.112	T	0.248	0.159	T	−0.13	0.676	/	−0.072	0.802	/
440	11517	−0.033	0.586	/	0.073	0.052	T	0.133	0.25	/	0.145	0.217	/	−0.016	0.762	/
441	12363	0.204	0.135	T	−0.087	0.926	/	0.578	0.013	S	0.188	0.053	T	0.036	0.176	T
442	12922	0.202	0.003	S	−0.035	0.928	/	0.453	0.14	T	0.164	0.096	T	0.006	0.298	/
443	15360	0.36	0.018	S	−0.046	0.728	/	−0.141	0.75	/	0.07	0.05	T	0.049	0.099	T
444	16028	0.341	0.032	S	−0.036	0.548	/	0.044	0.403	/	0.18	0.034	S	−0.015	0.604	/
445	16648	−0.49	0.989	/	0.033	0.374	/	0.471	0.025	S	−0.169	0.8	/	0.018	0.228	/
446	16705	0.227	0.072	T	−0.168	0.985	/	0.502	0.001	S	−0.228	0.996	/	−0.045	0.932	/
447	16715	0.011	0.442	/	0.059	0.161	T	0.485	0.042	S	−0.087	0.724	/	0.058	0.03	S
448	17316	−0.047	0.812	/	0.047	0.08	T	0.109	0.391	/	−0.172	0.747	/	0.229	0.008	S
449	17331	−0.451	0.979	/	−0.156	0.916	/	0.443	0.001	S	−0.11	0.761	/	0.043	0.069	T
450	17339	0.306	0.026	S	0.152	0.024	S	−0.738	0.936	S	0.095	0.369	/	0.008	0.356	/
451	17420	−0.171	0.931	/	−0.242	0.856	/	0.828	0.015	S	−0.291	0.817	/	−1.008	0.898	/
452	17446	−0.226	0.909	/	−0.038	0.673	/	0.302	0.026	S	0.145	0.118	T	−0.001	0.522	/
453	17487	−0.331	0.966	/	0.074	0.016	S	0.479	0.045	S	−0.209	0.995	/	0.04	0.132	T
454	17740	−0.036	0.641	/	0.016	0.414	/	0.763	0.057	T	0.087	0.15	T	0.095	0	S
455	17752	0.35	0.041	S	−0.107	0.673	/	−0.619	0.915	/	0.343	0.004	S	0.022	0.294	/
456	18021	−0.252	0.947	/	−0.131	0.836	/	0.287	0.079	T	−0.249	0.885	/	−0.018	0.64	/
457	18245	−0.227	0.99	/	−0.031	0.629	/	0.422	0.011	S	−0.126	0.758	/	−0.048	0.827	/
458	18617	−0.193	0.955	/	−0.3	0.95	/	0.877	0.001	S	−0.328	0.971	/	0.075	0.077	T
459	18734	0.248	0.043	S	0.033	0.192	T	−0.959	0.981	/	0.059	0.146	T	−0.012	0.618	/
460	18823	0.229	0.114	T	0.069	0.181	T	−0.056	0.677	/	0.282	0.048	S	0.032	0.24	/
461	19222	0.591	0.014	S	0.045	0.304	/	−0.258	0.767	/	0.156	0.1	T	−0.076	0.698	/
462	19430	0.362	0.024	S	−0.02	0.776	/	−0.751	0.857	/	0.036	0.281	/	−0.231	0.848	/
S: represents the transgenic plants showed statistically significant trait improvement as compared to the reference (p < 0.05)
T: represents the transgenic plants showed a trend of trait improvement compared to the reference, preferably with p < 0.2
/: represents the transgenic plants didn't show any alteration or had unfavorable change in traits examined compared to the reference in the current dataset

K. Low Nitrogen Tolerance Screen

Under low nitrogen conditions, Arabidopsis seedlings become chlorotic and have less biomass. This example sets forth the low nitrogen tolerance screen to identify Arabidopsis plants transformed with the gene of interest that are altered in their ability to accumulate biomass and/or retain chlorophyll under low nitrogen condition.

T2 seeds were plated on plates containing 0.5×N-Free Hoagland's T 0.1 mM NH₄NO₃ T 0.1% sucrose T 1% phytagel media and grown under standard light and temperature conditions. At 12 days of growth, plants were scored for seedling status (i.e., viable or non-viable) and root length. After 21 days of growth, plants were scored for visual color, seedling weight, number of green leaves, number of rosette leaves, root length and formation of flowering buds. A photograph of each plant was also taken at this time point.

The seedling weight and root length were analyzed as quantitative responses according to example 1M. The number green leaves, the number of rosette leaves and the flowerbud formation were analyzed as qualitative responses according to example 1L. We considered that the transgenic plants grew better under the low nitrogen condition evidenced by having more green leaves or greener leaves, compared to the reference. In addition, the change in the root length in either direction, i.e., either increase or decrease will benefit plant growth. Transgenic plants with increased root length under a low nitrogen condition will enable plants to obtain nutrient from a farther distance, whereas transgenic plants with decreased root length while maintain a healthy growth evidenced by green leaves may have developed an intrinsic mechanism of using nitrogen source efficiently.

TABLE 13
a list of recombinant nucleotides that improve low
nitrogen availability tolerance in plants
					Number of
		flowerbud	Number of green		rosette leavels
Pep		formation	leaves	Root Length	at day21	Rosette Weight
SEQ	Construct	RS	p-		RS	p-			p-		RS	p-			p-
ID	id	mean	value	c	mean	value	c	delta	value	c	mean	value	c	delta	value	c
241	74518	−0.141	0.97	/	−0.123	1	/	0.097	0.006	T	−0.532	0.983	/	0.104	0.007	S
315	12627	−0.881	1	/	1.713	0.001	S	−0.222	0.052	S	1.622	0.008	S	−0.037	0.136	/
316	12813	−1.269	1	/	1.151	0.011	S	−0.01	0.89	/	1.858	0.001	S	0.14	0	S
317	14945	−1.131	1	/	0.899	0.014	S	−0.056	0.486	/	0.305	0.289	/	−0.038	0.587	/
318	15345	−0.158	0.626	/	0.961	0.014	S	−0.352	0.004	S	−0.308	0.739	/	0.069	0.297	/
319	15348	−0.582	0.937	/	0.755	0.015	S	−0.17	0.082	T	0.923	0.046	S	−0.033	0.214	/
320	16325	−0.947	0.999	/	0.995	0.003	S	−0.204	0.079	T	1.15	0.01	S	−0.014	0.652	/
321	16702	−0.315	0.997	/	0.567	0.023	S	0.16	0.01	S	0.572	0.071	T	0.012	0.614	/
322	16836	−1.291	1	/	0.149	0.098	T	0.141	0.029	S	2.117	0	S	0.035	0.247	/
323	17002	−1.153	1	/	0.32	0.013	S	0.209	0.007	S	1.818	0.001	S	0.131	0	S
324	17012	−1.201	1	/	0.348	0.025	S	0.291	0.002	S	1.485	0.001	S	0.082	0.107	T
325	17017	−0.352	1	/	0.982	0.003	S	−0.112	0.159	T	0.276	0.127	T	−0.009	0.725	/
326	17344	−1.897	1	/	0.736	0.039	S	0.111	0.181	T	1.344	0.02	S	0.076	0.001	S
327	17426	−1.364	1	/	1.185	0.002	S	−0.218	0.008	S	0.814	0.094	T	−0.076	0.034	/
328	17655	−1.059	1	/	1.094	0.002	S	−0.084	0.208	/	1.656	0	S	0.024	0.637	/
329	17656	−1.309	1	/	0.465	0.04	S	0.107	0.228	/	1.317	0.001	S	−0.046	0.058	/
330	17906	−1.21	1	/	0.058	0.369	/	0.213	0	S	1.251	0.006	S	0.057	0.262	/
331	18278	0.025	0.45	/	0.838	0.003	S	0.04	0.592	/	2.056	0.001	S	0.016	0.667	/
332	18822	−0.47	1	/	0.697	0	S	0.189	0.029	S	1.17	0.001	S	0.048	0.07	T
333	18881	1.062	0.022	S	−0.365	0.949	/	0.08	0.211	/	−1.211	1	/	0.006	0.845	/
334	19213	−0.095	0.712	/	−0.298	1	/	0.18	0.001	S	−0.802	1	/	0.056	0.062	T
335	19239	−0.187	0.931	/	1.466	0	S	−0.104	0.186	T	1.297	0.006	S	−0.048	0.187	/
336	19247	−0.346	0.913	/	0.274	0.022	S	0.013	0.833	/	1.818	0.001	S	0.088	0.216	/
337	19460	−0.526	0.994	/	1.427	0	S	−0.004	0.932	/	0.952	0.01	S	0.003	0.952	/
338	19512	−0.546	1	/	1.611	0	S	0.152	0.011	S	0.824	0.001	S	0.041	0.226	/
339	19533	−0.283	0.929	/	1.909	0	S	0.072	0.353	/	1.904	0.001	S	−0.002	0.952	/
340	19603	−0.25	0.932	/	0.287	0.213	/	0.208	0.005	S	0.234	0.214	/	0.135	0.021	S
341	72126	0.337	0.017	S	−0.447	0.944	/	−0.149	0.059	T	0.23	0.147	T	0.253	0	S
342	72437	0.907	0.016	S	−0.36	0.989	/	0.111	0.049	S	−0.689	0.999	/	0.09	0.005	S
343	72441	0.354	0.011	S	0.57	0.002	S	−0.115	0.078	T	0.269	0.124	T	−0.041	0.361	/
344	72639	0.578	0.065	T	−0.198	0.956	/	0.23	0.001	S	−0.181	0.756	/	0.13	0.005	S
364	19058	1.236	0.008	S	−0.087	0.974	/	−0.103	0.244	/	−0.326	0.94	/	0.123	0.066	T
370	16403	−0.972	1	/	0.63	0.023	S	−0.182	0.006	S	1.751	0.002	S	−0.028	0.202	/
371	17737	−1.124	1	/	0.352	0.038	S	0.059	0.512	/	1.404	0.017	S	−0.038	0.381	/
372	18395	−0.567	1	/	0.522	0.023	S	0.182	0.004	S	0.935	0.007	S	0.027	0.318	/
373	72772	0.439	0.019	S	−0.113	0.827	/	0.211	0.006	S	−0.141	0.739	/	0.106	0.006	S
376	11409	0.001	0.498	/	0.327	0.094	T	−0.069	0.316	/	0.264	0.287	/	0.008	0.843	/
438	19249	−0.834	1	/	0.257	0.058	T	0.061	0.25	/	1.01	0.004	S	0.038	0.438	/
478	72091	−0.803	1	/	−0.273	1	/	0.526	0	S	1.033	0.029	S	0.167	0.003	S
S: represents the transgenic plants showed statistically significant trait improvement as compared to the reference (p < 0.05)
T: represents the transgenic plants showed a trend of trait improvement compared than the reference, preferably with p < 0.2
/: represents the transgenic plants didn't show any alteration or had unfavorable change in traits examined compared to the reference in the current dataset

L. Statistic Analysis for Qualitative Responses

TABLE 14
a list of responses analyzed as qualitative responses
response	screen	categories (success vs. failure)
wilting response risk	drought tolerance screen	non-wilted vs. wilted
score
growth stage at day 14	heat stress tolerance screen	50% of plants reach stage1.03 vs. not
growth stage at day 14	salt stress tolerance screen	50% of plants reach stage1.03 vs. not
growth stage at day 14	PEG induced osmotic stress	50% of plants reach stage1.03 vs. not
	tolerance screen
growth stage at day 7	cold germination stress tolerance	50% of plants reach stage 0.5 vs. not
	screen
number of rosette leaves	shade tolerance-low light screen	5 leaves appeared vs. not
at day 23
flower bud formation at	Shade tolerance-low light screen	flower buds appear vs. not
day 23
leaf angle at day 23	Shade tolerance-low light screen	>60 degree vs. <60 degree
number of green leaves at	low nitrogen tolerance screen	6 or 7 leaves appeared vs. not
day 21
number of rosette leaves	low nitrogen tolerance screen	6 or 7 leaves appeared vs. not
at day 21
Flower bud formation at	low nitrogen tolerance screen	flower buds appear vs. not
day 21

Plants were grouped into transgenic and reference groups and were scored as success or failure according to Table 14. First, the risk (R) was calculated, which is the proportion of plants that were scored as of failure plants within the group. Then the relative risk (RR) was calculated as the ratio of R (transgenic) to R (reference). Risk score (RS) was calculated as −log₂^RR. Subsequently the risk scores from multiple events for each transgene of interest were evaluated for statistical significance by t-test using S-PLUS statistical software (S-PLUS 6, Guide to statistics, Insightful, Seattle, Wash., USA). RS with a value greater than 0 indicates that the transgenic plants perform better than the reference. RS with a value less than 0 indicates that the transgenic plants perform worse than the reference. The RS with a value equal to 0 indicates that the performance of the transgenic plants and the reference don't show any difference.

M. Statistic Analysis for Quantitative Responses

TABLE 15
a list of responses analyzed as quantitative responses
response                     screen
seed yield                   drought stress tolerance screen
seedling weight at day 14    heat stress tolerance screen
root length at day 14        heat stress tolerance screen
seedling weight at day 14    salt stress tolerance screen
root length at day 14        salt stress tolerance screen
root length at day 11        salt stress tolerance screen
seedling weight at day 14    PEG induced osmotic stress tolerance screen
root length at day 11        PEG induced osmotic stress tolerance screen
root length at day 14        PEG induced osmotic stress tolerance screen
rosette area at day 8        cold shock tolerance screen
rosette area at day28        cold shock tolerance screen
difference in rosette area   cold shock tolerance screen
from day 8 to day 28
root length at day 28        cold stress tolerance screen
seedling weight at day 23    Shade tolerance-low light screen
petiole length at day 23     Shade tolerance-low light screen
root length at day 14        Early plant growth and development screen
seedling weight at day14     Early plant growth and development screen
rosette radius at day 25     Late plant growth and development screen
seed dry weight at day 58    Late plant growth and development screen
silique dry weight at day 53 Late plant growth and development screen
silique length at day 40     Late plant growth and development screen
Seedling weight at day 21    Low nitrogen tolerance screen
Root length at day 21        Low nitrogen tolerance screen

The measurements (M) of each plant were transformed by log₂ calculation. The Delta was calculated as log₂M(transgenic)−log₂M(reference). Subsequently the mean delta from multiple events of the transgene of interest was evaluated for statistical significance by t-test using S-PLUS statistical software (S-PLUS 6, Guide to statistics, Insightful, Seattle, Wash., USA). The Delta with a value greater than 0 indicates that the transgenic plants perform better than the reference. The Delta with a value less than 0 indicates that the transgenic plants perform worse than the reference. The Delta with a value equal to 0 indicates that the performance of the transgenic plants and the reference don't show any difference.

Example 2

Identification of Homologs

A BLAST searchable “All Protein Database” was constructed of known protein sequences using a proprietary sequence database and the National Center for Biotechnology Information (NCBI) non-redundant amino acid database (nr.aa). For each organism from which a DNA sequence provided herein was obtained, an “Organism Protein Database” was constructed of known protein sequences of the organism; the Organism Protein Database is a subset of the All Protein Database based on the NCBI taxonomy ID for the organism.

The All Protein Database was queried using amino acid sequence of cognate protein for gene DNA used in trait-improving recombinant DNA, i.e., sequences of SEQ ID NO: 240 through SEQ ID NO: 478 using “blastp” with E-value cutoff of 1e-8. Up to 1000 top hits were kept, and separated by organism names. For each organism other than that of the query sequence, a list was kept for hits from the query organism itself with a more significant E-value than the best hit of the organism. The list contains likely duplicated genes, and is referred to as the Core List. Another list was kept for all the hits from each organism, sorted by E-value, and referred to as the Hit List.

The Organism Protein Database was queried using amino acid sequences of SEQ ID NO: 240 through SEQ ID NO: 478 using “blastp” with E-value cutoff of 1e-4. Up to 1000 top hits were kept. A BLAST searchable database was constructed based on these hits, and is referred to as “SubDB”. SubDB was queried with each sequence in the Hit List using “blastp” with E-value cutoff of 1e-8. The hit with the best E-value was compared with the Core List from the corresponding organism. The hit is deemed a likely ortholog if it belongs to the Core List, otherwise it is deemed not a likely ortholog and there is no further search of sequences in the Hit List for the same organism. Likely orthologs from a large number of distinct organisms were identified and are reported by amino acid sequences of SEQ ID NO: 479 to SEQ ID NO: 12463. These orthologs are reported in Tables 2 as homologs to the proteins cognate to genes used in trait-improving recombinant DNA.

Example 3

Consensus Sequence Build

ClustalW program was selected for multiple sequence alignments of the amino acid sequence of SEQ ID NO:439 and 25 homologs. Three major factors affecting the sequence alignments dramatically are (1) protein weight matrices; (2) gap open penalty; (3) gap extension penalty. Protein weight matrices available for ClustalW program include Blosum, Pam and Gonnet series. Those parameters with gap open penalty and gap extension penalty were extensively tested. On the basis of the test results, Blosum weight matrix, gap open penalty of 10 and gap extension penalty of 1 were chosen for multiple sequence alignment. Attached are the sequences of SEQ ID NO: 439, its homologs and the consensus sequence at the end. The symbols for consensus sequence are (I) uppercase letters for 100% identity in all positions of multiple sequence alignment output; (2) lowercase letters for >=70% identity; symbol; (3) “X” indicated <70% identity; (4) dashes “−” meaning that gaps were in >=70% sequences.

