Patent Application
20210388375
The invention relates to genes associated with disease resistance in plants.
Crop diseases pose a threat to global food security. Genetic resistance can reduce crop losses in the field and can be selected using molecular markers. However, it often breaks down due to changes in pathogen virulence as experienced for the wheat yellow (stripe) rust fungus Puccinia striiformis f. sp. tritici (PST). This highlights the need to (i) identify genes that alone or in combination provide broad-spectrum resistance and (ii) increase our understanding of their molecular mechanisms.
NLRs are intracellular receptors which induce cell death upon pathogen recognition to prevent disease spread throughout the plant. Different modes of action for this gene family have been discovered over the past twenty years. The NB-ARC domain is the signature of the NLRs which in most cases carry additional Leucine Rich Repeats (LRR) at the C-terminus. Recent in silico analyses have identified NLRs with additional ‘integrated’ domains at different positions of the gene structure. These include zinc-finger BED domains (BED-NLRs) which are widespread across Angiosperm genomes and can confer resistance to bacterial blast in rice (Xa1).
In plant immunity, NLRs act as intracellular immune receptors that trigger a series of signalling steps ultimately leading to cell death upon pathogen recognition, preventing the disease spread throughout the plants. The NB-ARC domain is the hallmark signature of the NLRs which in most cases carry leucine-rich repeats (LRR) at the C-terminus. Recent in silico analyses have identified NLRs with additional ‘integrated’ domains, including zinc-finger BED domains (BED-NLRs). The BED domain from the DAYSLEEPER protein binds DNA in Arabidopsis, however whether BED domains from BED-NLRs conserved this function is unknown. BED-NLRs are widespread across Angiosperm genomes and this architecture provides resistance to bacterial blast in rice through Xa1.
The genetic relationship between Yr5 and Yr7 has been debated for almost 45 years. Both genes map to chromosome arm 2BL in hexaploid wheat (Triticum aestivum) and were hypothesized to be allelic, and closely linked with YrSP. While Yr5 confers resistance to almost all tested PST isolates worldwide, both Yr7 and YrSP have been overcome in the field following wide deployment (Table 1) and each display a different recognition specificity.
According to an aspect of the invention is provided an isolated nucleic acid encoding a nucleotide-binding and leucine-rich repeat (NLR) polypeptide comprising a zinc-finger BED domain, wherein expression of the NLR polypeptide in a plant confers or enhances resistance of the plant to a fungus, for example wheat yellow (stripe) rust fungus Puccinia striiformisi f. sp. tritici.
Further aspects and embodiments are as defined in the appended claims and in the detailed description below.
(A) Left-Pictures of wild-type and selected EMS-derived susceptible mutant lines for Yr7, Yr5 and YrSP (Tables 2-3) inoculated with PST isolate 08/21 (Yr7), PST 80/11 (Yr5), PST 134 E16 A+ (YrSP). Candidate gene structures, with mutations shown with black bars, identified by RenSeq and their predicted effects on the translated protein are shown on the right. (B) Schematic representation of the physical and genetic interval of the Yr loci. Schematic representation of chromosome 2BL and the Yr loci is shown in grey with previously published SSR markers shown in black. Markers that we developed to confirm the genetic linkage between this locus and the candidate contigs are shown with black marks on the close-up underneath the chromosme. Yr loci mapping intervals are defined by the black horizontal lines. A more detailed genetic map is shown in
(A) Schematic representation of the Yr7/Yr5/YrSP protein domain organisation. BED domains are highlighted in black, NB-ARC domains in dark grey, LRR motifs from NLR-Annotator in grey and manually annotated LRR motifs xxLxLxx in light grey. The sequence identity between YrSP and Yr5 is shown in light grey. Asterisks point the EMS-induced mutation positions. The plot shows the degree of amino acid conservation (50 AA rolling average) between Yr7 and Yr5 at the protein level based on the conservation diagram produced by Jalview (2.10.1) alignment viewer. Regions that correspond to the conserved domains have matching greyscale on the line. The amino acid changes between Yr5 and YrSP are annotated on the YrSP protein. (B) Five Yr5/YrSP haplotypes were identified in this study. Polymorphism are highlighted across the protein sequence with grey vertical bars for polymorphisms shared by at least two haplotypes and light grey vertical bars showing polymorphism that are unique to the corresponding haplotype. Matching greyscale across protein structures illustrate 100% sequence conservation.
(A) Table representing the NLR counts in the syntenic region across genomes (see
Annotated screen capture of RenSeq reads from the wild-type and mapping of EMS-derived mutants to the best candidate contig identified with MutantHunter for the three genes targeted in this study. From the top to the bottom: Vertical black lines represent the Yr loci, rectangles depict the motifs identified by NLR-Annotator (each motif is specific to a conserved NLR domain), while read coverage (grey histograms) is indicated on the left, e.g. [0-149], and the line from which the reads are derived on the right, e.g. CadWT for Cadenza wild-type. Vertical bars represent the position of SNP identified between the reads and reference assembly—dark grey shows C to T transitions and light grey G to A transitions. Black boxes highlight SNP for which the coverage was lower, but still superior to the 20x threshold used here.