SEQ ID NO :
5211      ------------------------------------------------------------
12100     ------------------------------------------------------------
6033      ------------------------------------------------------------
5630      ------------------------------------------------------------
2801      ------------------------------------------------------------
11474     ------------------------------------------------------------
12365     ------------------------------------------------------------
9090      ------------------------------------------------------------
439       ------------------------------------------------------------
11419     ------------------------------------------------------------
11201     ------------------------------------------------------------
4683      ------------------------------------------------------------
1624      ------------------------------------------------------------
11490     ------------------------------------------------------------
9137      ------------------------------------------------------------
10769     MIGTRVLAHSRVDPAIRWGVAARGRVVFAAIRWGAAARGRVVFAAVRWGAAARGTKREAG
2036      ------------------------------------------------------------
1472      ------------------------------------------------------------
2526      ------------------------------------------------------------
12153     ------------------------------------------------------------
2333      ------------------------------------------------------------
8918      ------------------------------------------------------------
12149     ------------------------------------------------------------
6330      ------------------------------------------------------------
11407     ------------------------------------------------------------
9050      ------------------------------------------------------------
consensus ------------------------------------------------------------
12464
-------------------MSCFACCGDEDTQ-VPDTRAQYPGHHPAR------------
-------------------MSCFACCGDEDTQ-VPDTRAQYPGHHPAR------------
-------------------MSCFACCGDEDTQ-VPDTRAQYPGHHPAR------------
-------------------MSCFACCGDEDTQ-VPDTRTQYPGHHPAR------------
-------------------MSCFACCGDEDTQGVPDNRNPYPGNHPAR------------
-------------------MSCLACCGGEDTQRTPDNGGPYPGGYPPR------------
-------------------MSCLACCGGEDTQRTPDNGGPYPGGYPPR------------
-------------------MSCFVCCGDEDTQRAPDNRNQYXKAIQQG------------
-------------------MSCFGCCGEDDDMHKTADYGGRHNQAKHFPPG---------
-------------------MSCFSCCDDDDMHRATDNGPFMAHNSAGN------------
-------------------MSCFSCCDDDDMHRATDNGPFMAHNSAGN------------
-------------------MGCFSCCGADDVGKKKKRDDPYVPIPDPG--G---------
-------------------MGFLCCSGKPSKRLESSSINENNSNIKRKDQTHVTSGSLKM
-------------------MGFLCFSGKSSKRSENSSIDENNSNIKRKDQTQLTSGSMKV
-------------------MGWIPCSGKSSGKTKKRSDSDENLSRNCSVSASERS-----
QETSTSETKKTKRKWGRGFCGMASHEVEEPLTSETKKTKRKWGRGFCGMASHEAEEPLTS
------------------MKILLGVGINGGLFGSCVSSRSKVDSSTSGISSHFEIKSTN-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------MAAADTSRVFLILIIALVMVIVVLLGICWRFLGPGIMR
-------------------xxxxxxxxxxxxxxxxxxxxxxxxxxxxx--x---------
------------------ADAYRPSDQPPKGPQPVKMQPIAVPAIPVDEIREVTKGFGDE
------------------ADAYRPSDQPPKGPQPVKMQPIAVPAIPVDEIREVTKGFGDE
------------------ADAYRPSDQPPKGPQPVKMQPIAVPAIPVDEIREVTKGFGDE
------------------ADAYRPADQPPKGSQPVKMQPIAVPAIPVDELREVTKGFGDE
------------------SDAYRTADPTPRGPQPVKVQPIAVPIIPVDEIREVTKNFGDE
------------------DDAYRTADPTPRGAQPLKMQPITVPTIPVEEIREVTVAFGDE
------------------DDAYRTADPTPRGAQPLKMQPITVPTIPVEEIREVTVAFGDE
------------------NDAYRTADPTPKGPQPVKVQPIAVPTIPMDEIREKNCTGGDE
----------------NDARHHQASETAQKGPPVVKLQPIEVPIIPFSELKEATDDFGSN
------------------NGGQRATESAQRETQTVNTQPIAVPSIAVDELKDITDNFGSK
------------------NGGQRATESAQRETQTVNIQPIAVPSIAVDELKDITDNFGSK
----------------NYGRSKPGPPAPSRSPPTSRNLPIAVPAIPLDEIKGITKNFSSD
KPYVNNLSKEGESKDDQLSLDVKSLNMKDEISKDRRSNGKQAQTFTFEELAAATSNFRSD
KPYVNDSREEGASKDDQLSLDVKSLNLKDEISKDIRNNGNPAQTFTFEELVAATDNFRSD
-----------------------KAKSSVSESRSRGSDNIVAQTFTFSELATATRNFRKE
ETKKKRKNVAASSEPDKKRWFKNKIWKKKKAKNEQLATLVKEISLATKLNSAMHVNINLS
-----------NVSKDQPTTSNSEHNLPTLTPEDELKVASRLRKFGFNDLKMATRNFRPE
----------------MGSKYSKATNSINDALNSSYLVPFESYRFPLVDLEEATNNFD--
----------------MGSKYSKATNSINDALSSSYLVPFESYRVPLVDLEEATNNFDDK
----------------MGSKYSKATNSISDASNSRYGVPFENYRVPLVDLEEATNNFDDN
----------------MGSKYSKATNSINDASNSSYRVPFESLRVPFVDLQEATNNFDDK
-------------------------------LNSSYRVPFESFRVPFVDLQEATNNFDEK
-------------------------------LNSSYRVPFESFRVPFVDLQEATNNFDEK
-------------------------------LNSSYRVPFESFRVPFVDLQEATNNFDEK
------------------MRSKDSKETTYISDTTSYRFPVESSQIPFAALQEATNNFNCN
---------------RLLRPRRCPSEVPEYFSGNMSGNLRTITYFDYVTLKKATKDFHQK
----------------xxxxxxxxxxxxxxxxxxxxxxpxxxxxxxxxxxxxxtxxfxxx
ALIGEGSFGRVYLGVLRNG----------RSAAVKKLDS-NKQPDQEFLA-QVSMVSRLK
ALIGEGSFGRVYLGVLRNGX---------GVAAVKKLDS-NKQPDQEFLSXQVSMVSRLK
ALIGEGSFGRVYLGVLRNG----------RSAAVKKLDS-NKQPDQEFLA-QVSMVSRLK
ALIGEGSFGRVYLGVLRNGR---------SAXRVKKLDS-NKQPDQEFLXAQVSMVSRLK
ALIGEGSFGRVYFGVLRNG----------RSAAVKKLDS-SKQPDQEFLA-QVSMVSRLK
ALIGEGSFGRVYFGVLKNG----------RSAAIKKLDS-SKQPEQEFLA-QVSMVSRLK
ALIGEGSFGRVYFGVLKNG----------RSAAIKKLDS-SKQPEQEFLA-QVSMVSRLK
ALIGEGSFGRVYFGTLRNG----------RGAAIKKLDS-SKQPDQELLA-QVSMVSRLK
SLIGEGSYGRVYYGVLNND----------LPSAIKKLDS-NKQPDNEFLA-QVSMVSRLK
ALIGEGSYGRVYHGVLKSG----------RAAAIKKLDS-SKQPDREFLA-QVSMVSRLK
ALIGEGSYGRVYHGVLKSG----------RAAAIKKLDS-SKQPDREFLA-QVSMVSRLK
ALIGEGSYARVFFGVLRDG----------RRSAVKKLDS-SKQPDQEFLV-QVSAVSRLK
CFLGEGGFGKVYKGYLDK---------INQAVAIKQLDR-NGVQGIREFVVEVVTLSLAD
CFLGEGGFGKVYKGYLEK---------INQVVAIKQLDQ-NGLQGIREFVVEVLTLSLAD
CLIGEGGFGRVYKGYLAS---------TGQTAAIKQLDH-NGLQGNREFLVEVLMLSLLH
MNICPTQTYEEHSGTYLR---------NLAVIAVKQLDK-DGLQGNREFLVEVLMLSLLH
SLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNH-DGLQGHKEWLAEVNFLGDLG
---GKGGFGKVYRGVLRDG----------TKVALKRHNR-DSGQSIEPFRTEIEILSRRS
FFIGAGVFGKVYKGVLRDG----------TKVALKRRKP-ESSQGIEEFETEIEILSFCS
FFIAEGGFGKVYRGVLRDG----------TKVALKRHNC-DSQQSIEEFRTEIEILSRRS
FLIGWGVFGKVYMGVLRNG----------TKVALKKHMP-ESSQGIEEFRTEIEILSLCS
FHIGLGGFGKVYRGVLRDG----------TKVALKRCKR-ESSQGIEEFRTEIEILSFCS
FHIGLGGFGKVYRGVLRDG----------TKVALKRCKR-ESSQGIEEFRTEIEILSFCS
FHIGLGGFGKVYRGVLRDG----------TKVALKRCKR-ESSQGIEEFQTEIEILSFCS
SLIGLGGFGTVYRGVLCDG----------TKVALKRCKL-ESSQGIEEFQTEIEMLSHFR
NQLGRGGFGPVYLGKLDDG----------RKVAVKQLSVGKSGQGESEFFMEVNMITSIQ
xxigxgxfgxvyxGvlxxg----------xxxaxKxxxx-xxxxxxexxxxxxxxxsxxx
HENVVELLGYCADGTLRVLAYEFATMGSLHDMLHGRKGVKG-AQPGPVLSWSQRVKIAVG
HENXVELLGYCXDGTLRVLAYEFATMGSLHDMLHGRKGVKG-AQPGPVLXWSQRXKIAVG
HENVVELLGYCADGTLRVLAYEFATMGSLHDMLHGRKGVKG-AQPGPVLSWSQRVKIAVG
HENVVELLGYCADGTLRVLAYEFATMGSLHDMLHGRKGVKG-AQPGPVLSWLQRVKIAVG
HEHVVELLGYCVDGNLRVLAYEFATMGSLHDMLHGRKGVKG-AQPGPVLSWAQRVKTAVG
HGNVVELLGYCVDGNTRILAYEFATMGSLHDMLHGRKGVKG-AQPGPVLSWTQRVKIAVG
HGNVVELLGYCVDGNTRILAYEFATMGSLHDMLHGRKGVKG-AQPGPVLSWTQRVKIAVG
HENVVELLGYCLDGNTRVLAYEFATMGSLHDMLHGRKGVKG-AQPGPVLSWIQRVKIAVG
HDNFVQLLGYCVDGNSRILSYEFANNGSLHDILHGRKGVKG-AQPGPVLSWYQRVKIAVG
DENVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKG-AQPGPVLSWAQRVKIAVG
DENVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKG-AQPGPVLSWAQRVKIAVG
HENIIQLIGYCAGGSIRVLAYEYAPRGSLHDILHGKKGVKG-AQPGPALSWMQRVKIALS
HPNLVKLIGFCAEGDQRLLVYEYMPLGSLENHLHDIP------PNRQPLDWNTRMKIAAG
NPNLVKLIGFCAEGDQRLLVYEYMPLGSLENHLHDIP------PNRQPLDWNARMKIAAG
HPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDIS------PSKQPLDWNTRMKIAAG
HPNLVTLLGYCTECDQKILVYEYMPLGSLQDHLLDLT------PKSQPLSWHTRMKIAVD
NPNLVKLIGYCIEDDQRLLVYEFLPRGSLENHLFRR---------SLPLPWSIRMKIALG
HPHLVSLIGFCDERNEMILIYDYMENGNLKSHLYG--------SDLPTMSWEQRLEICIG
HPHLVSLIGFCDERNEMILIYKYMENGNLKSHLYG--------SDLPSMSWEQRLEICIG
HPHLVSLIGYCDGRNEMILIYDYMENGNLKSHLYG--------SDLPSMSWEQRLEICIG
HPHLVSLIGYCDERNEMILIYEYMENGNLRSHLYG--------SDLPAMSWEQRLEICIG
HPHLVSLIGYCDETNEMILVYDYIENGNLRSHLYG--------PDLPTMSWEQRLEICIG
HPHLVSLIGYCDETNVMILVYDYIENGNLRSHLYG--------PDLPTMSWEQGLEICIG
HPHLVSLIGYCDERNEMILVYDYIENGNLRSHLYG--------SDLPSMSWEQRLEICIG
HPYLVSLIGYCDENNVTILIFKYMENGSLSSHLYG--------SYLPTMTWEQRLEICIG
HKNLVRLVGCCSEGTERLLVYEYMKNKSLDKILFAAADAPAPASAPPFLNWRTRHQIIIG
hxxxvxLxGyCxxxxxxxLxyexxxxgsLxxxLxgxxxxxx-xxxxpxxsWxqrxxIxxg
AAKGLEYLHEKAQPHIIHRDIKSSNVLLFDDDVAKIADFDLSNQ-APDMAARLHSTRVLG
AAKGLEYLHEKAQPHIIHRDIKSSNVLSFDDDVAKIADFDLSNQXAPDMAARLHSTRVLG
AAKGLEYLHEKAQPHIIHRDIKSSNVLLFDDDVAKIADFDLSNQ-APDMAARLHSTRVLG
AAKGLEYLHEKAQPHIMHRDIKSSNVLLFDDDVAKIADFDLSNQ-APDMAARLHSTRVLG
AAKGLEYLHEKAQPHIIHRDIKSSNVLLFDDDVAKIADFDLSNQ-APDMAARLHSTRVLG
AAKGLEYLHEKAQPHIIHRDIKSSNVLLFDDDVSKIADFDLSNQ-APDMAARLHSTRVLG
AAKGLEYLHEKAQPHIIHRDIKSSNVLLFDDDVSKIADFDLSNQ-APDMAARLHSTRVLG
AAKGLEYLHEKAQPHVIHRDIKSSNVLLFDDDVAKIADFDLSNQ-APDMAARLHSTRVLG
AARGLEYLHEKANPHIIHRDIKSSNVLLFEDDVAKIADFDLSNQ-APDMAARLHSTRVLG
AAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQ-APDMAARLHSTRVLG
AAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQ-APDMAARLHSTRVLG
AAKGLEELHEKAEPRVVHRDIKSSNIMLFDNDVAKVGDFDVSNQ-SPDMAARLHSTRVLG
AAKGLEYLHNEMKPPVIYRDLKCSNILLGEGYHPKLSDFGLAKV-GPSGDKTHVSTRVMG
AAKGLEYLHNEMAPPVIYRDLKCSNILLGEGYHPKLSDFGLAKV-GPSGDHTHVSTRVMG
AAKGLEYLHDKTMPPVIYRDLKCSNILLGDDYFPKLSDFGLAKL-GPVGDKSHVSTRVMG
AARGLEYLHEVANPPVVYRDLKASNILLDGNFSAKLADFGLAKL-GPVGDKTHVTTRVMG
AAKGLAFLHEEAKRPVIYRDFKTSNTLLDAEYNAKLSDFGLAKD-GPEGDKTHISTRVMG
AARGLHYLHTS---AVTHRDVKSTNILLDENFVAKITDFGISKK-GTELDQTHVSTDVKG
AARGLYYLHTR---AVIHRDVKSINILLDENFVPKITDFGISKK-GTELDQTHLSTVVQG
AARGLHYLHTN---GVMHRDVKSSNILLDENFVPKITDFGLSKT-RPQLYQTHVSTDVKG
AARGLHYLHTS---AVIHRDVKSINILLDDNFVPKITDFGLSKT-GTELDQTHVSTAVKG
AARGLHYLHTS---AVIHRDVKSINILLDENFVAKITDFGISKK-GTELDQTHLSTLVQG
AARGLHYLHTS---AVIHRDVKSINILLDENFVAKITDFGISKK-GTELDQTHLSTLVQG
AARGLHYLHTS---AVIHRDVKSINMLLDENFVAKITDFGLSKK-GTELDQTHLSTLVQG
AARGLYYLHKN---AVIHRDVKSANILLDENFVAKTTDFGVSKT-RTELDQTHVSTVVKG
IGRGLQYLHEESNLRIVHRDIKASNILLDDKFQPKISDFGLAR--FFPEDQTYLSTAFAG
aaxGLxyLHxxxxxxxihRDxKssNxllxxxxvxKixDFxlsxx-xxxxxxxxxsTxvxG
TFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSED
TFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPXLSED
TFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSED
TFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSED
TFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSED
TFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLCED
TFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLCED
TFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSED
TFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHRLPRGQQSLVTWATPKLSED
TFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSED
TFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGNR-VCYLGNARLSED
TFGYHAPEYAMTGQLSTKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSED
TYGYCAPDYAMTGQLTFKSDIYSFGVVLLELITGRKAIDQRKERGEQNLVAWARPMFKDR
TYGYCAPDYAMTGQLTFKSDVYSFGVVLLELITGRKAIDQTKERSEQNLVAWARPMFKDR
TYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRCTGEQNLVAWARPLFKDR
TYGYCAPEYAMSGKLTKMSDTYCFGVVLLELITGRRAIDTTKPTREQILVHWAAPLFKDK
TYGYAAPEYVMTGHLSSKSDVYSFGVVLLEMLTGRRSMDKKRPNGEHNLVEWARPHLGER
TFGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNG
TLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNG
TFGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPSEMVNLAEWAVESHNNG
TVGYLDPEYFIRGQLTEKSDVYSFGVVLFEVLCARPAIAHSHSREMISLAEWAVESHNNG
TIGYLDPEYFIRGQLTEKSDVYSFGVVLFEVLCARPAIVQSLPREMVNLAEWAVDSHNKG
TIGYLDPEYFLRGQLTEKSDVYSFGVVLFEVLFARPAIVQSLPREMVSLAEWAVDSHNKG
TIGYLDPEYFIRGQLTEKSDVYSFGVVLFEVLCARPAIVQSLPREMVNLAEWAVDSHNKG
TLGYLDPEYVIRGKLTEKSDVYSFGVVLFKVLCARSAIVHYISKGLVTLAAWAMDSHKKG
TLGYTAPEYAIRGELTVKADTYSFGVLVLEIISSRKNTDLNLPNEMQYLPEHAWRLYEQS
TxGYxxPeYxxxGqLxxksDvYsFGVvlxexlxxRxxxxxxlprxxxxlxxwaxxxxxxx
K-VRQCVDSRLGGD--YPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNAHAR-
K-VRQCVDSRLGGD--YPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNAACAG
K-VRQCVDSRLGGD--YPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNAHAR-
K-VRQCVDSRLGGD--YPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNAHARA
K-VRQCVDSRLGGD--YPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNARATN
K-VRQCVDSRLGVE--YPPKSVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNARASN
K-VRQCVDSRLGVE--YPPKSVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNARASN
K-VRQCVDSRLGGD--YPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNARAAH
K-VKQCVDARLGGD--YPPKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLNARAVA
K-VKQCVDARLNTD--YPPKAIAKMAAVAALCVQYEADFRPNMSIVVKALQPLLPRPVPS
K-VKQCVDARLNTD--YPPKAIAKMAAVAALCVQYEADFRPNMSIVVKLFSLCCLDLYQV
K-VKQCVDPRLEGD--YPPKAVAKMAAVAALCVQYEADFRPNMSIVVKALNPLLNSRPNN
RNFSCMVDPLLQGQ--YPIRGLYQALAIAAMCVQEQPNMRPAVSDLVMALNYLASHKYDP
RNFSGMVDPFLQGQ--YPIKGLYQALAIAAMCVQEQPNMRPAVSDLVMALNYLASHKYDP
RKFSQMADPMIQGQ--YPPRGLYQALAVAAMCVQEQPNLRPVIADVVTALTYLASQRFDP
KKFTKMADPLLDSK--YPLKGLYQALAISSMCLQEEAISRPLISDVVTALTFLADPNYDP
RRFYRLIDPRLEGH--FSIKGAQKAAQLASRCLSRDPKARPLMSEVVDCLKPLPALKDMA
Q-LEQIVDPNLADK--IRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYALRLQESV
Q-LEQIIDPNLADK--ITPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYALRLQESV
Q-LEQIIDPNLAAK--IRPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYALRLQESV
Q-LEQIIAPNIAAK--IRPESLKKFGETVVKCLALSSEDRPSMGDVLWKLEYALRLQESV
H-LEQIIDPDLAAK--IRPESLRKFGETAVKCLALSSEDRPSMGDVL-------------
Q-LEQIVDPDLAAK--IRPESLRKFGETAVKCLALSSEDRPSMGDVL-------------
Q-LEQIIDLNLAAK--IRPESLRKFGETAVKCLALSSGDRPSMGDVL-------------
Q-LEQIVDPNLASK--TRPKYLNKFGETAVKCLADSGVDRPSVGDVL-------------
K-ILELVDGRVQGGEGFEEKEVMLVCQIALLCVQPYPNSRPAMSEVVRMLTMKTDQSIPA
x-xxqxxdxxlxxx--xxpxxxxkxxxxaxxCxxxxxxxRPxmxxvxxxlxxxxxxxxxx
ATNPGEHAGS----------------------------------------------------
RPNPGEHAGS----------------------------------------------------
ATNPGEHAGS----------------------------------------------------
TNP-----------------------------------------------------------
PGENAGS-------------------------------------------------------
NPG-----------------------------------------------------------
NPG-----------------------------------------------------------
PGAEHAGR------------------------------------------------------
PGEGVH--------------------------------------------------------
--------------------------------------------------------------
RHQACEFSPYPCLYVMK---------------------------------------------
RPASFTDAGERSGL------------------------------------------------
---QVHSVQDSRRSPSRPGLDKDRGQ------------------------------------
---QIHPFKDPRRRPSHPGLDKDNGRT-----------------------------------
---MSQPVQGSLFGPGTPPRSKRVV-------------------------------------
---PDDIEPLPISVPNYDKGISLREAEISLSGFEEKQVEDS---------------------
GPSYYLQTVQPERAGSSPDPNRTRVGSFSRNGSQHPRTLSIPNASPRHNQFLQDSPNPNGKQ
I-------------------------------------------------------------
I-------------------------------------------------------------
I-------------------------------------------------------------
I-------------------------------------------------------------
--------------------------------------------------------------
--------------------------------------------------------------
--------------------------------------------------------------
--------------------------------------------------------------
PAKPAFLDRKNLNGDRDAASSDTATMEMMRSPAGYWMMTPSPMLEVDRPYDMSFGK------
xxxxxxxxxxxxxx------------------------------------------------

Example 4

Corn Transformation Construct

GATEWAY™ destination vectors (available from Invitrogen Life Technologies, Carlsbad, Calif.) were constructed for insertion of trait-improving DNA for corn transformation. The elements of each destination vector are summarized in Table 16 below and include a selectable marker transcription region and a DNA insertion transcription region. The selectable marker transcription region comprises a Cauliflower Mosaic Virus 35S promoter operably linked to a gene encoding neomycin phosphotransferase II (nptII) followed by both the 3′ region of the Agrobacterium tumefaciense nopaline synthase gene (nos) and the 3′ region of the potato proteinase inhibitor II (pinII) gene. The DNA insertion transcription region comprises a rice actin 1 promoter, a rice actin 1 exon 1 intron1 enhancer, an att-flanked insertion site and the 3′ region of the potato pinII gene. Following standard procedures provided by Invitrogen the att-flanked insertion region is replaced by recombination with trait-improving DNA, in a sense orientation for expression of a trait-improving protein and in a gene suppression orientation (i.e., either anti-sense orientation or in a sense- and anti-sense orientation) for a trait-improving suppression of a protein. Although the vector with trait-improving DNA inserted at the att-flanked insertion region is useful for plant transformation by direct DNA delivery, such as microprojectile bombardment, it is preferable to bombard target plant tissue with tandem transcription units that have been cut from the vector. For Agrobacterium-mediated transformation of plants the vector also comprises T-DNA borders from Agrobacterium flanking the transcription units. Vectors for Agrobacterium-mediated transformation are prepared with each of the trait-improving genes having a sequence of SEQ ID NO: 1 through SEQ ID NO: 151 and SEQ ID NO: 153 through SEQ ID NO: 239 with the DNA solely in sense orientation for expression of the cognate trait-improving protein and in a gene suppression orientation for suppression of the cognate protein. Each vector is transformed into corn callus which is propagated into a plant that is grown to produce transgenic seed. Progeny plants are self-pollinated to produce seed which is selected for homozygous seed. Homozygous seed is used for producing inbred plants, for introgressing the trait into elite lines, and for crossing to make hybrid seed. The progeny transgenic plants comprising the trait-improving DNA with a sequence of SEQ ID NO: 1 through SEQ ID NO: 151 and SEQ ID NO: 153 through SEQ ID NO: 239 have one or more improved traits including, but not limited to increased yield and those disclosed in Table 3. Transgenic corn including inbred and hybrids are also produced with DNA from each of the identified homologs and provide seeds for plants with the improved trait of the cognate DNA of SEQ ID NO: 1 through SEQ ID NO: 151 and SEQ ID NO: 153 through SEQ ID NO: 239. Transgenic corn plants are also produced where the trait-improving DNA is transcribed by each of the promoters from the group selected from, a maize globulin 1 promoter, a maize oleosin promoter, a glutelin 1 promoter, an aldolase promoter, a zein Z27 promoter, a pyruvate orthophosphate dikinase (PPDK) promoter, a soybean 7S alpha promoter, a peroxiredoxin antioxidant (Per1) promoter and a CaMV 35S promoter.

Seed produced by the plants is provided to growers to enable production of corn crops with improved traits associated with the trait-improving DNA.

TABLE 16
Elements of an exemplary corn transformation vector
FUNCTION	ELEMENT	REFERENCE
DNA insertion	Rice actin 1 promoter	U.S. Pat. No. 5,641,876
transcription region	Rice actin 1 exon 1,	U.S. Pat. No. 5,641,876
	intron 1 enhancer
DNA insertion	AttR1	GATEWAY ™ Cloning
transcription region		Technology Instruction
(att - flanked		Manual
insertin region)	CmR gene	GATEWAY ™ Cloning
		Technology Instruction
		Manual
	ccdA, ccdB genes	GATEWAY ™ Cloning
		Technology Instruction
		Manual
	attR2	GATEWAY ™ Cloning
		Technology Instruction
		Manual
DNA insertion	Potato pinII 3′ region	An et al., (1989) Plant
transcription region		Cell 1: 115-122
selectable marker	CaMV 35S promoter	U.S. Pat. No. 5,858,742
transcription region	nptII selectable marker	U.S. Pat. No. 5,858,742
	nos 3region	U.S. Pat. No. 5,858,742
	PinII 3′ region	An et al., (1989) Plant
		Cell 1: 115-122
E. coli maintenance	ColE1 origin of
region	replication
	F1 origin of replication
	Bla ampicillin resistance

Example 5

Soybean Transformation Construct

Constructs for use in transformation of soybean may be prepared by restriction enzyme based cloning into a common expression vector. Elements of an exemplary common expression vector are shown in Table 17 below and include a selectable marker expression cassette and a gene of interest expression cassette. The selectable marker expression cassette comprises Arabidopsis act 7 gene (AtAct7) promoter with intron and 5′UTR, the transit peptide of Arabidopsis EPSPS, the synthetic CP4 coding region with dicot preferred codon usage and a 3′ UTR of the nopaline synthase gene. The gene of interest expression cassette comprises a Cauliflower Mosaic Virus 35S promoter operably linked to a trait-improving gene in a sense orientation for expression of a trait-improving protein and in a gene suppression orientation (i.e., either anti-sense orientation or in a sense- and anti-sense orientation for a trait-improving suppression of a protein.

Vectors similar to that described above may be constructed for use in Agrobacterium mediated soybean transformation systems, with each of the trait-improving DNA having a sequence of SEQ ID NO: 1 though SEQ ID NO: 151 and SEQ ID NO: 153 through SEQ ID NO: 239 with the DNA solely in sense orientation for expression of the cognate protein and in a gene suppression orientation for suppression of the cognate protein. Transgenic soybean plants are produced comprising the trait-improving DNA with a sequence of SEQ ID NO: 1 through SEQ ID NO: 151 and SEQ ID NO: 153 through SEQ ID NO: 239 have one or more improved traits including, but not limited to, those disclosed in Table 3 and increased yield. Transgenic soybean plants are also produced with DNA from each of the identified homologs and provide seeds for plants with improved trait of the cognate DNA of SEQ ID NO: 1 through SEQ ID NO: 151 and SEQ ID NO: 153 through SEQ ID NO: 239. Transgenic soybean plants are also produced where the trait-improving DNA is transcribed by a desirable promoter including, but not limited to, the enhanced 35S promoter, napin promoter and Arabidopsis SSU promoter.

Seed produced by the plants is provided to growers to enable production of soybean crops with improved traits associated with the trait-improving DNA.

TABLE 17
Elements of an exemplary soybean transformation construct
Function	Element	Reference
Agro transformation	B-ARGtu.right border	Depicker, A. et al.,, (1982) Mol
		Appl Genet 1: 561-573
Antibiotic resistance	CR-Ec.aadA-SPC/STR
Repressor of primers	CR-Ec.rop
from the ColE1 plasmid
Origin of replication	OR-Ec.oriV-RK2
Agro transformation	B-ARGtu.left border	Barker, R.F. et at.,, (1983)
		Plant Mol Biol 2: 335-350
Plant selectable marker	Arabidopsis act 7 gene	McDowell et al., (1996) Plant
expression cassette	(AtAct7) promoter with	Physiol. 111: 699-711.
	intron and 5′UTR
	5′ UTR of Arabidopsis act 7 gene
	Intron in 5′UTR of AtAct7
	Transit peptide region of	Klee, H. J. et al.,, (1987) MGG
	Arabidopsis EPSPS	210: 437-442
	Synthetic CP4 coding region with
	dicot preferred codon usage
	A 3′ UTR of the nopaline synthase	U.S. Pat. No. 5,858,742
	gene of Agrobacterium
	tumefaciens Ti plasmid
Plant gene of interest	Promoter for 35S RNA from	U.S. Pat. No. 5,322,938
expression cassette	CaMV containing a duplication of
	the −90 to −350 region
	Gene of interest insertion site
	Cotton E6 3′ end	GenBank accession U30508