The top screen capture shows the Yr7 allele annotated and before curation from the Cadenza genome assembly (Table 4). Light grey dashed lines illustrate the actual locus and the one that was formerly de novo assembled from Cadenza RenSeq data, lacking the 5′ region containing the BED domain and thus the Cad903 mutation. This locus was the only one for which all seven mutant lines carried a mutation. The middle screen capture illustrates the Yr5 locus annotated from the Lemhi-Yr5 de novo assembly. The results are similar to those described above for Yr7. The full locus was de novo assembled.
Schematic representation of chromosome 2B from Chinese Spring (RefSeq v1.0) with the positions of published markers linked to the Yr loci and surrounding closely linked markers that were used to define their physical position (grey regions). Close-up of the physical locus indicating the positions of KASP markers that were used for the mapping (vertical bars Table 10). Light grey refers to Yr7, dark grey to Yr5 and grey to YrSP. The arrow points to the NLR cluster containing the best BLAST hits for Yr7 and Yr5/YrSP on RefSeq v1.0. Lines link the physical map to the corresponding genetic map for each targeted gene (see Methods). Values are expressed in centiMorgans.
Schematic representation of the physical loci containing Yr7 and Yr5/YrSP homologues on RefSeq v1.0 and its syntenic region based on gene content across RefSeq v1.0 subgenomes and selected grass genomes. Arrows represent loci. The syntenic region in other species was defined when three consecutive non-NLR genes had orthologues in the same order compared to chromosome 2BL outside the NLR cluster (see Methods). The syntenic region is bordered by conserved non-NLR genes (shown in light grey). Black arrows represent canonical NLRs and the different shades of grey arrows represent different types of BED-NLRs based on their BED domain and their relationship identified in
Phylogenetic tree based on translated NB-ARC domains from the NLR-Annotator. Sequences were aligned using Muscle v3.8.13 with default parameters and the tree was built with the MPI version of the RAxML (v8.2.9) program. Node labels represent bootstrap values for 1,000 replicates. The tree was rooted at mid-point and visualized with Dendroscope v3.5.9. The greyscale pattern matches the one in
Heatmap representing the normalised read counts (Transcript Per Million, TPM) from the reanalysis of RNAseq data for all of the BED-containing proteins and BED-NLRs annotated on RefSeq v1.0. No expression is shown in white and expression levels increase from light grey to dark grey. Most BED-containing protein and BED-NLRs were not expressed at all in the analysed data. No striking pattern was observed for those that were expressed: difference were observed between varieties but these were independent of the presence of the yellow rust pathogen.
The size of the circle is proportional to the prevalence of the variety in the tree. Greyscale illustrate the genotype with dark grey showing the absence of Yr7 and grey its presence. Varieties in light grey were not tested. Yr7 originated from Triticum durum cv. Iumillo and was introgressed into hexaploid wheat through Thatcher (top of the pedigree). All the varieties. Each variety positive for the Yr7 allele is related to a parent that was also positive for Yr7.
Spelt and Yr5 Isogenic Lines AvocetS+Yr5 and Lemhi+Yr5, YrSP donor Spaldings Prolific and YrSP Isogenic Line AvocetS+YrSP, lines carrying alternate Yr5 alleles identified on
In a first aspect the invention relates to an isolated nucleic acid encoding a nucleotide-binding and leucine-rich repeat (NLR) polypeptide comprising a zinc-finger BED domain, wherein expression of the NLR polypeptide in a plant confers or enhances resistance of the plant to a fungus, for example wheat yellow (stripe) rust fungus Puccinia striiformisi f. sp. tritici.
The isolated nucleic acid may be isolated from a plant, for example an Angiosperm such as Aegilops tauschii, Brachypodium distachyon, Oryza sativa, Triticum turgidum or Triticum aestivum.
The BED domain may have an amino acid sequence corresponding to SEQ ID NO: 1 (BED-I sequence SVVWEHFTITEKDNGKPVKAVCRHCGNEFKCDTKTNGTSSMKKHLENEHS) or a variant thereof (see for example BED-I variants and consensus sequence shown in
The NLR polypeptide may comprise a leucine-rich repeat (LRR) motif at or near the C-terminus.
The NLR polypeptide may have an amino acid sequence comprising SEQ ID NO: 2 (Yr5 protein) or SEQ ID NO: 3 (Yr7 protein), or a variant or functional fragment of either, including variants described herein. For example, the isolated nucleic acid may have a nucleotide sequence comprising SEQ ID NO: 4 (Yr5 gene nucleotide sequence), or its corresponding cDNA sequence, SEQ ID NO: 5 (Yr7 gene nucleotide sequence), or its corresponding cDNA sequence, or variants or functional fragments thereof, including other alleles described herein.
Alternatively, the NLR polypeptide may have an amino acid sequence comprising SEQ ID NO: 6 (YrSP protein) or a variant or functional fragment thereof, including variants described herein. For example, the isolated nucleic acid may have a nucleotide sequence comprising SEQ ID NO: 7 (YrSP nucleotide sequence) or its corresponding cDNA sequence, or variants or functional fragments thereof, including other alleles described herein.