Appendix

TABLE 3
SEQ ID NO:	SEQ ID NOs of homologs
240:	7319	7772	4165	7279	8472	1915
241:	872	9283	6127	9719	4864	6242	8526	6419	7759	9073	2613	2268
	4632	9988	706	4211	5868	5162	6778	2818	4446	8022	5640	2336
	937	9010	7423	10353	8552	4128	4105	7686	12195	10669	12342	8692
	5537	11579	2835	8650	5475	11890	7460	9427	2284	3244	11978	9829
	4748	8553	1446	2403	7293	3548	12319	6834	10066	6183	4312	7543
	5134	8322	2800	11545	6091	11097	3540	3961	7214	10438	1640	9780
	4934	7927	2400	7549	12416	10157	1349	6290	7629	4403	10890	6442
	2515	5801	12216	8987	5141	9726	6551	10160	5289	1354	4654	7838
	11102	3968	2890	6186	628	8703	9371	3860	10153	8874	1345	7931
	11204	11770	3018	3441	10577	10610	10499	8307	12271	1848	4425	1204
	1537	11923	3133	4808	9940	6766	3234	12003	8649	7112	12207	10622
	5119	3464	9955	6521	4120	9924	5693	8842	7406	4197	4325	11073
	9174	6893	10059	1792	9442	8812	5665	9783	1361	6628	8108	6348
	10795	6924	1868	12137	4042	2276	3365	6619	12076	2084	4511	3278
	10300	4514	7688	1267	870	4951	2767	8580	11788	10100	7117	5046
	6531	5445	9848	2178	713	10999	6411	646	5189	7310	10504	11929
	1690	5343	6267	1010	5444	10776	7548	3144	4347	6416	9264	9668
	1540	7457	1122	10665	8509	11546	9473	4244	3142	6550	4093	2863
	10916	9567	862	7304	1912	11709	884	11773	4089	11785	2325	5602
	8736	11430	3004	5891	11938	8737	6309	4091	10924	5306	970	8723
	3683	9687	7150	3905	10712	8324	8543	6285	2682	5065	2993	8344
	1928	12197	6661	3414	3878	8576	774	10904	8487	5985	7098	9655
	5534	7770	12211	7227	6188	11837	8030	8147	9951	9758	683	5810
	9658	7427	854	9096	9694	10883	8039	9649	1316	2610	8172	9902
	11673	9763	499	2532	2273	1867	10674	11658	10467	11143	1561	1227
	9980	2746	6047	9225	2913	6734	10827	3272	6723	9908	7466	1095
	3459	6609	11165	9800	10526	4253	9446	9328	5243	6005	1744	3090
	12421	3920	9832	3711	9011	8423	4461	6692	6831	8360	1571	3181
	10685	9072	11904	1514	2794	8680	1183	2396	9496	723	3283	5147
	998	10149	12448	9404	2278	9070	5576	1261	5939	3430	2638	11889
	9203	5258	12274	5799	9522	2209	11401	4316	10154	7581	4238	1104
	2565	2848	3349	4385	7993	4012	10842	544	2395	6432	11530	3630
	6887	1938	8532	4631	7779	9935	6726	5294	3500	2088	5588	8751
	10934	9077	12313	8073	6328	3806	12016	9891	2751	5347	3832	10482
	524	4855	1451	4889	9957	9833	3328	3098	11887	579	2376	3260
	1257	10421	5585	7953	6402	1187	8710	933	10081	11571	10018	11279
	929	11738	10702	8395	1157	3651	6278	10269	5139	1814	9838	12108
	7445	2303	9917	11909	2568	7488	10105	12154	11220	2690	3294	8852
	2106	8583	3726	9139	4395	7992	7908	9159	5429	8677	5538	1997
	10866	5592	7970	3940	8551	6443	4844	10921	7499	3865	12214	9624
	9142	10614	3371	11020	5516	3879	2073	1240	10773	867	6888	483
	7134	7633	4447	3518	9610	10005	4180	2410	2959	6221	10371	4837
	6806	10032	9340	610	6464	3840	6788	8340	5255	11301	3620	11459
	1054	9431	3644	6930	815	12034	4401	1154	10315	3519	4509	7105
	5666	8850	3340	2021	10868	3167	2533	4785	3507	1879	1719	7972
	9585	784	11284	10399
242:	6383	3426	9749	9579	6504	8571	11363	9729	2774	2824	6800	11836
	10978	7535
243:	5229	2681	3233	1102	12450	7058	6882	3684	4692	2430	6687	2702
	11159	493	3493	6575	9272	8970	4693	4714	7364	4741	11303	7436
	6620	9708	652	2422	6738	8982	8262	3429	5618	10576	9432	10821
	546	12282	7540	3060	4399	5507	4375	597	4290	6727	1992	2652
	10629	2001	4620	7522	3946	5212	8061	3108	11936	9667	9717
244:	11270	10304	1123	8010	8141	2919	10052	3566	6143
245:	9076	1014	3740	10454	2125	974	3282	11533	12119	7082	8997	10377
246:	7026	4240	12380
247:	9507	5676	8328	9317	3732	4437	1163	9237	8320	2838	8151	1714
	11146	6077	9057	11217	2449	10690	9448	10293	5728	5782	2401	4138
	7730	4667	11152	2750	5910	1459	8501	967	3942
249:	5305	5158	1726	8705	7617	4366	12092	7504	11434	7904
250:	909	10291	9115	8458	1394	8188	6229	2718	3041	1813	8123	2293
	4615	5989
251:	5788	3707	4166	1309	11626	1215	9592	10564	11762	2922	1120	12246
	10130	6124	7520	7244	10681	11835	10359	11822	1766	2023	3987	4219
	4929	3514	7009	6835	10366
252:	2506	10724	1168	12248	3861	6955	5455	8083	2472	2882	11296	7518
	4531	2790	5220	4642	5764	10555	8516	7162	10500	9751	11410	3195
	949	2139	9846	4335	8027	1533	9734	7365	5135	8792	10929	10357
	8500	4674	5959	6248	9723	9847	2620	3874	6654	2979	2131	8267
	8917	1975	1952	5318	5235	10456	6570	9295	5997	8133	9082	3101
	11307	5913	10426	10488	9032	1935	11387	5730	9598	886	9453	3484
	2108	9605
253:	9563	6621	3102	7854	11948	9707	2789	1234	7544	3885	709	3508
	2080	8875	6633	5726	583	9480	6387
254:	2558	10259	7830	12190	11787	11233	11804	11932	5432	11382	10976	10354
	8558	8784	1077
255:	663
256:	3155	8327	12074	9950	11278	1918	6688	12219	11002	11810	8671	11340
	3023	2359	11271	7811	5557	10846	11839	5352	9877	1249
257:	5521	2418	9398	6286	3794	2948	10602	1167	9572	8598	4842	10051
	8479	1101	2475	4960	4151	11114	7441	9907	5012	10145	5948	5536
	7793	2678	1630	5607	3893	11211	4471	2407	5192	10494	9235	5625
	2844	7863	1916	11840	9416	12031	7637	5138	1397	10345	11318	10309
	533	5104	9566
258:	10132	11629	1984
259:	2502	2744	1758	1245	7521	1770	3621	3677	7322	6549	3343	3277
	665	1392	5927	4207	3763	11133	10919	8597	7914	1260	825	4249
	7390	8418	9344	1332	11207	9792	10283	8237	9052	10573	4819	5161
	2192	9433	9103	11532	1235	9170	7685	12286	7576	504	9858	5613
	773	12105	6580	8482	882	7672	11475	4067
260:	5500	10296	1405	4006	3542	3588	9697	3853	9860	4078	11994	5042
	8840	5076	11683	7326	10026	11098	7930	10838	7510	4570	2206	6315
	10542	6334	790	3761	8956	812	5842	7642	9437	1657	4261	10932
	6736	7695	1678	11518	4057	11273	6908	8749
261:	7236	10747	6886	8505	4433	2828
262:	5541	12099	1314	7357	4849	6797	10245	8407	7689	11614	11634	10992
	8211	9445	11122	3505	3148	7133	5137	5978	7204	6146	1059	3030
	11553	4770	4028	2756	3934	2656	9282	5506	5701	12125	7721	5870
	10689	11077	6742	9122	3045	11005	1242	4623	1135	12324	9419	4799
	3549	860	4326	6616	12346	4982	1794	5146	4991	1988	4589	5126
	3279	9035	12249	8864	1774	10361	7949	3640	1388	9286	11235	1803
	6587	9401	2722	10861	1954	6421	4603	3258	6379	3220	2945	10757
	6351	7391	12326	8560	1725	11541	7338	11740	2415	5573	2977	4393
	1588	5712	6159	10673	7398	1137	10128
263:	5581	3054	4968	11826	7738	7209	11043	9303	8847	11344	4650	8603
	6538	7278	11262	9330	1403	3746	1381	7631	8428	2483	4715	11572
	10166	7872	4218	1555	9388	4651	5293	11379	7883	5692	6376	9091
	11863	5991	7677	3240	9457	2300	10016	6676	7461	7839	866	4971
	11657	5928	7762	6798	3314	7619	5988	2960	8922	1702	6642	2170
264:	6344	6298	1512	7511	5719	2491	5202	10321	3352	10631	5917	6083
	9894	5968	3590	12458	7922	8486
265:	5263	2200	8210	4468	4206	4894	5244	2592	10185	5266	7690	5903
	9738	7426	5696	649	2130	9378	2976	8828	5950	11690	877	9138
	4017	6360	1056	10568	824	1530	9517	8233	3151	753	7163	5754
	2049	530	8273	7202	11941	5905	6366	6487	2697	7635	6279	12035
	10146	6342	752	8246	9931	692	10126	8766	5561	11222	3361	10946
	5242	8076	2405	2617	1865	2657	8607	5921	6471	5322	5204	8380
	9132	7500	10092	3267	8286	9969	6973	11893	12262	10563	3738	822
	6392	622	10857	9505	11086	10533	2312	3827	8685	2271	6241	5008
	3275	11760	7717	8735	5121	4477	10541	2457	12093	672	10642	3263
	4132	3908	2158	1110	9674	4706	5371	4655	1385	7054	10162	4026
	9426	798	8527	7663	9407	1548	12317	1065	6247	3991	6995	10511
	3310	7942	7749	971	8054	3702	7725	4149	1430	4869	8240	863
	5849	2614	676	6373	9434	6569	8422	7905	2065	8226	1508	9293
	10963	7217	1061	11930	5694	4859	2066	4479	3376	3741	8660	4973
	5325	12445	7501	11478	9009
266:	5282	9034	7946	3565	11010	7556	8542	2900	11813	2791	11619	8609
	8565	3327	12063	10274	10374	900	7557
267:	11439	1214	4657	9436	2384	9226	4077	682	8386	4448	11550	8196
	11891	5540	8891	2221	2140	6220	8049	9688	10817
268:	10697	8194	3123	9121	966	3221	3093
269:	10295	1410	8017	3948	5643	4846	6118	9778	6770	9890	12451	1151
	3574	4835
270:	7653	9879	12273	7937	9112	4263	8319	5428	2874	11856	9069	3095
	8815	2046	641	8043	4590	11907	9367	1159	3424	9260	11646	11305
	11376	7165	4574	4181	2391	12397	5370	5450	8238	11297
271:	9887	1594	4561	739	2428	7289	3300	8694	1074	4512	12138	1956
	10699	1707	7373	11092	8691	1166	9373	700	1732	4645	10654	1460
	1285	1281	8288	11083	1510	2274	11977	10396	750	9084	10927	9906
	5155	1382	8164	2022	3091	2406	5839	11635	5635	7282	5281	6545
	9626	11931	2083	7990	5071	3039	9941	2486	6359	11986	8040	5737
	7068	2386	969	8753	10709	1706	3782	5246	2968	11013	11425	6000
272:	12210	3011
273:	4502	1337	6810	4527	5021	4545	10234	4774	8930	11081	12176	4641
	4805	10993	5304	3150	4398	2850	11682	10640	7643	2956	7696	10206
	2017	10653	12339	11567	9175	5639	9149	4145	10829	7654	7745	6090
	4474	12310	11298	4324	7989
274:	10151	1343	9690	5795	915	6283	12244	6167	12415	11244	7538	669
	10236	7748	5338	8272	3603	10715	8221	6126	8746	1147	3862	1386
	4626	9462	3382	11669	9745	1953	5485	11800	12029	7011	4464	3433
	6878	916	10508	9362	6949	7323	9591	3126	4283	10994	4969	5567
	2076	829	11238	1408	1733	8827	7859	8376	2390	6010	9864	10550
	11449	4453	11559	574	12253	12301	2742	3302	7911	10899	1584	10625
	907	6246	11192	840	11341	609	3764	10344	11888	4851	2989	7281
	5505	764	10714	10412	3223	2713	1255	11776	10389	3325	10604	4254
	6746	5745	2438	4102	3660	11358	6251	10395	7396	7923	5336	4661
	5515	10273	11125	8513	6191	5873	5865	5467	3138	6058	9002	6100
	3066	7028	7343	7983	11854	8332	7665	6357	8659	3544	6694	10434
	1608	9976	6353	10465	5897	3342	12015	10483	2353	3379	8843	11336
	899	4186	2077	11282	2511	696	3951
275:	3988	802	11542	11369	9017	11035	9816	5563	4495	3642	6836	1845
	8908	5111	3844	9772	8011	11500	12331	3612	3997	1045	8865	7631
	11726	9696	6732	10000	4895	3344	697	6470	807	8854	9589	10566
	9152	8713	1944	7340	702	3836	8254	10886	564	1886	3831	6333
	6117	1496	11477	8135	1724	950	5818	10193	8811	8628	905	3898
	8299	8358	12402	4237	11838	6642	1355
276:	2169	11476	7821	9495	559	1266	9387	6032	9172	6564	5439	10117
	12044	3527	12088	1802	10038	6104	11857	1112	5026	1804	1488	4647
	5852	8919	3271	10791	1940	10169	5685	4328	8860
278:	4220	5703	10281	11415	5739	1519	633	8471	11602	3177	10311	3720
	6857	7703	4881	8725	4607	2350	7783	8244	9074	2110	8593	11793
	9543	3699	7208	9578	2215	5605	2949	10824	5027	5513	1127	2378
	6061	8900	5611	1681	500	8962	2636	9653	6323	8203
279:	7977	4811	2446	5969	7781	11781	6820	3168	5194	2308	2692	7979
	3206	3191	10546	3728	7408	7127	10251	8926	2683	4190	11458	624
	2770	7857	12407	12231	4035	12461	9756	2575	8112	5600	5560	3284
280:	2287	7413	3795	955	7407	6771	3577	6512	918	11231	2508	9630
	4279	11287	9474	7449	1585	11322
281:	2028	1786	5526	6693	4360	11647	11029	7795	3076	6567	12424	5784
	8619	7640	719	10603	3255	4058	5009	9469	3104	3560	1991	4995
	7473	3131	3446	11778	2436	11154	1914	3301	3697	6627	2421	2985
	8765	11696	2067	2884	6975	808	4659	12259	6116	4053	3061	1241
	2503	9710	8539	11176	5157	12436	5596	1069	7135	2640	3543	9315
	7926	1963	11876	11825	1926	4235	2876	8700	1574	12368	12254	823
	4476	3534	6997	1948	9739	4457	7074	566	5110	3289	4223	1173
	11332	2668	9331	8372	3257	5631	1114	2596	9870	5609	11966	8627
	4572	11263	1106	2517
282:	6885	12394	3460	5431	10471	1949	11830	8616	10537	8905	8718	7566
	11255	7655	4357	9718	8693	10578	5918	7620	3719	6735	8835	7577
	2545	10266	4353	2003	7606	10833	4397	5077	8739	8635	9581	9878
	6257	9391	10046	9449	8224	6202	3529	7739	3053	10569	6689	9494
	3892	9795	5280	4728	8773	5720	6472	6961	12395	1772	9164	9819
	9351	12175	4380	8389	8062	5525	4322	6666	602	9760	6826	9359
	6952	8535	1524	1587	8816	8477	6697	3154	12001	1083	3502	4513
	3252	9470	1909	8651	2347	7341	8427	7945	5368	8447	2143	1516
	9817	8044	7032	7719	735	4038	4756	4966	5522	6631	11853	4975
	7003	6724	9360	9209	1951	12228	1609	1421	7481	6644	8777	12140
	10687
283:	1264	11225	3729	5940	7731	12370	659	7066	9515	4931	2567	6128
	3931	2518	6686	705	5223	5813	2082	10751	3378	10518	8119	7714
	7598	8128	5904	8647	9354	8977	6953	12230	9075	10913	621	2918
	6596	6500	5250	5906	3182	10854	3105	11319	10872	7611	11668	645
	3083	7126	3944	10161	10805	5835	2014	5486	2092	8804	4986	1747
	8661	3669	11765	3911	5170	5131	11064	4830	3169	4771	8468	2199
	9730	12042	6401	3880	10156	4342	4126	12422	2433	2908	7692	4703
	3001	5603	8034	9394	7102	11362	2880	7164	3841	2730	2902	7741
	2688	9762	10756	1500	12018	7554	6614	4299	10031	7987	4336	3353
	1452	7666	3538	7184	1032	496	4521	6170	1031	12261	7659	3522
	3406	6207	3941	3107	6114	1364	7036	6553	5645	11299	1591	2260
	2527	7807	10915	11381	3339	4106	3403	3513
284:	6275	8031	11396	11068	6144	6901	1677	9747	5479	10638	10458	12008
	7191	4441	10503	9320	5378	6741	8310	11937	5463	5820	6201	4251
	10652	5984	3650	4243	8318	2772	690	4162	2152	951	3034	11886
	4131	4517	4483	1053	4076	12352	2833	2445	10815	10247	9468	1097
	9265
285:	940	9000	9831	9731	7276	8668	6396	7301	2470	10278	2467	4421
	7774	3286	2063	1808	2189	7260	11548	8989	1250	5911	4075	5203
	2358	5558	5226	7431	1785	6448	3767
286:	2145	8599	10948	6225	11072	2197	2757	6638	5311	7645	1982	4821
	1376	2555	2747	10907	3161	4905	1891	7299	6938	8788	893	11843
	8470	11662	5421	2349	11864	7049	10028	1222	2608	12111	2214	1335
	10383	8738	1841	6534	1246	6377	2646	4358	5942	7951	8088	4662
	11432	6967	5837	3017	8907	9593	9659	482	3666	2501	3744	3064
	9837	10637	6827	1996	9849	1985	2873	1882	5028	9685	11008	8686
	6446	7029	7027	5458	7033	6213	6295	1076	12256	8859	12163	931
	4920	11878	3715	9643	7875	8225	12038	8403	11408	6962	8291	12013
	9666	7532	10425	3996	4964	10826	484	1417	6821	8311	10644	5302
	7711	1979	8295	3649	12328	4085	5838	1563	2427	1369	10062	2039
	3137	7986	6801	1872	9285	11018	1415	3585	6710	1520	7573	5535
	12389	11651	8631	11896	1279	4516	4043	10442	4972	3363	1219	8277
	6808	10460	10481	4724	4086	4843	8260	6972	8897	9573	6840	1319
	4866	6354	8954	4541	9078	2367	7262	8419	4023	5593	2103	5880
	9207	10480	4878	8507	4682	1189	7154	2118	3589	2629	11281	9269
	9208	1812	12377	2700	6802	5328	9597	4302	10352	11089	3569	9420
	11397	896	7628	6205	9287	11031	5218	11549	6524	10574	1881	5339
	5045	4071	10233	10909	12281	7025	7971	11737	11915	8033	9418	8461
	8346	3737	2205	2107	606	11914	3822	11576	7789	5578	5056	1764
	6011	8217	12298	10433	3351	8600	1967	9809	5511	4280	10360	2531
	1660	5200	1817	1484	7733	12423	10823	5112	1901	8200	8462	5319
	7648	4216	12052	6554	10867	5774	3524	10230	1877	9711	9335	6059
	11667	8707	11717	3197	7064	11940	10287	10939	1480	844	4796	2135
	749	7963	4915	1352	6211	5892	11275	3046	4718	9194	4402	7782
	6584	7550	7199	6271	10918	9995	4084	10596	8450	2859	6992	10175
	8530	10138	850	9383	5116	7826	4456	2062	5628	746	6980	3618
	9693	8455	4187	5821	8832	9025	9657	1017	11242	9336	9925	3739
	11971	5185
288:	5348	6988	9850	7061	12393	5642	4272	7664	5768	2239	10722	11731
	6181	8354	8858	4580	2292	11675	11955	3003	2309	6978	7437	6963
	3348	1384	3367	4295	11024	6522	10818	2095	8059	5391	4575	2845
	751	5938	2005	7757	8416	1079	9930	6064	8019	7973	5001	8966
	8103	3696	8845	10877	11016	3966	11997	7483	4704	1755	5574	2153
	10075	4543	613	4822	4321	1170	7459	10843	7479	4345	1028	821
	7615	10064	4827	4045	9607	3901	9278	4885	8800	3708	12309	8573
	4029	8098	976	11913	9490	6374	9234	892	11638	11650	842	5597
	11803	9447	532	10820	6853	11295	10415	10973	6258	625	6489	4373
	8623	1861	11497	10774	1341	5241	7291	11074	9223	1636	10485	8099
	10704	1689	3110	1625	3479	2459	7846	4670	4908	11404	7790	11959
	2302	4099	7169	2704	3935	5659	11109	1971	4882	1420	2724	7516
	2619	11145	726	11950	10404	11066	8602	4952	4595	8430	7957	6667
	4098	5760	3721
289:	1683	12362	9113	4392	7600	2414	2717	7366	11744	2316	12432	10453
	11679	8722	6948	2664	778	5462	5825	6919	945	2473	6807	8373
	2166	1633	7234	7776	12372
290:	4700	7981	9048	2079	2356	10812	9843	3864	2142	9836	1057	3447
	1172	7866	7140	8426	5441	8679	8292	7107	1826	4121	10814	1141
291:	7236	8505	4433
293:	6920	2766	12174	5078	10056	1978	3146	3915	7250	6194	7842	3385
	12026	10851	9549	5924	9689	7070	3010	1015	3080
294:	11118	1686	1569	7161	9314	6479	5327	8152	7604	2735	6160	11023
	6082	7438	11324	658	6632
295:	1797	12327	9056	1769	8521	6141	4451	10662	3121	6729	4002
296:	11665	4628	8100	11272	2962	6690	8757	3907	736	10968	8396	4139
	2701	2537	11009	3140	569	636	10430	11348	11239	4423	8170
297:	10040	6879	1716	4274	5840	11946	10045	1299	4204	6868	1203	1570
	12187	4055	11034	11867	10121	8764	9896	4383	10441	11603	5197	7751
	2307	4538	8156	9640	9117	9173	2889	2739	1302	11224	6739	12406
	5005	2175	11240	6051	8920	4088	2602	3670	4411	2277	8695	9684
	2157	9102	12411	667	11355	12131	3377	4744	1665	1819	9771	6610
	3356	8252	7484	12046	2109	6629	7975	3550	12082	11922	2488	7468
	6702	3819	12435	3037	7503	8208	2368	1656	10950	7799	3709	11821
	6754	9570	3461	2514	10798	6302	9565	12201	1206	7542	7345	9166
	1827
298:	8139	8641	6523	7360	10848	7080	11351	10710	6316	8361	9946	1907
	6719	10272	12085	7644	8212	1763
299:	6133
301:	2843	8911	6094	12023	11991	12055	2010