The NLR polypeptide may comprise a further zinc-finger BED domain, for example having an amino acid sequence comprising SEQ ID NO: 8 (BED-II sequence KAWDNFDVIEEENGQPIKARCKYCPTEIKCGPKSGTAGMLNHNKICKD) or a variant therefore (see for example BED-II variants and consensus sequence shown in
In another aspect the invention relates to a nucleotide-binding and leucine-rich repeat (NLR) polypeptide comprising a zinc-finger BED domain, wherein expression of the NLR polypeptide in a plant confers or enhances resistance of the plant to a fungus, for example wheat yellow (stripe) rust fungus Puccinia striiformisi f. sp. tritici. The BED domain may have an amino acid sequence comprising SEQ ID NO: 1 (BED-I) or a variant or functional fragment thereof
Further features of the NLR polypeptide per se of the invention may be defined as above and herein.
In another aspect the invention relates to a vector comprising an isolated nucleic acid of the invention. The vector may further comprising a regulatory sequence which directs expression of the nucleic acid, for example a regulatory sequence selected from a constitutive promotor, a strong promoter, an inducible promoter, a stress promotor or a tissue specific promoter.
In yet another aspect, the invention relates to a host cell comprising a nucleic acid, an NLR polypeptide or a vector of the invention. The host cell may be a bacterial cell, a yeast cell, plant cell or other cell type.
In another aspect, the invention relates to a method of producing a transgenic plant or plant cell comprising introducing and expressing a nucleic acid or a vector according to the invention into a plant or plant cell, wherein introducing and expressing the nucleic acid or vector confers or enhances resistance of the plant or plant cell to a fungal pathogen such as wheat yellow (stripe) rust fungus Puccinia striiformisi f. sp. tritici.
The transgenic plant or plant cell may have resistance or enhanced resistance to the fungal pathogen compared to a plant or plant cell of the same species lacking the nucleic acid or vector. The term “transgenic plant” refers to a plant comprising such a transgene. A “transgenic plant” includes a plant, plant part, a plant cell or seed whose genome has been altered by the stable integration of recombinant DNA. A transgenic plant includes a plant regenerated from an originally-transformed plant cell and progeny transgenic plants from later generations or crosses of a transformed plant. As a result of such genomic alteration, the transgenic plant is distinctly different from the related wild type plant. An example of a transgenic plant is a plant described herein as comprising one or more of the nucleic acids of the disclosure, for example encoding Yr5, YrSP or Yr7 proteins or a functional variant thereof, typically as transgenic elements. For example, the transgenic plant includes one or more nucleic acids of the present disclosure as transgene, inserted at loci different from the native locus of the corresponding Yr5, YrSP or Yr7 gene(s). Accordingly, it is herein disclosed a method for producing a transgenic plant, wherein the method comprises the steps of
In specific embodiments, said transgenic plant is an Angiosperm such as Aegilops tauschii, Brachypodium distachyon, Oryza sativa, Triticum turgidum or Triticum aestivum.
For transformation methods within a plant cell, one can cite methods of direct transfer of genes such as direct micro-injection into plant embryos, vacuum infiltration or electroporation, direct precipitation by means of PEG or the bombardment by gun of particules covered with the plasmidic DNA of interest.
It is preferred to transform the plant cell with a bacterial strain, in particular Agrobacterium, in particular Agrobacterium tumefaciens. In particular, it is possible to use the method described by Ishida et al. (Nature Biotechnology, 14, 745-750, 1996) for the transformation of monocotyledons.
Descriptions of Agrobacterium vector systems and methods for Agrobacterium-mediated gene transfer are provided by Moloney et al., Plant Cell Reports 8:238 (1989). See also, U.S. Pat. No. 5,591,616 issued Jan. 7, 1997.
Alternatively, direct gene transfer may be used. A generally applicable method of plant transformation is microprojectile-mediated transformation wherein DNA is carried on the surface of microprojectiles measuring 1 to 4 micron. The expression vector is introduced into plant tissues with a biolistic device that accelerates the microprojectiles to speeds of 300 to 600 m/s which is sufficient to penetrate plant cell walls and membranes. Sanford et al., Part. Sci. Technol. 5:27 (1987), Sanford, J. C., Trends Biotech. 6:299 (1988), Klein et al., BioTechnology 6:559-563 (1988), Sanford, J. C., Physiol Plant 7:206 (1990), Klein et al., BioTechnology 10:268 (1992). Several target tissues can be bombarded with DNA-coated microprojectiles in order to produce transgenic plants, including, for example, callus (Type I or Type II), immature embryos, and meristematic tissue.
Following transformation of plant target tissues, expression of the selectable marker genes allows for preferential selection of transformed cells, tissues and/or plants, using regeneration and selection methods now well known in the art.
The foregoing methods for transformation would typically be used for producing a transgenic plant including the nucleic acids of the invention as transgenic element(s).
The transgenic plant could then be crossed, with another (non-transformed or transformed) inbred line, in order to produce a new transgenic line. Alternatively, a genetic trait which has been engineered into a particular line using the foregoing transformation techniques could be moved into another line using traditional backcrossing techniques that are well known in the plant breeding arts. For example, a backcrossing approach could be used to move an engineered trait from a public, non-elite inbred line into an elite inbred line, or from an inbred line containing a foreign gene in its genome into an inbred line or lines which do not contain that gene. As used herein, “crossing” can refer to a simple X by Y cross, or the process of backcrossing, depending on the context.
When the term transgenic plant is used in the context of the present disclosure, this also includes any plant including, as a transgenic element one or more of nucleic acids of the invention and wherein one or more desired traits have further been introduced through backcrossing methods, whether such trait is a naturally occurring one or a transgenic one. Backcrossing methods can be used with the present invention to improve or introduce one or more characteristic into the inbred. The term backcrossing as used herein refers to the repeated crossing of a hybrid progeny back to one of the parental plants. The parental plant which contributes the gene or the genes for the desired characteristic is termed the nonrecurrent or donor parent. This terminology refers to the fact that the nonrecurrent parent is used one time in the backcross protocol and therefore does not recur. The parental plant to which the gene or genes from the nonrecurrent parent are transferred is known as the recurrent parent as it is used for several rounds in the backcrossing protocol (Fehr et al, 1987).
In a typical backcross protocol, the recurrent parent is crossed to a second nonrecurrent parent that carries the gene or genes of interest to be transferred. The resulting progeny from this cross are then crossed again to the recurrent parent and the process is repeated until a plant is obtained wherein all the desired morphological and physiological characteristics of the recurrent parent are recovered in the converted plant in addition to the gene or genes transferred from the nonrecurrent parent. It should be noted that some, one, two, three or more, self-pollination and growing of a population might be included between two successive backcrosses.
In another aspect the invention relates to a method for producing a non-transgenic plant or plant cell having resistance or enhanced resistance to a fungal pathogen, the method comprising mutating or editing the genomic material of the plant or plant cell to comprise a nucleic acid of the invention.
An aspect of the present disclosure relates to a DNA fragment of the corresponding nucleic acids of the invention (either from naturally occurring coding sequence, or improved sequence, such as codon optimized sequence) combined with genome editing tools (such TALENs, CRISPR-Cas, Cpf1 or zing finger nuclease tools) to target the corresponding Yr5, YrSP or Yr7 genes within the wheat plant genome by insertion at any locus in the genome or by partial or total allele replacement at the corresponding locus.
In particular, the disclosure relates to a genetically modified (or engineered) plant, wherein the method comprises the steps of genetically modifying a parent plant to obtain in their genome one or more nucleic acids of the invention, preferably by genome-editing, selecting a plant comprising said one or more one or more nucleic acids as genetically engineered elements, regenerating and growing said wheat genetically engineered plant.
As used herein, the term “genetically engineered element” refers to a nucleic acid sequence present in the genome of a plant and that has been modified by mutagenesis or by genome-editing tools, preferentially by genome-editing tools. In specific embodiments, a genetically engineered element refers to a nucleic acid sequence that is not normally present in a given host genome in the genetic context in which the sequence is currently found but is incorporated in the genome of plant by use of genome-editing tools. In this respect, the sequence may be native to the host genome, but be rearranged with respect to other genetic sequences within the host genomic sequence. For example, the genetically engineered element is a Yr5, YrSP or Yr7 gene that is rearranged at a different locus as compared to a native gene. Alternatively, the sequence is a native coding sequence that has been placed under the control of heterologous regulatory sequences.
In specific embodiments, said genetically engineered plant is an Angiosperm such as Aegilops tauschii, Brachypodium distachyon, Oryza sativa, Triticum turgidum or Triticum aestivum.
The term “genetically engineered plant” or “genetically modified plant” refers to a plant comprising such genetically engineered element. A “genetically engineered plant” includes a plant, plant part, a plant cell or seed whose genome has been altered by the stable integration of recombinant DNA. As used herein, the term “genetically engineered plant” further includes a plant, plant part, a plant cell or seed whose genome has been altered by genome editing techniques. A genetically engineered plant includes a plant regenerated from an originally-engineered plant cell and progeny of genetically engineered plants from later generations or crosses of a genetically engineered plant. As a result of such genomic alteration, the genetically engineered plant is distinctly different from the related wild type plant. An example of a genetically engineered plant is a plant comprising mutated versions of Yr5, YrSP or Yr7 encoding genes. In another embodiment, the genetically engineered plant includes the nucleic acids as genetically engineered elements, inserted at loci different from the native locus of the corresponding Yr5, YrSP or Yr7 gene(s).
In specific embodiments, said genetically engineered plants do not include plants which could be obtained exclusively by means of an essentially biological process.
Said one or more genetically engineered element(s) enables the expression of polypeptides which restore or improve resistance to certain fungus, in particular resistance to a fungal pathogen such as wheat yellow (stripe) rust fungus Puccinia striiformisi f. sp. Tritici, as compared to the parent plant which do not comprise the genetically engineered element(s). Typically, said genetically engineered plant is a wheat plant, comprising, as the genetically engineered elements, a mutated version of Yr5, YrSP or Yr7 encoding gene, and said genetically engineered plant has an improved resistance to a fungal pathogen such as wheat yellow (stripe) rust fungus Puccinia striiformisi f. sp. Tritici.