302:	10750	3288	4820	10759	7232	1468	2951	4205	1048
303:	7006	9229	1705	10858	4364	880	1760	7465	4675	12426	5360	2156
	9318	8825	11203	6042	7668	11101	1703	6193	7506	6825	5555	4308
304:	1683	4392	7600	2710	7988	10089	2414	2717	7366	2316	960	1455
	10749	9333	4153	10429	6807	8373
305:	6095	6918	10432	6852	5239	3438	10943	9551	695	9080	5993
306:	4430	2094	4292	12439
307:	1536	9023	11880	10936	7226	9524	9199	6926	6112	11618	7321	8750
	11623	4860	6588	5722	8796	4694	11392	7090	10582
308:	5238	3842	10493	3617	12025	10781	7017	10148	4213	1647	734	1922
	1286	6020	11398	4553	4130	1328	10923	2987	997	9857	1651	8745
	1276	11827	5769	11903	1711	10772	2601	8974	5893	9389	3765	6869
	1320	8841	560	4916	9060	7308	3672	10804	7998	5884	7476	6162
309:	8801	3541	1041	6711	7964	681	876	1839	9861	3546	9830	9865
	1265	6813	11471	9210	1347	9892	9273	7114	12376	2419	3964
310:	4125	2643	777	875	8914	5741	7486	11181	7454	10520	1438	12303
	9051	5051	7954	6123	3280	1495	3158	3837	12409	4690	2998	8519
	7534	797	9155	2452	10780	10529	1310	9092	6012	8983	10985	4080
	2765	2516	2971	5804	7794	9472	4925	1082	1535	8326	10677	4469
	10965	4601	5747	1947	11884	8621	2712	485	497	5002	7211	5018
	4902	11085	5772	3149	11134	3570	7109	545	2244	5163	4170	10310
	2612	1373	10624	1896	11243	584	5259	3993	4281	1326	8302	4033
	3299	1465	9045	1664
311:	5122	8544	1850	3407	3082	2101	8807	1743	4416	4485	4518	3943
	4757	7512	786	9889	3591	2580	2002	3092	5789	9825	994	3209
	8435	4537	11593	7021	8789	10106	1573	6780	7096	6073	7736	7171
	4282	4394	1849	930	972	2847	1117	8721	7189	2100	5149	7221
	11953	11963	4974	1429	2210	11598	1531	7039	11711	9936	5224	10186
	4072	2649	8963	2382	10351	2096	10974	10636	11000	8734	3916	6796
	8657	11687	4697	4329	6832	2727	8374	9438	10668	3647	11552	7524
	6604	1885	11828	7595	10209	11411	7797	11885	10661	12019	10202	4612
	10108	10561	1613	1092	10530	7110	9015	3939	4852	1642	724	2015
	12189	9706	3937	2177	8937	11655	4387	10778	528	3692	1932	9177
	8140	6092	5247	1545	9038	5309	11555	5090	7242	785	8998	10155
	3954	1639	6650	8405	3305	10431	10539	8886	4361	1783	9454	2362
	4246	1134	11285	2831	7650	4979	12225	6502	1557	4758	6477	2980
	5277	9165	7722	7118	7822	3783	11529	1049	6277	11780	5477	11519
	11902	8645	10034	2590	9003
312:	7634	1055	5087	3270	10523	6530	4135	2639	12447	10719	3604	10044
	11004	5269	5981	9041	6527	7087	1003	12355	3599	1749	1820	5237
	7019	10664	4458	6210	6762	5579	1513	6086	10859	10159	3881	10294
	2398	12212	766	6385	11329	1607	1256	2732	11289	12151	9669	12374
	2974	11070	10739	3928	2935	3478	3994	8822	7264	6240	12089	1476
	5528	4883	10745	11984	2621	8740	3950	745	1798	3044	7394	5136
	9692	9466	10063	2967	12391	6677	2946	10268	10123	2008	8755	2625
	2298	7571	9242	3014	11869	11288	6433	5751	9405	1874	1578	9665
	9703	10320	1824	11681	948	6637	4997	5823	9683	604	3847	8941
	3539	7889	12124	6925	8278	4831	1027	6795	9728	4914	11590	4955
	3033	8945	3413	2133	3141	9776	8259	5604	661	6708	2072	12017
	7921	9961	3450	11775	11689	6597	1305	4984	6024	4604	7267	2781
	3324	8629	6970	4731	5856	9555	9063	10972	10612	7412	3246	9125
	4523	6617	2807	8556	2723	8799	6217	9664	1990	11713	2075	10468
	4467	6119	11216	7469	2925	2494	3341	4896	2416	4030	10414	9642
	4643	7255	9639	5236	1493	9646	4850	11457	1654	2507	12091	10492
	7103	2934	5863	8408	5290	4617	9606	8925	9280	7235	9904	5480
	2332	1344	6048	1870	4562	3225	6261	9429	11873	9097	8533	3625
	1562	3814	9222	6849	9779	9289	10403	7784	10394	10711	5376	9998
	9111	11670	2440	4937	8095	11790	3533	3573	10164	3631	5413	7728
	4797	5032	3704	4146	12291	3808	8279	3188	9621	5861	3160	1278
	9042	7012	1339	8067	4027	12239	1111	6505	1964	2755	7935	1146
	5619	11265	9550	7470	5941	2048	671	2054	11792	10983	4007	11511
	3313	2905	8370	577	6682	8829	2637	7402	10339	2388	11321	8431
	7853	5000	708	8697	11858	8007	3242	10998	7675	6001	6775	10819
	10672	4362	4303	6889	9634	12308	3291	10452	10522	11809	637	6341
	12285	12296	3800	10019	11112	9244	9312	10119	9168	6896	6098	10192
	7342	5015	2487	3021	11213	7043	986	9461	9910	2648	4195	4300
	11055	2513	1815	1005	2305	11368	3526	1900	8978	9874	1294	6139
	11757	9476	6915	6678	8672	11808	9501	10375	632	3130	11380	1466
	5108	396	12020	6945	2981	6611	10243	7593	4578	5469	8960	3071
	3977	9183	4638	4536	5335	7404	8494	10474	5464	8474	6990	8014
	5831	6203	12383	2696	11829	9304	2557	4221	4376	9927	10496	1226
	3798	585	9118	660	619	8366	12387	10069	12183	4463	4586	11071
	2345	5424	6894	10158	11247	9301	8176	6140	4214	871	11164	3381
	1638	4957	5190	6700	3735	1445	4493	4490	3902	5321	6187	8125
	8124	10068	10324	4539	4117	3925	3859	11975	4532	10405	11859	7496
	8381	9275	6259	803	6176	11343	11136	11610	9332	4494	8895	5353
	5936	11292	8637	7285	3825	10337	8522	2680	8726	7136	11138	3680
	5761	11442	6639	5433
313:	3073	2474	3510	7075	4976	9185	6594	869	9518	10060	2564	8838
314:	10029	7651	7037	7585	7372	977	1353	5662	11431	7052	1583	10463
	12267	6507	3712	8663
315:	9863	731	7111	1547	6030	1144	2530	2947	7906	6412	10680	711
	2149	7709	1058	10768	11394	10997	1284	965	4092	9557	8392	9018
	11227	11661	7614	8846	8961	6265	490	12083	5584	6306	3578	978
	2842	8258	10448	3028	3973	2330	6069	9296	5493	11444	8227	1889
	1976	12418	11926	5310	9629	2823	7121	8824	7288	2825	5007	4727
	12316	11612	6029	10124	5395	1188	5651	9230	2587	9403	9616	4660
	8057	8263	12442	4124	2229	9270	4779	3224	2595	1363	1671	8594
	6155	1946	6712	8032	4807	5172	985	1160	11249	9027	7492	503
	1411	3627	6314	2251	4025	9899	2898	4371	5499	4640	1407	1416
	2827	8336	3321	6390	11330	5678	2357	7419	4422	1604	1334	9460
	9380	3823	1149	1878	3273	11574	2693	9855	6216	9497	1866	7358
	9376	3870	5679	11309	1521	5487	6999	9402	3639	5342	9511	11774
	10476	6643	10262	9095	7084	4824	6791	6636	4738	3470	11228	3628
	7590	8050	5438	3050	2836	8078	9535	11620	9299	851	10008	11688
	10302	9253	10109	10392	7447	10775	9647	6398	11767	2404	9532	7553
	2223	4320	12144	9221	11973	1195	6037	612	8163	6142	1835	11727
	10024	11866	1740	11823	1296	6755	6363	10020	1599	9297	7901	2689
	1450	12117	6630	3852	9369	5010	3440	541	2026	8352	11759	7435
	11048	6494	1923	2091	9363	3829	9321	11337	10557	8839	5332	9599
	9455	5217	8901	5962	6050	10900	11801	11059	578	9821	11653	3449
	4684	5740	3923	3266	2247	783	3906	1238	911	9782	6669	3056
	3331	8118	5734	10367	9491	11323	6276	12005	9249	5317	10489	11752
	7123	4021	6679	3673	10752	5998	10004	10887	7803	3768	10845	2786
	1270	10072	4981	7207	2866	902	1837	11543	8433	8274	2372	6706
	11025	9202	859	6833	3706	11172	9258	4993	7131	9538	4212	2504
	2399
316:	8724	5044	10558	8303	9909	12419	4296	12010	10150	6441	7879	1790
	6993	7248	6491	1233	8304	3559	5660	11014	6121	7157	10033	9834
	8343	623	4818	2695	8950	5944	8070	6179	7155	8476	7471	4735
	1999	3100	5671	2691	2148	10084	9248	7835	11562	2611	5661	7181
	6841	6612	11769	11372	12269	6349	7224	7867	9948	4404	8851	4016
	7750	11832	12148	11180	2896	9964	2111	3311	11733	5130	6634	3026
	11157	9412	3099	3498	5691	10021	6282	4159	2235	3506	6135	10583
	5471	7428	3029	4177	6845	5345	5775	3075	8251	1968	8338	10990
	9254	8337	9663	954	3674
317:	3309	1527	722	3863	6557	3497	9944	9740	9322	10027	1087	1070
	5196	8294	7902	1436	1367	8642
318:	5591	1829	11695	2000	9068	10423	11601	5883	4658	7572	11257	12196
	8459	8921	10876	12235	1905	856	7764	7158	8826	7552	10363	6559
	3049	10022	3134	11123	959	5622	6519	2482	10006	7884	8634	10070
	8473	6909	1942	5807	3129	11586	6254	1094	8148	1685	7743	3487
	6540	12002	11155	3419	11976	11185	8314	8820	10691	6859	6339	11175
	7919	10204	10947	3213	11850	3694	8055	9086	1409	4904	6427	9284
	7984	1606	10085	6498	12180	4930	5899	828	6794	8456	8300	2319
	10521	8577	1989	10299	4438	3051	4884	9888	1004	10552	855	4405
	2535	1499	5039	1597	8767	11625	5482	5559	9932	10570	2068	6563
	10524	12314	4977	757	651	11350	4768	9005	4429	4780	3250	8964
	5900	8137	2594	11961	9012	754	1230	10885	10536	5399	8142	6244
	2943	2168	1691	4435
319:	8234	755	4745	5743	11416	5655	10409	2053	6607	7820
320:	9329	6305	5715	6935	1731	3235	12440	12412	4278	1822	847	5334
	7870	10648	9544	12378	4268	8349	5812	8182	7802	11782	1218	925
	717	3215	2591	4985	1602	2996	2432	1383	3682	6516	11924	4415
	6860	6131	5268	7382	571	4888	3972	11464	10290	4716	9677	5653
	9087	7976	8046	2070	7624	811	6873	8268	7044	1659	10116	10088
	1282	8742	5145	5955	10182	1895	7354	591	8388	11998	5166	4933
	4983
321:	2426	7091	11276	4874	9934	4591	1667	7682	6262	1393	10547	1777
	12123	2176	7559	6552	4963	6164	4840	9408	2716	2793	891
322:	5419	1980	10862	5179	5755	8819	8830	6917	1185	595	6593	1568
	7678	4248	1342	4787	11039	12209	1773	537	8102	2886	1780	6969
	3022	2431	9990	8284	889	2883	601	9129	6056	3334	6536	489
	10095	6789	2134	7294	9824	3856
323:	4349	10326	768	6031	10342	4665	1943	8790
324:	1807	6871	7314	1009	1853	3486	9866	10057	6759	6556	9450	7290
	4154	5279	5478	11702	7771	12388	2031	9217	8382	11450	10571	4891
	2887	2749	7969	1467	11587	4119	10940	6703	9822	10009	1458	10348
325:	1672	4606	2593	3085	10400	12452	5312	8862	8090	10382	7674	7752
	10332	11535	1038	6913	7099	3416	1507	5055	5806	4176	5817
326:	9196	7256	12366	4110	10397	10333	11199	4630	4803	3350	4579	12192
	9062	5834	5404	2669	11508	9233	2116	5182	2314	8990	3210
327:	3079	1902	6763	6196	10297	525	1136	10317	8887	9143	6493	9364
	6322	4750	5504	4828	2519	9913	10221	721	10417	8585	9033	4739
	6515	11302	3894	10054	3781	7528	10683	4917	9992	11040	8730	10090
	11452	6125	7046	6717	1544	8931	1612	6804	2283	1567	3563	3714
	4051	9487	7312	5698	4906	9488	7768	10592	9266	1871	4306	6941
	5085	3766	657	7452	2721	7222	2942	10732	7982	2495	5802	5023
	12359	2051	7891	6362	11507	9238	599	4022	6595	7515	7974	3985
	7170	5916	2462	5466	7960	1303	9959	5841	1153	6843	11521	1442
	7399	2188	4833	6839	11489	5350	924	8774	2086	9533	3810	10807
	4054	5228	7206	10738	4228	11845	9187	11075	3002	8384	7124	4747
	10742	958
328:	9919	4426	6725	7362	1497	4470	4262	781	6226	6466	3147
329:	2983	6189	952	4334	3360	11105	2813
330:	9520	5175	6428	1775	3228	2615	1674	1529	10556	12061	6180	1471
	10413	11057	4958	5727	11103	6356	4687	3052	6579	7318	5171	10445
	1884	4172	7024	6395	4588	3482	8574	3077	5684	4175	7684	8761
	8410	11156	3963	8793	7076	11898	12294	4594	2505	7292	910	11927
	10280	10853	2562	9290
331:	5926	3535	9559	5422	9498	5418	11106	3035	8145	3788	3434	2958
	4528	5307	2150	8390	6071	7591	11525	6824	12012	5780	7924	588
	2542	12236	1781	3295	7747	10979	927	5393	5498	1232	6378	6060
	5705	4565	4678	2892	5214	2604	8270	10598	3347	6773	1983	10666
	5416	4535	2042	6985	12304	2254	12193	11445	8126	6218	11609	2510
	8946	6891	10623	9150	9341	8952	10725	6292	8420	4743	1894	5205
332:	8023	7887	10238	9213	8562	6182	1506	1558	1435	3884	10364	7810
	6750	8165	9926	8918	11981	4257	6330	7446	4730	2526	2036	2270
333:	7316	11087	8566	7430	8215	10884	617	11671	7403	771	5330	11210
	874	2708	10986	8079	10214	8720	9937	9954	12443	5156	11161	11236
	11274	3882	8213	11346	3833	1433	2146	5627	12305	6370	522	12343
	6792	6740	4809	5925	4436	8130	3983	7141	11712	2424	10882	3292
	10338	4927	7045	5949	1851	5053	3412	6405	9316	10864	5664	655
	7325	5686	3063	3152	3401	7125	8904	7596	12198	2961	9424	7305
	10419	3652	9133	3164
334:	2706	10115	1941	10786	12217	1037	5649	6880	2468	8350	5120	11413
	8965	2552	5150	1490	5544	5454	10388	10222	9089	2064	1925	8449
	5369	6375	1883	7228	5106	10227	1628	11584	8197	838	2743	9261
	1906	12437
335:	5048	2893	1470	8587	9982	8563	992	5407	3472	9481	11433	6747
	10703	3793	630	2029	552	9920	10658	11925	6440	10163	4087	4297
	3477	11972	11551	795	10649	7128	11956	4428	2600
336:	2895	11678	10073	8802	7383	1186	6288	6895	1846	3139	11160	7898
	953	6648	2246	7020	7962	12043	10436	11144	11645	767	6783	4500
	3097	9773	4921	1572	10510	3845	11447	895	9193	5457	6529	3256
	1148
337:	6394	10174	8413	2929	12463	7434	4194	2477	9390	11245	3690	7237
	989	4445	4639	3312	10763	7760	2499	9922	11703	7259	5299	11517
	2798	8113	4275	4259	1133	10427	763	492	11466	796
338:	12363	12358	4801	8504	11079	9200	9918	2258	11786	8127	5101	9562
	1375	10840	5449	7015	7705	1126	4355	9939	2626	1582	6415	9793
	7240	9134	4378	5484	8595	1002	1960	7380	5733	12030
339:	8296	10930	3512	4549	4311	3678	8316	12037	9411	6338	7588	1091
	3445	10255	9984	2081	5707	7200	11607	9106	2524	11617	7681	10626
	1113	2574
340:	6308	8489	3318	5096	4024	12141	9463	2413	8951	4618	11140	6875
	2236	11496	2869	10416	6720	6805
341:	5401	12226	2834	3616	1217	7007	10418	5716	10594	2310	3910	4193
	9768	6605	11899	8567	3432	6624	5099	8967	1439	9542	3431	1580
	10323	1036	1177	11223	7907
342:	8184	2250	6514	7840	6940	6635	10785	7934	5709	2204	5402	1125
	4370	9392	11049	5524	3287	10067	7632	6768	5285	7306	8805	7167
	2858	4232	3200	1748	6964	4942	6830	6320	5638	10736	7545	7179
	7873	6641	2570	11995	10216	2186	7050	3787	5272	6912	5990	1461
	4227	11698	1142	728	1109	3685	3116	12289	9409	12039	3725	11595
	5366	3201	9379	11360	6166	1739	9236	1011	5206	3835	10449	1684
	2915
343:	10188	2007	2016	5850	4350	7000	2306	6027	519	2627	4501	4773
	7047	2914	6721	10525	10225	11664	4271	10554	9443	8053	9601	1757
	6957	9214	12095	2338	8091	8158	9876	8185	3219	4001	10901	10380
	11232	6571	6321	7238	5509	5531	6190	1481	11491	7251	8202	1424
	9430	1093	1539	8094	9162	8491	12373	6691	4250	6326	4367	3120
	11992	9516	10384	11969	5383	7443	9761	11954	11438	6884	8081	5689
	3693	9510	3198	3815	1676	5420	1290	7955	7065	5890	4961	6062
	581	2686	3394	9435
344:	6016	8669	7837	3285	5153	8414	5003	6936	1823	11693	6756	1090
	7296	10903	8308	3336	8975	11448	12311	5895
345:	6350	10059	1792	10553	1052	9871	4680	11701	1620	6685	5543	9189
	3089	2955	3239	984	2183	6136	2550	2867	10379	8511	8936	7833
	9393	5546	1247	2344	9603	6670	10229	5013	5216	9638	495	10870
	8502	10014	2097	5365	11704	10925
346:	10910	9252	7236	10747	11205	8087	9568	8505	3422	11280	2828
347:	9478	7851	9259	3554	2906	9872	1549	5257	2227	10439	712	2975
	1371	3769	4323	2624	10343	4133	1652	3408	3218	5867	4967	1191
	11187	1193	5545	11252	10671	5564	1704	4129	7409	9529	9895	5213
	12184	11141	6986	1931	6701	6585	3384	11504	5388	5954	3475	12215
	10107	7680	12113	1006	3982	6968	2578	12021	11605	730	9840
348:	11699	890	7060	5408	3891	2025	5553	6088	1171	9536	7944	2585
	6626
349:	4581	12427	4118	10579	6861	11017	8438	11054	5359	3828	670	11094
	10308	7001	4034	901	7814	2667	4970	1542	3173	3981	3355	2383
	6150
350:	11417	1710	7143	12413	4143	1380	5658	4141	2529	689	12054	5683
	8670	9716	7767	9724	804	8261	1972	8448	12347	4600	6403	8928
	836	6649	7254	8646	1538	4115	6751	2245	5315	1289
351:	2222	5633	1475	12182	10043	6299	1275	10135	11560	8411	4729	11979
	10980	11596	1161	3153	2759	2928
352:	3872	8759	1601	2322	6250	5881	8675	3496	10136	8605	7855	7819
	2394	10960	8041	11325	11502	4391	2074	10684	1169	10878	8550	775
	8673	3320	8355	8001	8863	1030	9350	6478	9459	4688	4136	7283
	9853	9923	5566	8153	7558
353:	10729	2481	11933	3274	9399	7657	12414	6573	2679	4924	12348	2129
	2299	3695	5412	9744	4871	2663	5923	2674	1178	1213	3849	2812
	10001	3040	7938	1696	4418	1816	2257	7555	2598	11267	1432	4946
	9786	2875	12110	3799	4560	1737	10215	3437	3598	3230	8884	11290
	7198	9757	1742	10197	5169	1351	9201	5459	9239	6426	3909	2267
	10834	7698	6068	6956	11540	7030	4097	10678	1428	9789	5995	666
	5811	1503	12315	7385	5947	12398	5400	6539	11174	7393	8239	3812
	1653	10532	9596	5128	2417	4137	2861	10966	9180	3986	1263	2984
	9218	8933	5833	3661	5314	2161	5284	4800	7097	9081	2924	1699
	6281	8441	3435	8639	10284	5275	8084	8781	8537	1919	11367	6958
	11592	3615	6817	7464	2180	11746	11385	11558	3797	12334	6057	9651
	8955	8992	2857	9806	4886	7824	4487	6178	9130	3375	9905	1398
	6760	8464	7732	4224	2586	5502	7432	4857	10490	7225	10228	9110
	2758	4533	1779	5049	2878	2816	8666	8986	873	7639	11037	9989
	8794	11928	9425	10771	5714	7804	5127	747	4868	4427	1259	7243
	1489	5103	1546	1887	4898	9628	10306	7507	3959	1423	9192	8092
	2190	11640	7115	10231	562	2155	4284	2253	2213	1116	5381	3855
	2045	7900	8283	6510	10386	8440	4365	11779	8018	4992	1449	9564
	10995	9255	6769	11406	1040	5650	2768	10855	7041	3867	9767	10335
	11169	11871	3491	7880	6921
354:	4928	539	6076	7626	2465	8883	12086	9675
355:	10941	5827
356:	7899	2286	11193	1590	4944	8228	5230	8377	10663	6499	7913	3914
	3330	8929	1366	6532	5461	12302	2425	5550	7472	3786	9953	7359
	638	2439	12129	3601	10559	5320
357:	9769	8015	4161	2360	7713	9049	5894	1492	8881	9292	6846	11197
	10179	5547	7991	1577	10964	995	4854	2078	8454	11277	7270	846
	11149	4711	8179	8940	5875	4163	8004	6019	3517	11480	9759	11982
	2443	7831	6866	520	10288	11721	10794	5184	9263	9227	7967	6704
	4726	12229	12241	2761	2548	5888	5798	1304	4558	10053	10279	7726
	2371	8763	11964	1440	11352	3185	10955	5377	2392	1330	6764	9999
	7932	7710	1216	833	2822	1258	6423	1610	9479	7241	9311	5974
	5542	12079	11012	6111	2738	2779	9294	616	6406	8857	4171	4185
	7448	6154	2581	8570	2912	5060	5572	11258	6898	3143	11849	7311