Such genetically engineered plant with improved resistance may be screened by exposing a variety of genetically engineered plant having distinct mutated versions of Yr5, YrSP or Yr7 encoding gene, to a fungal pathogen such as wheat yellow (stripe) rust fungus Puccinia striiformisi f. sp. Tritici and selecting the plants which present improved resistance to said fungal pathogen.
In specific embodiments, a genetically engineered element includes an Yr5, YrSP or Yr7 encoding nucleic acid under the control of expression elements as promoter and/or terminator.
Another aspect of the disclosure relates to a genetically engineered wheat plant, which comprises the modification by point mutation, insertion or deletion of one or few nucleotides of an Yr5, YrSP or Yr7 encoding nucleic acid, as genetically engineered element, into the respectively Yr5, YrSP or Yr7 locus, by any of the genome editing tools including base-editing tool as described in WO2015089406 or by mutagenesis.
The present disclosure further includes methods for improving resistance to a funal pathogen in a plant by genome editing, comprising providing a genome editing tool capable of replacing partially or totally an Yr5, YrSP or Yr7 encoding nucleic acid or form in a plant by its corresponding mutated sequence as disclosed herein which confer improved resistance to said fungal pathogen when expressed in said plant.
Such genome editing tool includes without limitation targeted sequence modification provided by double-strand break technologies such as, but not limited to, meganucleases, ZFNs, TALENs (WO2011072246) or CRISPR CAS system (including CRISPR Cas9, WO2013181440), Cpfl or their next generations based on double-strand break technologies using engineered nucleases.
In another aspect, the invention relates to a plant or plant cell obtained or obtainable by a method of the invention. The plant or plant cell may be a crop plant or plant cell or a biofuel plant or plant cell, for example selected from maize, wheat, tobacco, oilseed rape, sorghum, soybean, potato, tomato, grape, barley, pea, bean, field bean, lettuce, cotton, sugar cane, sugar beet, broccoli or other vegetable brassicas or poplar.
In another aspect, the invention relates to a seed of the plant of the invention wherein the seed comprises a nucleic acid or an NLR polypeptide of the invention. The seed may be a wheat seed.
In another aspect, the invention relates to a method of limiting wheat yellow (stripe) rust in agricultural crop production, the method comprising planting a wheat seed as according to the invention and growing a wheat plant under conditions favourable for the growth and development of the wheat plant.
In another aspect, the invention relates to a method for identification or selection of an organism such as plant having resistance to a fungus such as wheat yellow (stripe) rust fungus Puccinia striiformisi f. sp. tritici, comprising the step of screening the organism for the presence or absence of: (1) a nucleic acid as defined according to the invention; and/or (2) an NLR polypeptide according to the invention, wherein presence of the nucleic acid or the NLR polypeptide indicates resistance.
Accordingly, it is disclosed herein the means for specifically detecting the nucleic acids of the present invention in a wheat plant.
Such means include for example a pair of primers for the specific amplification of a fragment nucleotide sequence specific of the nucleic acids of the invention in the plant genomic DNA.
As used herein, a primer encompasses any nucleic acid that is capable of priming the synthesis of a nascent nucleic acid in a template-dependent process, such as PCR. Typically, primers are oligonucleotides from 10 to 30 nucleotides, but longer sequences can be employed. Primers may be provided in double-stranded form though single-stranded form is preferred.
Alternatively, nucleic acid probe can be used for the specific detection of any one of the nucleic acids.
As used herein, a nucleic acid probe encompass any nucleic acid of at least 30 nucleotides and which can specifically hybridizes under standard stringent conditions with a defined nucleic acid. Standard stringent conditions as used herein refers to conditions for hybridization described for example in Sambrook et al 1989 which can comprise 1) immobilizing plant genomic DNA fragments or library DNA on a filter 2) prehybridizing the filter for 1 to 2 hours at 65° C. in 6× SSC 5× Denhardt's reagent, 0.5% SDS and 20 mg/ml denatured carrier DNA 3) adding the probe (labeled) 4) incubating for 16 to 24 hours 5) washing the filter once for 30 min at 68° C. in 6× SSC, 0.1% SDS 6) washing the filter three times (two times for 30 min in 30 ml and once for 10 min in 500 ml) at 68° C. in 2× SSC 0.1% SDS. The nucleic acid probe may further comprise labeling agent, such as fluorescent agents covalently attached to the nucleic acid part of the probe.
In certain embodiments, said nucleic acid probe is a fragment of at least 20 bp, 30 bp, 40 bp, 50 bp, 60 bp, 70 bp, 80 bp, 90 bp, 100 bp, 110 bp, 120 bp, 130 bp, 140 bp, 150 bp, 160 bp or the whole fragment of any of SEQ ID NO:4, 5 or 7.
References to “variant” include a genetic variation in the native, non-mutant or wild type sequence. Examples of such genetic variations include mutations selected from: substitutions, deletions, insertions and the like.
More generally, as used herein the term “polypeptide” refers to a polymer of amino acids. The term does not refer to a specific length of the polymer, so peptides, oligopeptides and proteins are included within the definition of polypeptide. The term “polypeptide” may include polypeptides with post-expression modifications, for example, glycosylations, acetylations, phosphorylations and the like. Included within the definition of “polypeptide” are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids), polypeptides with substituted linkages, as well as other modifications known in the art both naturally occurring and non-naturally occurring.
As used herein, a “functional variant or homologue” is defined as a polypeptide or nucleotide with at least 50% sequence identity, for example at least 55% sequence identity, at least 60% sequence identity, at least 65% sequence identity, at least 70% sequence identity, at least 75% sequence identity, at least 80% sequence identity, at least 85% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, or at least 99% sequence identity with the reference sequence.
Sequence identity between nucleotide or amino acid sequences can be determined by comparing an alignment of the sequences. When an equivalent position in the compared sequences is occupied by the same base or amino acid, then the molecules are identical at that position. Scoring an alignment as a percentage of identity is a function of the number of identical amino acids or bases at positions shared by the compared sequences. When comparing sequences, optimal alignments may require gaps to be introduced into one or more of the sequences to take into consideration possible insertions and deletions in the sequences. Sequence comparison methods may employ gap penalties so that, for the same number of identical molecules in sequences being compared, a sequence alignment with as few gaps as possible, reflecting higher relatedness between the two compared sequences, will achieve a higher score than one with many gaps. Calculation of maximum percent identity involves the production of an optimal alignment, taking into consideration gap penalties.
Suitable computer programs for carrying out sequence comparisons are widely available in the commercial and public sector. Examples include MatGat (Campanella et al., 2003, BMC Bioinformatics 4: 29; program available from http://bitincka.com/ledion/matgat), Gap (Needleman & Wunsch, 1970, J. Mol. Biol. 48: 443-453), FASTA (Altschul et al., 1990, J. Mol. Biol. 215: 403-410; program available from http://www.ebi.ac.uk/fasta), Clustal W 2.0 and X 2.0 (Larkin et al., 2007, Bioinformatics 23: 2947-2948; program available from http://www.ebi.ac.uk/tools/clustalw2) and EMBOSS Pairwise Alignment Algorithms (Needleman & Wunsch, 1970, supra; Kruskal, 1983, In: Time warps, string edits and macromolecules: the theory and practice of sequence comparison, Sankoff & Kruskal (eds), pp 1-44, Addison Wesley; programs available from http://www.ebi.ac.uk/tools/emboss/align). All programs may be run using default parameters.
For example, sequence comparisons may be undertaken using the “Needle” method of the EMBOSS Pairwise Alignment Algorithms, which determines an optimum alignment (including gaps) of two sequences when considered over their entire length and provides a percentage identity score. Default parameters for amino acid sequence comparisons (“Protein Molecule” option) may be Gap Extend penalty: 0.5, Gap Open penalty: 10.0, Matrix: Blosum 62. Default parameters for nucleotide sequence comparisons (“DNA Molecule” option) may be Gap Extend penalty: 0.5, Gap Open penalty: 10.0, Matrix: DNAfull.
In one aspect of the invention, the sequence comparison may be performed over the full length of the reference sequence.
Particular non-limiting embodiments of the present invention will now be described in detail.
Introduction
Here we isolate and characterise three major yellow rust resistance genes (Yr7, Yr5, and YrSP) effective in hexaploid wheat (Triticum aestivum), each having a distinct and unique recognition specificity. We show that Yr5, which remains effective to a broad range of PST isolates worldwide, is allelic to YrSP and paralogous to Yr7, both of which have been overcome by multiple PST isolates. All three Yr genes belong to a complex gene cluster on chromosome 2B encoding nucleotide-binding and leucine-rich repeat proteins (NLRs) with a non-canonical N-terminal zinc-finger BED domain that is distinct from those found in non-NLR wheat proteins. We developed and tested diagnostic markers to accelerate haplotype analysis and marker-assisted selection for breeding, enabling stacking of the non-allelic Yr genes. Our results provide evidence that the BED-NLR gene architecture can provide effective field-based resistance to important fungal diseases such as wheat yellow rust.
Results and Discussion
To clone the genes encoding Yr5, Yr7 and YrSp, we identified ethyl methanesulfonate-derived susceptible mutants from different genetic backgrounds carrying these genes (
The Yr7, Yr5 and YrSP proteins contain a zinc-finger BED domain at the N-terminus, followed by the canonical NB-ARC domain. Only Yr7 and Yr5 proteins encode multiple LRR motifs at the C-terminus. YrSP lost most of the LRR region due to the presence of a premature termination codon in exon 3 (
We examined the allelic variation in Yr7 and Yr5/YrSP across eight sequenced tetraploid and hexaploid wheat genomes (Table 4). Yr7 was originally derived from tetraploid durum wheat (T. turgidum ssp. durum) cultivar Iumillo and was spread globally through hexaploid cultivar Thatcher. We identified Yr7 only in Cadenza (Thatcher-derived) and Paragon, which is identical by descent to Cadenza in this interval (Table 5a and b). None of the three sequenced tetraploid accessions (Svevo, Kronos, Zavitan) carried Yr7.