	9897	8778	4540	3875	10589	3523	10101	9704	9915	6361	3492	5763
	946	10099	11632	4390	4475	6157	10420	6455	8280	11246	8247	5118
	11855	11044	10706	2632	7589	7257	8483	7583	5337	11797	9735	4686
	10244	1413	10049	7841	4148	1205	8981	2705	2841	3059	10241	511
	6765	1196	3400	4548	1293	4870	8298	6870	7601	3758	1806	6713
	7895	9746	11440	3296	11135	531	12232	6959	7712	2528	10944	4544
	6844	12396	10265	7950	7862	8733	5434	9512	523	6422	4564	2037
	4559	8460	10141	8241	6939	4947	5088	3115	1152	5316	9093	12321
	2484	570	5793	11604	7268	4359	6138	1899	8219	5061	1784	10748
	7525	9250	10620	7416	11644	8451	5301	7048	3817	615	9384	4912
	1646	10461	2840	9147	6007	6548	2734	8712	11513	6640	6099	8335
	5174	8138	5809
358:	9456	10091	8818	9686	491	6509	10041	5375	5497
359:	1799	8105	6680	5822	716	9622	6488	8882	6249	5621	7246
360:	714	4732	1511	9059	11326	12188	3337	7352	9720	8923	3113	2381
	688	11186	6294	11728	4873	12114	4636	8596	1858	4552	7753
361:	12275	7578	1271	8220	517	6822	11492	10740	8915	1237	7313	6003
	8089	502	3632	6236	800	2290	7104	10731	10208	8285	9695	2429
	11179	4061	975	12345	3469	4432	6660	11019	6525	7694	7153	4766
	7563	1551	7850	6954	9960	5047	10767	11958	9620	9043	1269	558
	11895	9231	2972	4156	5700	2228	744	4646	834	12048	3418	2115
	9996	2315	12024	8896	3724	2033	8309	12022	8056	12152	8698	596
	12222	7183	10896
362:	3074	9370	4079	5426	2409	3958	6274	3117	3264	8655	2301	6897
	8397	1864	6452	8528	2090	4208	4000	6705	10758	3971	11095	11734
	10908	5836	11366	11983	3945	10695	10698
363:	6232	8229	5094	2536	8195	8305	11129	7370	6651	10713	12329	10502
	3869	1362	12428	11633	4386	1833
364:	3918	9184	6928	11422	9880	3754	3316	5448	6234	5494	7231	4443
	961	9464	2019
365:	5176	5308	11795	12263	839	8051	725	738	1801	1487	5073	10122
	11570	4047	3557	6291	7582	8394	12237	5501	8878	4245	8257	8779
	3803	9036	6984	10692	10346	12011	3038	3889	1145	11293
366:	11753	3016	2911	5829	2185	9537	11999	6447	2243	9823	5031	9323
	5143
367:	1672	4606	2208	2593	3085	4608	5312	2365	4258	1108	7780	1474
	2670	6672	4877	8116	4113	567	5844	922	1507	5055	6371	12297
	5806	6153	4176
368:	1637	6662	7275	12072	10534	10235	7477	576	4547	5695	11725	11041
	2144	3637	8866	3065	12238	12051	11021	6537	1315	1024	2776	5470
	5271	11906	5583	5907	9609	2444	4763	4066	12204	4410	5862	4046
	11455	6668	4742	6937	5198	6748	6490	3031	7966	6454	6436	2497
	7737	818	11952	5274	2207	6707	5151	1248	6284	3067	575	10007
	2991	1336	1312	600	9022	3545	10301	8325	11648	2573	11182	7903
	12047	7980	11206	3655	7216	11534	8589	2655	6075	10114	2052	1673
	9678	7502	7151	2295	4856	11942	2868	4169	11253	8689	12295	10478
	7533	857	8484	7778	8608	4112	9338	837	1936	6393	8245	1834
	3359	861	10811	9277	8301	2937	10010	11536	853	2242	3345	4826
	5960	5105	8612	4918	883	8756	6790	2420	3917	11919	10002	7083
	9966	7808	4384	6867	5608	9513	3877	7763	488	9339	4829	518
	9901	8154	3676	8495	2121	9977	12277	5725	4140	1444	7439	12357
	4332	3531	2839	10627	2826	5935	11544	9962	4569	2554	6850	10074
	1553	2184	7145	7918	9156	8271	6902	4199	9774	10303	11493	8249
	6239	5059	8701	1162	5882	5987	3718	9160	11007	7067	4939	12064
	11600	1202	2849	3317	8129	10239	10865	1962	6325	4691	9302	2234
	9123	12322	8457	8979	5670	3024	4440	9560	5885	3421	4265	11628
	2280	12332	592	1494	11523	1244	2523	6110	2231	5437	551	5409
	6716	4573	3839	10422	8275	8588	737	9262	7487	5465	7493	4534
	11266	10727	7828	11115	8002	5225	10562	8378	9400	12224	7420	8290
	3780	6224	11462	2397	5411	8797	806	11718	7378	12283	9921	6854
	3333	10881	9100	1559	11751	8944	10954	2226	7330	6079	3924	1099
	2694	1412	5610	6149	8696	3607	7008	9274	2442	1729	1453	11468
	8334	6233	10632	7636	4455	535	1073	8699	9325	11585	9441	4294
	4236	10498	3813	7263	7939	2030
369:	12323	718	9099	11577	11908	9361	7271	12027	5331	8889	12136	6562
	7298	10254
370:	1105	10455	3073	6977	4330	5374	2173	10058	9053	6486	2474	8879
	4004	7530	11226	11126	11987	10782	10535	4210	5472
371:	3659	3717	5958	5227	5173	563	1974	11405	2411	10256	11147	9698
	1595	3775	3388	7148	4862	7827	3850	8768	5847	6009	1598	5296
	2435
372:	10050	9750	10875	7497	2584	2941	5460	8412	2471	11342	3448	6615
	4344	10212	11030	8614	1464	10355	8387	6526	3483	5803	3900	4887
	12318	10250	10765	1081	7302	3451	5781	8856	6456
373:	3742	9841	9366	1717	10514	6445	2098	7489	11807	10922	2004	7092
	5699	5406	9352	1306	11743	7252	4103	1291	9039	3402	7490	2927
	4815	5718	9085	3587	4252	12361	1119	11527	6757	6177	2117	957
	1619	7647	8758	6103	1550	3373	4234	8442	10275	3397	919	10491
	8000	9483	5624	7353	6772	8995	11944	3528	11162	6346	11389	10330
	12218	9741	5986	6424	9046	11148	6134	5934	9327	6745	1192	8662
	10515	759	5589	1023	8465	8035	1001	7307	11719	7387	6332	2820
	12268	11591	8391	6081	3757	5736	8020	12109	10194	1220	11399	557
	9619	12369	6998	10519	6297	10023	2635	6815	4672	1753	9523	3481
	12171
374:	2263	8253	8529	2957	5854	8654	12242	1321	9319	8683	5453	4689
	8478
375:	6965	11170	1791	4291	11390	8902	11875	6799	6266	9014	11320	3805
	5529	4032	8287	11865	10167
376:	4414	8762	11259	9504	9784	11748	5341	9107	10327	1525	9644	12240
	10723	1910	8082	6558	9736	7526	5682	6365	6386	9545	9617	6173
	7400	11050	12004	3364	11569	8475	4872	1043	9671	1955	4256	2500
	8467	10828	11694	8568	9268	2855	11353	9054	2577	7462	1663	10479
	11794	11561	7197	11386	2607	9614	1643	11100	7336	4389	1201	10178
377:	5305	5158	1726	7617	8705	4366	12092	7504	11434	7904
378:	7791	5199	11173	10410	12364	4074	3537	6151	741	762	3820	3868
	1629
379:	8873	4792	3802	648	7890	7159	3112	587	9007	3183	1698	6097
	6555	5115
381:	3204	9368	2597	3132	8678	3380	8421	9867	10548	4247
382:	11124	1434	12462	4719	11190	12213	1457	10349	5414	2201	629	10253
	2904	9701	7085	6219	4861	5765	7175	4363	6087	12403	5209	644
	5425	11916	8134	11897	11316	9508
383:	8186	6269	9355	11705	5262	10621	8036	3610	2124	9722	3871	1741
	3293	9385	9781	6364
384:	10959	5098	5436	9777	2795	3974	11831	7152	1401	6574	7742	1793
	5222	5508	6900	12449	9310	10787	10837	3205	11388	9547	12014	4307
	8890	8402
385:	11531	9198	6864	9815	8024	9374	1209	1771	9211	8255	6256	9337
	10996	8496	7172	8276	9452	1945	4713	4611	9224	864	7916	3171
	5590	2342	6484	9458	9525	8711	5971	6313	3830	9611	1348	7495
	11484	3667	1068	10307	11676	7425	4337	3776	2715	11741	8903	3713
	10572	2520	4409	4568	9662	10575	9713	4522	4201	9353	936	7455
	3127	9055	11472	2804	2485	5992	7546	5787	1614	12272	820	8199
	7565	11045	5264	1051	2219	7215	5054	4622	12247	6046	729	7607
	4563	2792	2126	7328
386:	11268	6449	4644	5349	12159	3613	7832	3553	10905	7536	12202	990
	8235	10686	2456	2603	2327	7754	12260	3458
387:	2041	8848	2909	5750	7062	4627	2566	7094	2141
388:	817	9679	3392	4988	6465	10879	9281	11631	1000	534	10133	5512
	10286	2050	7915	1818
389:	4812	3006	2832	11649	3536	8821	10336	12335	5851	1395	1668	4183
	9732	3319	799	2877	8991	8968	770	5606	12115	4496	7805	6408
	6388	4134	5270	827	7072	8775	9001	7871
390:	12454	3012	6026	11219	4005	8748	9818	11892	12191	2496	6715	10737
	12145	3276	5188
391:	8545	662	1325	8282	5909	2352
392:	3087	1402	9975	3048	11515	5142	11356	11860	8331	1322	9492	4784
	2179	2266	494	4286	794	10808	5496	7186	3629	9467	6453	2769
	678	620	3062	4408	7878	8400	7106	727	6473	9963	2035	2329
	1505	1184	9006	586	5387	7630	8564	4111	10667	2540	831	8752
	8741	4285	6108	4478	4676	10888	11470	8906	11374	9804	11082	12059
	10716	10951	5568	8984	6565	5677	5668	1692	12299	9991	5144	10080
	3759	7077	10211	4790	4990	5612	8143	1228	5168	3596	11402	7494
	8578	10799	9580	4424	7560	3595	6156	5757	4823	9770	8546	3396
	8716	983	9875	5474	9798	9660	5632	10938	8351	6228	1658	5249
	1655	8782	11119	4708	5361	3238	6045	7505	11188	1130	5358	2458
	572	11949	11349	7315	6368	10143	6467	10184	7817	10408	9191	10195
	3913	5575	2363
393:	5476	3156	7848	2476	2917	2879	3307	12433	7564	3663	7337	5783
	8492	653	10313	3936	4150	6230	1268	618	12371	6907	4781	10328
	5762	7523	7610	3953	11848	8038	5291	8207	8717	10645	3175	10077
	5355	7843	12205	675	8025	10802	4230	7442	11996	6699	9826	1847
	1129	9828	7023	9128	7245	5886	8159	4379	7579	4577	4293	3338
	6458	3801	5160	6767	5447	4196	5382	6407	1389	11917	10248	2377
	740	10316	4945	3203	7608	5178	553	2461	2973	10111	2127	4848
	1026	11706	10753	10183	11627	9775	2703	7978	2569	5828	5451	12455
	1456	11283	1701	8844	710	9094	3956	4188	3166	6451	10587	6671
	8321	11032	8064	10543	991	3456	5983	8160	8490	3876	3675	3848
	1007	7687	780	10198	10170	9502	7586	4377	10544	2163	4597	1857
	4260	2760	6049	6397	7101	7829	3057	11110	11974	2218	830	1965
	4585	7985	5385	3665	11516	1085	8026	10270	8959	677	4810	4525
	8508	2647	10777	11654	8066	3608	8630	5491	9485	6865	11842	3552
	7034	11656	11707	10172	11547	10144	10762	11451	8610	12102	10271	8345
	6410	4709	3036	11819	1441	3088	1483	1727	12139	5187	5912	7309
	5324	6561	9499	12155	7758	8109	6547	7609	2043	5351	7456	5256
	8175	4504	4817	512	8191	5510	8969	6036	2631	12120	9623	627
	3298	9413	9691	6673	6028	6089	12168	8409	1374	1143	1523	1957
	1239	964	8785	4339	6876	10707	3619	1937	5233	5129	9195	3743
	12420	6343	1970	10813	10784	765	9308	3751	556	2539	7584	11347
	4941	8101	11764	2087	8554	5556	8656	5011	8371	6231	9375	1688
	1277	1863	6863	2464	8658	6914	6506	5975	2599	4775	2970	10102
	4056	11171	6469	4664	5520	4233	7877	11046	10362	7882	3399	4648
	11663	8204	5826	6600	7417	10655	2645	5846	11520	908	7676	10289
	6927	8934	1600	2256	5082	2966	11209	8256	5100	5234	7616	11269
	4679	6851	11874	8281	6417	9440	8060	4903	11306	10096	7188	3960
	4609	5752	7834	6130	9279	5037	4499	8894	11304	3703	9835	9539
	2198	11027	7792	12223	9024	7561	506	2965	11735	1324	2059	3597
	5933	7100	11400	7740	8760	4225	6430	12071	11429	9553	7828	10142
	2328	9801	8953	2978	7185	8005	2047	3834	9754	12283	4712	10223
	8557	4996	6289	10585	8497	4486	7374	3069	4157	12169	8806	8617
	4723	7812	10588	3480	8341	5952	1251	8110	1019	11680	2191	9276
	8947	2803	2269	10226	3199	4629	8357	1356	973	4949	7777	5004
	5617	2910	1088	1131	4382	8944	4557	4576	7734	2385	3453	914
	4305	12150	6718	5647	9307	3749	555	12257	8626	5808	9903	1300
	7723	5794	3600	3572	12280	9079	6828	2662	10017	2676	10406	12128
	10605	6838	11469	6107	8242	8927	4901	11985	10954	3043	10030	10822
	9993	8485	6944	5708	8339	3658	11312	1715	8106	3436	5946	11078
	10835	962	6414	6168	1486	8813	8569	8218	9842	6652	12194	7813
	12243	1391	12065	9965	8869	2811	4663	5729	10447	1650	7956	8517
	9796	4943	6065	11108	2099	7220	11806	7844	10633	10898	7691	10676
	11939	2085	6287	11789	7317	9670	5329	1498	8582	3824	2027	9148
	7379	11715	5373	10207	8534	7177	4948	4624	11841	2311	2071	5014
	10889	11736	1357	3007	1412	9396	4515	11403	6535	6006	3561	5265
	5932	8572	2034	5253	1973	1662	6198	3688	10809	1225	3208	3638
394:	9790	5879	6253	4178	7414	668	3932	6039	9240	6497	707	1809
	11817	7266	10531	1832	5033	3501	5124	9856	7284	3779	1313	4142
	1504	1828	5364	11080	3912	8681
395:	2323	4956	6172	1800	10801	1060	12405	2783	8187	1288	1426	1541
	7327
396:	2709	1262	5083	2123	6530	9041	4778	2821	7509	7002	5183	8935
	10971	3687	4584	7122	1820	1513	2355	6762	5579	7856	1115	5240
	3881	11329	12212	12006	766	10294	2974	10120	11070	3994	5346	3478
	10739	2935	1476	9938	11383	2621	3950	9141	5528	5357	11499	745
	1034	9885	1645	7498	1798	10268	9242	8855	6677	12391	6300	2625
	3980	8755	10123	7014	12133	2946	2967	10063	8021	6070	11870	1898
	3474	2387	1138	6433	9405	9703	9665	1874	4997	11912	5823	604
	8941	9683	6637	12124	6925	8278	9421	10643	9728	11590	3033	10708
	9776	8259	2133	7201	3141	5604	1622	8625	10177	6435	10473	9584
	2288	4984	8665	9021	8432	687	6024	12375	4604	582	12078	4508
	9765	6109	2262	7347	11526	10717	3324	4304	9063	4731	11766	4550
	12438	9125	3246	4523	4740	6617	6217	2075	3723	10468	7469	11216
	4467	6684	6929	3341	7729	2494	8780	9642	5236	2642	9639	4643
	7255	10492	12091	6586	2507	1360	8408	9606	8925	9280	4050	5290
	6048	1344	5480	8533	9429	9377	3814	9779	9289	10403	12121	9222
	7784	11901	5095	9111	3096	9372	5032	7728	10242	9788	3704	3808
	4797	4656	9489	10368	9621	5816	1339	1111	1964	11335	8067	7935
	12239	6505	10285	3691	9985	5843	3202	4605	7470	11265	10983	6195
	11511	577	8370	3313	2388	8463	2255	3614	1759	5093	8364	11117
	5702	4264	6761	6682	8829	7402	8431	11858	656	8007	9145	5063
	3174	2324	4303	3792	9884	6775	6001	7675	9634	9313	12028	11308
	3159	6974	9168	5749	3021	10836	7671	9461	9910	4300	11055	8265
	9140	312	3955	1431	2547	11090	10475	1447	3005	10528	9968	1287
	11505	9648	3745	8077	8329	6678	8177	7182	12399	8672	11808	12050
	10956	4702	2366	10340	9869	6899	8192	11495	5245	6132	1730	1207
	1466	6758	3193	9040	632	3671	7925	5595	5108	3071	1253	9131
	3977	1966	1103	11163	5831	4583	12383	4593	7113	9309	2862	11829
	6185	7597	10496	585	7603	3798	9118	9291	619	660	12183	3679
	4463	2345	4214	7958	6700	3735	5190	4957	8042	6476	6812	748
	8888	12104	3902	6187	3251	5321	8124	2102	4539	12077	3925	3859
	2490	11859	10721	6259	11136	6176	11198	803	11343	7496	11610	5936
	4494	5353	8726	11033	5761	879	5433	11442	6639	7136
397:	11768	5972	8910	6923	1071	11851	3710	1869	4352	10083	5081	5356
	11051	2289	4439	7568	5405	4287	12135	2238	2944	1840	814	1365
	11685	7720	2450	9029	835	6444	12097
398:	2241	3444	6018	956	10922	12070	7756	10305	2233	4152	1831	2888
	9085	7130	9343	10869	4488	8664	5915	1687	8817	11945	7519	11722
	2340	5215	5565	3125	1158	10459	10104	9271	3962	6008	3648	1644
	7928	2589	7139	11905	4777	9004	1700	11514	11036	4652	4910	8706
	6911	5860	8837	12199	7806	6227	4073	9973	2733	11001	4677	8312
	7287	10325	521	6781	1491	12453	10517	2560	7057	3111	1821	5721
	7273	704	12186	2164
399:	548	9300	9554	7547	8636	11881	4081	7368	10874	7147	4338	2672
	11463	897	5276	4009	2799	1012	1575	5022	10933	5070	6434	8834
	8406	5201	8190	12049	8181	514	4751	691	1767	6329	11877	1680
	10586	7377	2658	9232	480	8714	4954	3145	7995	8236	3581	6223
	10411	5267	7422	3748	2852	8424	4634	6391	3124	9163	5748	6437
	9868	11575	7517	10741	10982	8916	7693	1140	7885	554	7514	3442
	1603	5029	5123	8183	4909	10055	4431	5473	7168	4270	7849	7531
	5394	7411	10616	3995	2860	9151	4699	2282	8849	8250	5746	4599
	6543	8198	12459	12279	607	11063	1212	4450	2899	3979	9037	8939
	2885	8016	6074	9176	4764	1418	6932	7599	640	4267	10800	1961
	1175	9484	1927	6577	11918	5133	8223	3567	5066	1789	8592	9415
	1359	9807	9047	4922	8086	988	3032	2572	12081	9637	4095	2630
	6483	11583	5674	11611	9987	8434	6803	8317	8909	2060	9595
400:	3594	5858	6163	8162	5298	6877	9676	7641	7335	11393	3236	10613
	8880	928	5961	5117	5323	11677	7040	9672	626	11053	10989	7333
	4094	8536	10370	10189	6608	2659	11501	2780	5252	1180	2806	611
	5273	698	9186	8885	813	8008	11483	1722	5973	3970	12157	3681
	5384	1502	5038	7864	9886	12360	10487	3582	6067	536	9997	11573
	4836	5853	11038	2661	8809	11980	1396	1350	7475	7888	12350	2466
	6947	6793	9650	10087	11195	5024	789	2707	6485	8289	5193	1462
	7392	5069	12069	10754	4717	5452	9067	5340	7623	3952	5417	11597
	3826	5648	11720	4998	9061	10975
401:	11218	10912	3778	3297	9967	6495	12167	12233	9791	6623	9588	10369
	11113	1522	4935	3583	5697	5283	11315	1860	9530
402:	7156
403:	1556	906	2463	4200	3646	6052	7351	7138	12208	3362	5601	4063
	9933	10137	4783	7869	11375	3335	6733	12390	11524	11659	8359	2685
	7053	12265	11011	7166	3975	11317	4015	4255	7397	5041	12284	10201
	8893	10113	6482	4013	11697	6646	7815
404:	10847	2334	10082	10701	2901	11454	6589	5539	10131	6475	2653	10407
	4346	9358	3370	3643	685	3626	10187	1272	7016	3516	12325	8216
	1736	7213	12278	12341
405:	4331	4736	7999	9625	7541	3731	10849	4158	11047	2576	2894	9714
	4155	10797	3770	8814	594	3515	7669	7539	7108	1782	5440	12122
	7376	5681	4269	10893	8383	2313	9571	9251	793	5819	2865	11777
	11121	10635	4551	8870	7765	6238	1046	8072	6340	5533	8503	3172
	9743	9558	7818	2335	4582	2249	4863	7646	6380	2304	9881	1855
	5057	11868	9613	2480	8523	10079	10398	6542	4114	8769	8798	4484
	2217	6122	4417	2193	4381	10252	4498	11771	5626	7095	3326	7825
	11761	12245	6606	3489	1155	10949	5767	7861	11486	9381	4554	2297
	11621	12066	10744	8732	5582	6819	9146	11127	4109	515	550	5855
	4340	1648	10402	11498	9972	4832	3467	5797	2114	3395	9179	538
	5186	810	3386	1331	631	9471	6946	11710	8206	2521	3777	9766
	1713	3653	1921	6656	9947	8993	11250	11151	10497	6934	2737	6862
	11088	3984	7363	10282	743	9608	3919	1981	7086	1454	4396	5114
	10991	4459	7881	6848	2296	8912	1805	3511	8065	1761	7132	6910
	10730	5195	3930	9587	3635	1390	3281	9154	12431	5562	2544	11742
	904	5957	8429	7356	9493	881	10094	1121	5637	7367	5392	898
	9656	6463	3636	11365	2616	8771	11943	8085	8559	11564	4481	10783
	8994	2809	9583	9144	8425	2285	11557	4876	12312	4919	7482	8180
406:	12179	1132	4407	8525	8006	6599	6212	6582	6696	10015	8938	12040
	7174	5901	5443	8772	2754	1018	701	4168	3866	2830	7410	8541
	4867	12127	4786	2881	993	1626	10257	590	4613	3686	8232	10988
	8611	6659	11951	11970	5790	694	1950	8687	3243	1611	5068	2583
	3374	11300	4978	3290	4685	9245	8524	3226	3564	8297	5791	10743
	5514	12404	4160	10761	6264	3455	7381	4530	7088	11724	1340	12221
	3372	2172	9900	3009	6215	8149	5967	4031	516	2159	6152	2119
	7625	5636	11581	10329	3927	6951	5300	1666	5792	7176	1908	8776
	10334	7755	4489	4839	7621	3504	11772	2455	1709
407:	5164	1712	2856	7349	10914	10129	568	7679	2988	11811	1995	11589
	10850	4503	1298	1746	8590	10650	7429	10880	3268	11798	7896	3503
	10856	11820	7004	4010	6035	12068	5519	12333	1022	2020	5260	8174
	1100	6002	852	2265	1280	6971	6023	3217	9083	2999	3784	5278
	5773	11107	2778	9893	1283	4999	9158	4760	6513	10372	4789	8368
	7638	5532	1078	3476	2773	6243	7947	7219	3013	4542	7485	5050
	10180	2741	9397	7909	12344	8653	8161	7700	6270	10424	9386	12053
	2551	4239	7195	5742	2563	10387	9943	10591	12293	8401	598	10190
	1518	3262	8393	9357	3753	10634	8622	792	5503	6749	5779	9627
	8899	894	3609	868	2666	8379	7943	6084	8171	5415	10619	5830
	8058	11606	6777	5615	8744	8385	6352	5732	565	3042	4825	6372
	11714	8638	9414	6904	4707	3698	10607	3354	3248	11099	7933	2618
	7997	9721	5710	7081	1067	12401	11254	3611	5832	6837	3494	8037
	4520	10630	9206	9326	10451	1194	12033	1368	10356	3752	2069	4191
	11510	2671	4989	805	7527	10679	2579	9477	4068	9127	5744	2044
	3843	7704	8248	1156	6991	12007	10035	5766	4610	11421	7453	8264
	2829	2728	5859	4491	4669	6872	10873	11437	4497	1179	6983	809
	680	11745	10224	2441	1029	3485	10593	8293	11196	4444	787	9912
	3466	12067	11522	11328	11168	10705	3103	11637	7146	7013	12203	7272
	11183	8872	2339	3689	4671	6439	1564	2891	2326	10816	2058	9167
408:	6842	10832	1752	6874	7594	7652	10728	8591	5091	1745
409:	3390	11580	1139	2740	3398	7297	8096	11461	1994	9590	10039	4519
	1327	5914	1924	498	2711	11643	2492	10450
410:	2556	8787	2810	2752	4019	849	2525	848	543	10440	5587	2687
	10565	7329	4633	10365	1469	1013	9911	6199	5552	7253	3387	6581
	6753	2212	7451	10191	9661	10472	8604	3947	1318	10341	3903	4192
	782	4804	4555	7605	3606	5072	11652	11756	10926	3556
411:	10755	6544	11218	10912	3778	8555	12233	12167	9791	6623	10444	9588
	10369	5824	9682	7746	5706	11642	9212	4935	5697	8715	5283	11315
	4900	12457	858	10937	9530
412:	4734	2240	9031	2437	8481	8643	4962	4203	7203	10390	10086	5814
	11371	10513	9742	10945	9859	1632	1615	7063	11339
414:	7193	8549	8168	5092	8861	11989	11947	11178	5786	2453
415:	6653	6714	9983	4083	3854	2748	7708	9764	5629	981	3439	10469
	7346	4782	12349	3163	8949	3899	5805	10540	5864	6450	7761	12090
	5874
416:	1842	3162	8971	3427	6054	10217	8729	1754	6622	7952	9382	11862
	7142	634	7239	8770	4506	8586	1200	6367	2113	12058	3323	6474
	3605	8047	4705	8976	2623	6722	2275	9503	11414	7230	487	7173
	6327	7450	1086	11139	10969	7580	6856	10788	9715	4755	2923	11730
	12425	3020	5599	9044	7078	10584	11212	10871	2684	1969	5930	6055
	4070	639	11128	1295	7529	2775	2543	11636	6598	1208	6425	11359
	3998	6252	8348	11758	8667	7592	6546	11716	6560	10277	7395	10601
	9873	5107	10240	5208
417:	6345	1856	10958	11096	10013	593	11755	7187	6816	10906	1199	5652
	8452	7056	3701	11373	3562	12181	2950	10597	8606	5254	8728	4082
	1210	7300	3896	12382	9952	788	11241	10507	11750	3136	6728	9465
	3722	12351	6337	3008	6858	573	10437	1050	3645	9808	9256	2509
	11883	4020	11479	3254	9727	4044	12460	2628	12255	8136	5704	7735
	9066	7332	5711	4229	1182	1576	3656	11805	11485	6960	6101	2011
	8111	6996	4209	7129	12307	481	8243	5287	7912	10962	703
418:	3811	5219	1679	4621	4127	10675	6404	5800	3921	6511	9681	903
	10538	3558	4466	6175	10545	5132	2921	5857	12143	7941	7286	11968
419:	3771	8363	9548
420:	1485	4911	7178	9071	11509	6647	1721	4460	947	513	2348	7249
	11150	11747	2997	11191	11443	3662	8453	2753	11791	6481	11420	5483
	10462	4788	4507	8877	4008	11334	8575	6731	9135	6192	2317	608
	5979	3055
421:	4414	9504	1165	5341	9784	11748	9107	10327	1525	12240	10723	1910
	11286	6078	6558	9736	7526	9617	6173	5966	5586	6120	2380	9205
	6319	7575	10097	11594	8356	9671	2500	4722	2986	4959	6245	3949
	11353	2855	9054	2577	7071	5896	11794	11561	7197	4389	7336	1643
	1201
422:	6674	12454	8443	3602	3012	6541	10495	6389	2952	9267	11311	12145
	10737	9521	3700	3883	6429	4242
423:	3471	3462	11861	2211	7320	5075	4333	1836	6400	5796	4892	647
	3269
424:	5926	9559	5422	9498	5418	11106	3035	6102	6592	2150	8390	6071
	7591	11796	9586	11310	4368	5758	588	2542	1781	12236	9803	7747
	10979	927	7683	3965	4678	5214	2604	8270	3304	5616	10831	2393
	8080	4535	3410	7371	11565	2493	7055	9785	2720	5980	10682	7295
	10506	2982	10793	6985	8126	6218	11609	12193	2042	12304	2254	11445
	7375	2510	8946	885	6891	9150	10623	9341	8952	10725	6292	8420
	4743	1894
425:	3122	11494	10549	2650	1897	3804	5390	1379	3184	3716	2654	10037
	1473	9971	2731	5778	4313	6129	9561	10606	10693	8120	4938	4049
	4060	4413	3409	3015	2351	1939
426:	11847	2995	4737	7277	3895	5688	1959	4452	843	6336	3128	11563
	2964	10486	7718	8069	12080	6015	8205	10512	2963	888	9812
427:	10318	1515	1150	11130
428:	9750	6331	3027	10875	3668	7005	9306	12430	6106	9190	654	1670
	9862	10048	4319	7716	5492	6892	9026	6462	6737	6645	4749	10098
	12000	547	7562	6456
429:	6568	8052	10608	1308	9065	8831	7384	8709	7350	4327	10609	12288
	9820	4100	4795	11684	7622	9929	1098	3192	4059	9182	8353	9417
	7137	5152	11660	2940	11467	2933	6145	5109	4388
430:	8584	2261	7656	2018	11538	9342	12107	12164	6293	7936	1661	11624
	4853
431:	9116	2171	7602	8690	9883	4473	6085	10435	6301	2203	9928	7190
	10147	10470	1862	2182	932	3025	12251	8266	7662	4231	8640	12434
	2151	4372	1033	9126	9810	3495	509	7612	5354	10770	10651	987
	9365	4813
432:	7570	5554	4754	8362	2230	8469	9220	3329	6080	4356	9349	7994
	5043	887	9216	8097	4101	3358	10171	3190	10790	1501	501	2633
	8399	9527	6324	3571	7233	5016	1930	1811
433:	1616	6093	10298	1333	9124	11229	6566	6576	11833	11357	8833	6618
	841	5759	1301	4182	6040	11022	8365	7079	6280	10112	7920	4834
	4980	3886	8075	5735	8404	1617
434:	4462	1934	5148	10841	4816	5523	7587	9228	2939	4241	10393	11815
	3818	4301	11539	1425	3957	11067	6304
435:	7874	3332	1892	10839	1297	5020	4526	2872	6273	7274	6987	11568
	2916	5869	4913	5518	8150	7269	4374	7658	5945	5159	6063	4277
	3391	8028	9423	9197	2132	1694	3525	11460	1307	7893	12353	5297
	10567	12185	11482	4069	10140	6113	4710	8613	942	9030	12386	1875
	7823	6994	10615	1377	3165	1422	2346	944	7149	4721	9942	3253
	9534	8437	9109	6583	8269	5181	3727	2785	11616	10928	6013	3851
	6779	11345	3888	8115	12234	1593	11166	5064	9064	8068	2920	11723
	1292	3068
436:	6347	3468	11338	11409	12270	6989	2546	5731	6603	9120	10134	11132
	8045	3411	9970	4217	8868	6022	11364	7706	8499	10764	2259	8466
	2660	11256	10381	4994	10726	7766	2412	6096	5641	505	7223	9020
	3178	1876	7265	3623	6409	508	507	1016
437:	684	7280	11639	2549	7965	8231	10595	7331	6105	8144	9633	2093
	9958	4276	11512	2675	4465	7787	11641	10917
438:	9852	9813	3420	3677	6942	3277	6017	791	7627	11435	3897	5927
	4207	7673	10919	8597	10213	7914	825	6981	4752	4018	4039	11441
	9737	9811	643	4090	4666	4546	6461	2864	1198	10505	1414	8510
	1332	9632	6508	9748	5207	7702	3747	12087	3357	9406	3417	4104
	3657	3772	11104	8237	8514	8436	2571	4116	3922	8122	6209	10639
	693	732	4062	7892	686	3094	3499	3000	2167	6655	1509	10401
	1427	1579	2802	9356	8013	6206	3904	7261	9433	934	510	6382
	8330	9157	10376	9699	832	1479	7796	2553	7440	3791	1738	5177
	7444	12266	3261	1236	5344	3157	5577	4289	9028	2374	9986	4510
	5313	12252	4434	9805	4625	2489	1554	2057	8415	7724	6950	3790
	10071	1888	10647	2936	9844	6590	642	5953	9569	11882	6358	2897
	2797	5667	3259	1008	2009	9475	11260	1252	8074	3306	4480	6785
	10892	7801	2478	12060	10181	10457	11313	11251	10961	5398	11091	1021
	8867	11189	2479	1526	2174	11424	6658	4950	11613	12337	2055	4096
	11784	5724	6115	11058	9979	6460	5035	6730	4923	6381	6683	3081
	6021	11093	12172	6580	7672	6698
439:	9050	1624	11490	9137	4683	1472	11419	11201	12153	11407	2333	8918
	12149	10769	2801	9090	6033	5211	11474	12365	5630	12100	6330	2526
	2036
440:	5951	3216	9673	4696	9814	3530	10953	5785	720	6518	1693	11588
	10246	7120	5040	10911	11834	8071	11378	3196	5717	9753	5644
441:	7707	8538	2341	7194	5074	5690	2147	2538	9725	10428	4880	5920
	10970	6335	7744	8342	11672	5446	6675	8117	1618	6922	6664	1708
	10501	3809	2321	1477	3404	8823	5288	1911	4926
442:	11879	6492	3887	756	4733	6158	1728	5673	5481	11069	12381	1890
	1649	2930	2784	6431	1020	3078	9576	3232	7334	2622	4189	8439
	3249	3593	4179	4841	5713	12338	10718	6823	6695	3315	6663
443:	2994	605	1631	6296	1844	11844	3084	9395	1933	8702	7786	11988
	2128	10660	5251	6665	7785	5248	9981	11142	4174	3452	3303	12156
	4698	12118	2699	12096	7773	10611	2953	5956	12178	12170	5672	9916
	7788	4953	11739	4556	6260	11846	3109	8488	8674	9574	8624	3734
	11566
444:	11436	9600	4036	2771	1190	6072	6982	2138	5753	5102	4767	7415
	9797	5570	7192	1387	4343	2370	5680	10618	5872	3634	11291	10696
	1986	9618	10628	10894	1404	5877	9827	6200	1273	9615	2105	6034
	10168	4940	1734	8417	8948	3019	8808
445:	5898	11158	5363	4614	479	7670	4772	679	6014	3641	11608	11120
	8644	8810	9334	12142	6025	10895	5777	923	11900	9914	580	1904
	3473	8157	9546	10735	1346	4635	12408	5326	10987	4765	12292	2408
	3705	11060	920	10127	11506	11960	6468	2264	2469	7344	5771	9604
	2225	2423	5614	6255	4052	3890	5154	4753	2006	4144	913	1893
	11578	1641	10844	7418	4406	8743	3664	7010	6263	9188	8333	11184
	3586	7119	4592	10897	1543	4041	3967	10446	6161	8214	9019	8506
	8178	8166	2609	6272	11990	10220	10720	4720	1372	8999	5687	1064
	2764	7876	2726	10484	8618	8445	878	11391	5389	1532	4482	2194
	5970	2854	1329	5025	8114	12116	540	8209	6786	1605	3796	9500
	6774	2846	6204	7569	9752	3423	2248	2665	8972	12410	8446	3821
	8648	9439	6312	733	11327	2605	8876	10319	7537	5908	4987	9013
	3443	9602	12276	7661	1274	10200	5396	11003	10042	11749	8121	11076
	9974	11026	1419	10891	1463	5977	2460	6881	10165	3756	2451	5549
	1517	2237	9215	4893	6903	10551	603	8871	3933	7551	7660	6459
	2448	10902	11799	12162	11708	5866	3938	11582	5019	9219	1223	2361
	3750	10152	5770	8615	4412	7727	1552	5097	10590	6782	9346	10110
	8347	1399	4798	8063	10203	7369	3212	3929	4222	2932	2814	2808
	4003	6572	10580	7424	7144	10581	8029	614	12041	9422	11418	7355
	4890	9654	3858	6591	526
446:	2763	11630	10646	5423	8132	999	1338	3592	12392	1695	1880
447:	5756	4298	9204	3118	7348	2187	6044	11528	3135	8988	3176	11446
	4858	5386	6613
449:	12062	3366	9305	2281	4123	4637	8367	769	2719	4653	1084	7458
450:	12147	9257	3555	5006	5380	3990	699	7196	8444	1317	486	5669
	9008	10806	1852	3245	1913
451:	7961	6784	10385	12354	865	6268	12456	4879	11331	1843	3415	3457
	8727	9428	4065	1063	1920	845	10276	6165	12385	11052	4847	4310
	4673	2038	4649	9641	2122	7093	11894	3047	6855	561	8107	4273
	7069	9794	9178	12356	1917	6681	10830	10176	11333	7035	11763	2291
	9680	10796	6237	2745	8942	1107	5551	2354	8913	5062	2272	10205
	6966	8747	11111	5876	5902	9949	12045
452:	6394	10174	11264	2929	1796	12463	7434	9390	4194	2477	11245	3690
	1838	5530	1929	9136	7237	989	11473	6317	11703	7760	2499	9922
	7259	6310	2561	2364	10199	11466	796
453:	6394	10174	11264	2929	1796	12463	9390	7434	4194	2477	11245	5530
	1838	1929	7237	989	7421	9348	1044	4048	10219	9509	8398	5286
	5871	11487	980	7210	816	796
454:	6625	1795	11957	10600	4695	8786	1854	826	8093	5089	8783	5261
	542	6979	12146	11354	11208	4567	3736	3070	3227	2154	7613	9181
	2375	7852	10957	10358	4616	8853	2165
455:	11314	10125	5372	1221	9486	8375	5654	7809	1768	3229	4762	10599
	4701
456:	8762	11259	9107	10327	1525	10723	11286	8082	8795	7526	1751	9617
	6173	10210	8996	5165	9994	10981	2651	8924	5646	10734	1043	6503
	7160	674	10942	6208	2500	2232	5435	8003	7775	7197	11386	9614
	7336	4389	1201
457:	6933	2534	5034	10920	4668	801	7463	9241	4122	10093	8480	1669
	4875
458:	12340	917	2331	6174	4354	1998	5058	11006	9105	6744	12417	3551
	10011	2512	3369
459:	1750	2582	939	7800	4167	10863	1778	3187	3119	8688	9519	7715
	3465	8518	7218	3654	9851	3214	9839	8754	11131	3785	10516	5456
	1066	9161	2498	7968	4449	8957	11214	11622	11993	12161
460:	3393	11215	6311	8704	11428	12454	7996	9854	1062	3012	10737	12145
	4242
461:	1596	11261	12367	6847	9799	1697	3584	4419
462:	2559	3211	8719	9526	912	8678	9169	529	7339
463:	8985	11453	9101	1592	996	9514	8633	664	10466	11427	8230	2310
	3910	4193	2788	12130	1565	10560	8540	6384	11084	4965	9345	1623
	3579	12441	9119	1042	3490	8581	6214	7907
464:	5490	9114	10657	1047	9324	2641	3532
465:	5468	6657	4173	4351	1080	4899	8973	2817	10047	7847	1370	2389
	11692	10139	7089	6369	5848	9153	2447	6533	10312	3428	12166	7229
	12336	1718	4369	11599	3520	1903	12300	1482
466:	1224	5723	2541	11729	5963	4598	5738	2220	8201	5996	11234	5067
	943	2089	10322
467:	11200	7567	3580	4845	2181	10852	549	2202	11686	1089	7836	9898
	1118	4587	4761	11028	7798	9104	8548	7649	5889	1358	3846	12287
	10700	8601	5442	2137	10267	7042	2634	760	1406	9108	5922	3789
	6004	4198	10766	2454	3807	12306	12290	11237	9088	7917	9288	7212
	11361	1586	3575	1993	5292	10350	12258	2782	5845	8104	4936	9246
	10103	7474	1873	6809	9171	12400	6038	9410	2560	5403	2736	8012
	1197	1859	4317	1762	11062	1788	1589	8632	12112	7865	2796	10617
	1478	3978	7405	8958	12158	4314	1096	3383	6169
469:	6501	9978	9506	8048	6041	11554	7940	1311	761	9444	1675	9956
	8980	3509	8369	7051	10464	4793	9243	11137	9702	650	2162	2318
	8547	5167	2224	3189	11426	11921	12073	5571	10065	11294	1231	1534
	12094	1787	5994	2871	3170	9945	1211	6776	5232	9755	3346	4529
	7769	10952	2907	4108	1825	8189	9705	2337	5815	6517	2024	9712
	7508	10391	12009	7433	2870	5210	5086	1723	1765
470:	5084	11194	9575	8315	3179	1987	11812	3976	3760	2762	779	4164
	11691	10789	12264	5656	10659	2104	11167	8323	4400	10935	5221	5623
	921	3463	10656	10670	4215	5379	2522	6418	982	7059	3322	7858
	9733	8620	6578	6976	10694	5052	2725	5937	3180	5594	11700	8684
	4226	10509	12384	11783	11615	3194	8836	3058	4838	1075	589	6318
	12032	4746	6787	9636	2112	12444	5488	10076	9098	4011	2926	4776
	8892	12036	1627	1229	7868	12227	4806	3425	3106	5517	5569	2805
	6222	1072	3265	7386	6709	4420	8943	8561	11384	4492	6943	7513
	5489	11412	5620	935	4602	3992	12126	4524	5295
471:	4125	2643	8914	5741	7486	11181	7454	1438	9051	5051	7954	6066
	1495	10258	12409	2931	2998	7574	8519	10264	7534	797	3773	10985
	4080	10803	2516	7845	10965	4601	5002	7211	11852	3999	6602	11085
	5772	3149	11134	10624	1896	11243	5259	3993	4281	1326	4033	3299
	1465	9045
473:	1243	1128	2040	10378	8222	10746	10012	7467	5079	1528	11934	8515
474:	6601	527	2379	10196	6137	8682	4571	5965	1720	11962	7324	6890
	2000	3989	9528	2837	979	1830	4658	5140	12206	7572	11257	3730
	3247	9845	5430	6818	11818	9582	1443	9531	2032	12196	8459	12235
	1905	7764	7158	3049	7860	6184	10022	5125	11754	776	11248	1635
	11123	3134	3576	12200	1437	2294	10118	5180	4802	2992	6519	5231
	2482	11465	7884	2815	6520	12103	10061	758	8634	12134	2903	10025
	5634	5303	4014	11481	2853	4147	5919	1025	8579	11370	10373	9451
	7816	8473	6909	2056	1942	5495	9556	941	11202	3129	11586	7180
	4318	8652	1094	12057	8148	3547	1039	1685	7743	3838	11056	11872
	3487	6540	4865	2136	12002	1735	7894	5527	9635	6171	3419	11976
	11116	4202	2787	3857	11185	8493	7897	9631	2132	5397	11537	4725
	9882	10003	7886	11920	8820	1566	8009	6859	5036	1810	6339	5982
	10204	6829	5887	11503	1164	4505	10947	7478	11732	2729	11967	6906
	1181	12106	7401	8306	4315	3213	2969	11177	10260	11850	5333	4769
	3231	10237	11065	11935	2196	9700	8932	1776	4348	10232	2954	9540
	9284	6427	11488	1448	5878	4288	11911	1606	5899	2216	4930	828
	8456	8300	12173	1581	3969	3308	3733	8146	4107	318	318	10810
	10688	7258	3755	6413	3072	2938	1958	2013	3222	7116	9552	6743
	3633	5410	10967	9652	3051	4884	6438	2195	3521	715	11816	5080
	6811	11824	6148	7701	2120	2012	10779	7038	2714	1004	8131	3368
	8676	2320	7910	10733	11153	5976	2606	1254	10261	10527	6399	7022
	2373	12098	10524	11061	2677	2819	8155	8898	4897	3568	2061	2343
	4454	5367	5900	8137	9016	5191	9012	754	8169	1230	4040	9541
	8193	5427	7697	3237	10536	3816	7388	5399	11230	4472	3241	2168
	4442	3086	3186	1691	2369	9347	4435	6197
475:	2644
476:	12084	6235	4759	10347	8520	3926	9058	7491	1621
477:	12177	6814	4681	6355	5964	1174	7480	2252	11814	11423	4309	10760
	10292	8167	9787	1400	10173	5931	4566	772	6147	5362	2160
478:	8803	12320	5017	819	1756	7073	10263	8731	3488	5675	2434	11042
	2673	2990	11910	11377	1682	12429	12056	4814	742	2402	12165	7948
	11221	10036	10314	10977	4596	1323	10078	7929	3624	6883	3114	10477
	3389	8708	5663	6480	3774	3454	9482	11666	5598	6307	9709	5580
	4619	5929	3207	12379	6931	5030	938	7247	12101	7031	4907	11965
	10984	6905	6496	673	2777	5113	1378	10218	1124	4266	12160	10249
	6752	4932	11395	11015	5999	10641	6043	1035	12446	4184	9645	10931
	3873	12330	5943	5657	6916	7389	2698	3762	12075	9802	12250	5548
	6053	6457	11456	1634	12220	4794	8173	4037	6420	926	7361	2588
	7618	11802	10825	10443	7699	1560	11556	1176	8791	7303	9298	2851
	9247	11674	2279	8498	4791	8531	6303	635	1977	9577	5776	8512
	10792	7667	9612	3405	4341	7959	10860	3622	6528	8313	7205	4064
	9631	9594	968	10331	7018