For Yr5/YrSP, we identified three additional alleles in the sequenced hexaploid wheat cultivars (Table 5a and b). Claire encodes a complete NLR with only six amino-acid changes situated outside the three conserved domains (BED, NB-ARC and LRRs) and six polymorphisms in the C-terminus compared to Yr5. Robigus, Paragon and Cadenza also encode a full length NLR which shares common polymorphisms with Claire in addition to 19 amino acid substitutions across the BED and NB-ARC domains. Tetraploid Kronos and Svevo encode a fifth Yr5/YrSP protein with a truncation in the LRR region distinct from YrSP, in addition to multiple amino acid substitutions in the C-terminus. This truncated tetraploid allele is reminiscent of YrSP and is expressed in Kronos (see Methods). None of these varieties exhibit a typical Yr5 resistance response, suggesting that these amino acid changes/truncations may alter recognition specificity or protein function.
We designed diagnostic markers for Yr5 and Yr7 to facilitate their detection and use in breeding. We confirmed their presence in the donor cultvars Thatcher and Lee (Yr7), Spaldings Prolilic (YrSP), and spelt wheat cv. Album (Yr5) (Tables 10-12;
We defined the Yr7/Yr5/YrSP syntenic interval across the wheat genomes and related grass species Aegilops tauschii (D genome progenitor), Hordeum vulgare (barley), Brachypodium distachyon and Oryza sativa (rice) (
Among other mechanisms, integrated domains of NLRs are hypothesised to act as decoys for their intended effector targets. This would suggest that the integrated domain might be sequence-related to the host protein targeted by the effector. To identify potential host targets of AvrYr7, AvrYr5 and AvrYrSP, we retrieved all BED-domain proteins (108) from the wheat genome, including 25 BED-NLRs, and additional BED-NLRs located in the syntenic intervals (Table 6). We also retrieved the rice Xal and ZBED proteins, the latter being hypothesized to act in rice resistance against Magnaporthe. oryzae. We used the split network method implemented in Splitstree4 to represent the relationships between these BED domains (
BED-NLRs are frequent in Triticeae and occur in other monocot and dicot tribes. However, only a single BED-NLR gene, Xa1, had been previously shown to confer resistance to plant pathogens. In the present study, we show that the distinct Yr5, YrSP, and Yr7 resistance specificities belong to a complex NLR cluster on chromosome 2B and are encoded by two BED-NLRs genes which are paralogous. We report an allelic series for the Yr5/YrSP gene with five independent alleles including three full-length BED-NLRs (including Yr5) and two truncated versions (including YrSP). This wider allelic series could be of functional significance as previously shown for the Mla and Pm3 loci that confer resistance to Blumeria graminis in barley and wheat, respectively, and the flax L locus conferring resistance to Melampsora lini. Overall, our results add strong evidence for the importance of the BED-NLR architecture in plant-pathogen interactions. The paralogous and allelic relationship of these three distinct Yr loci will inform future hypothesis-driven engineering of novel recognition specificities.
Methods
1.1. MutRenSeq
Mutant Identification
Table 2 summarises plant materials and PST isolates used for each Yr gene. We used an ethyl methanesulfonate (EMS)-mutagenised population in cultivar Cadenza to identify mutants in Yr7, whereas EMS-populations in the corresponding AvocetS-Yr near isogenic line (NIL) were used to identify Yr5 and YrSP mutants. For Yr7, we inoculated M3 plants from the Cadenza EMS population with PST isolate 08/21 which is virulent to Yr1, Yr2, Yr3, Yr4, Yr6, Yr9, Yr17, Yr27, Yr32, YrRob, and YrSol. We hypothesised that susceptible mutants would carry mutations in Yr7. Plants were grown in 192-well trays in a confined glasshouse with no supplementary lights or heat. Inoculations were performed at the one leaf stage (Z11) with a talc-urediniospore mixture. Trays were kept in darkness at 10° C. and 100% humidity for 24 hours. Infection types (IT) were recorded 21 days post-inoculation following the Grassner and Straib scale. Identified susceptible lines were progeny tested to confirm the reliability of the phenotype and DNA from M4 plants was used for RenSeq (see section below). Similar methods were used for AvocetS+Yr7, AvocetS+Yr5 and AvocetS+YrSp EMS-mutagenised populations with the following exceptions: PST pathotypes 108 E141 A+ (University of Sydney Plant Breeding Institute Culture no. 420),150 E16 A+(Culture no. 598) and 134 E16 A+(Culture no. 572) were used, respectively. EMS-derived susceptible mutants in Lehmi+Yr5 were previously identified and DNA from M5 plants was used for RenSeq.