Claims

1. Transgenic seed for a crop, wherein the genome of said transgenic seed comprises trait-improving recombinant DNA for expressing a bacterial phytochrome protein.

2. Transgenic seed according to claim 1, wherein said protein provides improved tolerance to cold stress

3. Transgenic seed according to claim 1, wherein said protein provides improved tolerance to water deficit stress.

4. Transgenic seed according to claim 1, wherein said protein provides improved tolerance to low nitrogen availability stress.

5. A transgenic seed of claim 1, wherein said DNA is derived from a Pseudomonas fluorescens.

6. Transgenic seed according to claim 1, wherein transgenic plants grown from said seed exhibit increased yield as compared to similar plants without the recombinant DNA.

7. Transgenic seed according to claim 1, wherein (a) said crop is susceptible to a yield-limiting environment; and (b) transgenic plants grown from said transgenic seed of claim 1 thrive in said yield-limiting environment.

8. Transgenic seed according to claim 7, wherein said yield-limiting environment is cold stress, water deficit stress or low nitrogen availability stress.

9. A method of facilitating production of a crop comprising providing to a grower of said crop transgenic seed of claim 1.

10. A method according to claim 9, wherein transgenic plants grown from said seed exhibit increased yield as compared to similar plants without the recombinant DNA.

11. A method according to claim 9, wherein (a) said crop is susceptible to a yield-limiting environment; and (b) transgenic plants grown from said transgenic seed thrive in said yield-limiting environment.

12. A method of claim 9, wherein said yield-limiting environment is cold stress, water deficit stress or low nitrogen availability stress.

13. Transgenic seed for a crop, wherein the genome of said transgenic seed comprises trait-improving recombinant DNA from a gene for a protein having amino acid sequence with at least 90% identity to a consensus amino acid sequence in the group consisting of a consensus amino acid sequence for SEQ ID NO: 240 and homologs thereof through a consensus amino acid sequence for SEQ ID NO: 478 and homologs thereof, but excluding SEQ ID NO:391 and homologs thereof.

14. Transgenic seed according to claim 13, wherein said protein has an amino acid sequence selected from the group consisting of SEQ ID NO: 240 through SEQ ID NO: 390, SEQ ID NO: 392 through SEQ ID NO: 478.

15. (canceled)

16. (canceled)

17. Transgenic seed according to claim 13, wherein (a) said protein has the function of a specific protein that has been demonstrated in a model plant with efficacy for an improved trait as compared to a plant without said recombinant DNA wherein said specific protein and trait are as indicated in Table 5; and (b) transgenic plants grown from said transgenic seed exhibit said improved trait

18. Transgenic seed according to claim 15, wherein said protein provides the trait indicated in Table 5 for a model plant-expressed protein which has an amino acid sequence which was used with homologs to build said consensus amino acid sequence and wherein transgenic plants grown from said transgenic seed exhibit an improved trait which was demonstrated in the model plant expressing said model plant-expressed protein

19. Transgenic seed according to claim 13, wherein transgenic plants grown from said seed exhibit increased yield as compared to similar plants without the recombinant DNA.

20. Transgenic seed according to claim 13, wherein (a) said crop is susceptible to a yield-limiting environment; and (b) transgenic plants grown from said transgenic seed thrive in said yield-limiting environment.

21. Transgenic seed according to claim 20, wherein (a) transgenic plants grown from said seed exhibit increased yield as compared to similar plants without the recombinant DNA when said plants are grown in a yield-limiting environment of water deficit stress and said protein has the function of the protein with an amino acid sequence selected from the group consisting of SEQ ID NO: 241, 243, 258, 268 through 294, 298, 307, 312, 345 through 357, 358, 359, 367 through 369, 372 through 374, 376, 390, 395, 398 through 424, 435, 439, 463 through 478, and homologs thereof; (b) transgenic plants grown from said seed exhibit increased yield as compared to similar plants without the recombinant DNA when said plants are grown in a yield-limiting environment of heat stress and said protein has the function of the protein with an amino acid sequence selected from the group consisting of SEQ ID NO: 268 through 294, 298, 347, 351, 359, 367-369, 435, 473, 474 and homologs thereof. (c) transgenic plants grown from said seed exhibit increased yield as compared to similar plants without the recombinant DNA when said plants are grown in a yield-limiting environment of high salinity stress and said protein has the function of the protein with an amino acid sequence selected from the group consisting of SEQ ID NO: 242, 258, 285, 298, 312, 372, 376, 390, 424, 439, 463 through 478, and homologs thereof; (d) transgenic plants grown from said seed exhibit increased yield as compared to similar plants without the recombinant DNA when said plants are grown in a yield-limiting environment of cold stress and said protein has the function of the protein with an amino acid sequence selected from the group consisting of SEQ ID NO: 240 through 267, 273, 276, 277, 293, 298, 346, 357, 366, 367, 434, 474 and homologs thereof; (e) transgenic plants grown from said seed exhibit increased yield as compared to similar plants without the recombinant DNA when said plants are grown in a yield-limiting environment of low nitrogen availability stress and said protein has the function of the protein with amino acid sequence of SEQ ID NO: 241, 315 through 344, 364, 370 through 373, 376, 438, 478 and homologs thereof; (f) transgenic plants grown from said seed exhibit increased yield as compared to similar plants without the recombinant DNA when said plants are grown in a yield-limiting environment of shade stress and said protein has the function of the protein with an amino acid sequence selected from the group consisting of SEQ ID NO: 262, 282, 295 through 314, 370, 427, 436, 437, 477, 478 and homologs thereof.

22. A recombinant DNA construct comprising a promoter functional in a plant cell operably linked to trait-improving recombinant DNA from gene for a protein having an amino acid sequence with at least 90% identity to a consensus amino acid sequence in the group consisting of a consensus amino acid sequence for SEQ ID NO: 240 and homologs thereof through a consensus amino acid sequence for SEQ ID NO: 478 and homologs thereof, but excluding SEQ ID NO: 391 and homologs thereof.

23. (canceled)

24. (canceled)

25. (canceled)

26. (canceled)

27. (canceled)

28. (canceled)

29. (canceled)