DNA Preparation and Resistance Gene Enrichment and Sequencing (RenSeq)
We extracted total genomic DNA from young leaf tissue using the large-scale DNA extraction protocol from the McCouch Rice Lab (https://ricelab.plbr.cornell.edu/dna_extraction). Total genomic DNA of all Avocet mutants and wild-types were extracted following a previously described method. We checked DNA quality and quantity on a 0.8% agarose gel and with a NanoDrop spectrophotometer (Thermo Scientific). Arbor Biosciences (Ann Arbor, Mich., USA) performed the targeted enrichment of NLRs according to the MYbaits protocol and using an improved version of the Triticeae bait library. Library construction was performed using the TruSeq RNA protocol v2 (Illumina 15026495). Libraries were pooled—one pool of samples for Cadenza mutants and one of eight samples for the Lemhi+Yr5 parent and Lemhi+Yr5 mutants. AvocetS+Yr5 and AvocetS+YrSP wild type together with their respective mutants were also processed according to the aforementioned MYbaits protocol and the same bait library were used. All enriched libraries were sequenced on a HiSeq 2500 (Illumina) in High Output mode using 250 bp paired end reads and SBS chemistry. We used Cadenza wild-type data previously generated on an Illumina MiSeq instrument.
In addition to the mutants, we also generated RenSeq data for Kronos and Paragon to confirm the presence of the Yr5 allele in Kronos and the Yr7 gene in Paragon
Details of all the lines sequenced is available in Table 3 and sequencing details are in Table 8.
1.2. MutantHunter Pipeline
We adapted the pipeline from https://github.com/steuernb/MutantHunter/to identify candidate contigs for the targeted Yr genes. First, we trimmed the RenSeq-derived reads with trimmomatic and the following parameters: ILLUMINACLIP:TruSeq2-PE.fa:2:30:10 LEADING:30 TRAILING:30 SLIDINGWINDOW:10:20 MINLEN:50 (v0.33). We made de novo assemblies of wild-type plant trimmed reads with the CLC assembly cell and default parameters apart from the word size (-w) parameter that we set to 64 (v5.0, http://www.cicbio.com/products/c1c-assembly-cell!, Table 9). We then followed the MutantHunter pipeline detailed at https://github.com/steuernb/MutantHunter/. For Cadenza mutants, we used the following MutantHunter program parameters to identify candidate contigs: -c 20-n 6-z 1000, that translates into SNPs with at least 20x coverage, six susceptible mutants must have a mutation in the contig to report it as candidate, and small deletions were filtered out by setting the number of coherent positions with zero coverage to call a deletion mutant at 1000. The -n parameter was modified accordingly in subsequent runs with the Lemhi+Yr5 (−n 6). For identifying Yr5 and YrSP contigs from Avocet mutants, we followed the aforementioned MutantHunter with all default parameters, except the use of CLC Genomics Workbench (v10) for reads QC and trimming, as well as de novo assemblies of Avocet wild-type and mapping all reads against de novo assembly of wild-type. The MutantHunter programme parameters were set all as default except for −z was set as 100. The parameter −n was set for two as the first run and then three as the second run. Regarding Yr5, two mutants were sibling lines as they carried the same mutation at identical positions (
For Yr7 we identified a single contig with six mutations, however we did not identify mutations in line Cad0903. Upon examination of the Yr7 candidate contig we predicted that the 5′ region was likely missing (
The Triticeae bait library does not include integrated domains in its design so they are prone to be missed, especially when located at the ends of an NLR. Sequencing technology could also have accounted for this: MiSeq was used for Cadenza wild-type whereas HiSeq was chosen for Lemhi-Yr5 and we did not observe the missing 5′ region in the latter, although coverage was lower than the regions encoding for canonical domains.
In summary, we sequenced nine, ten and four mutants for Yr7, Yr5 and YrSP and identified a single contig for each target gene which accounted for all the mutations.
1.3. Candidate Contig Confirmation and Gene Annotation
We sequenced the three candidate contigs to confirm the EMS-derived mutations using primers documented in Table 10. We first PCR-amplified the full locus from the same DNA preparations as the ones submitted for RenSeq with the Phusion® High-Fidelity DNA Polymerase (New England Biolabs) following the provider's protocol (https://www.neb.com/protocols/0001/01/01/per-protocol-m0530). We then carried out nested PCR on the obtained product to generate overlapping 600-1,000 bp amplicons that were purified using the MiniElute kit (Qiagen). The purified PCR products were sequenced by GATC following the LightRun protocol (https://www.gatc-biotech.com/shop/en/lightrun-tube-barcode.html). Resulting sequences were aligned to the wild-type contig using ClustalOmega (https://www.ebi.ac.uk/Tools/msa/clustalo/). This allowed us to curate the Yr7 locus in the Cadenza assembly that has two ‘N’ in its sequence, corresponding to a 39 bp insertion and a 129 bp deletion, and confirm the presence of the mutations in each mutant line.
We used HISATt2 (v2.1) to map RNA-Seq reads available from Cadenza and AvocetS-Yr5 onto the RenSeq de novo assemblies with curated loci to define the gene structure of the genes. We used the following parameters: —no-mixed—no-discordant to map read in pairs only. We used the—novel-splicesite-outfile to predict splicing sites which we manually checked with the genome visualisation tool IGV (v2.3.79). Predicted CDS were then translated using the ExPASy online tool (https://web.expasy.org/translate/). This allowed us to predict the effect of the mutations for each candidate gene (
1.4. Genetic Linkage Experiments
We generated a set of F2 populations to genetically map the candidate contigs (Table 2). For Yr7 we developed an F2 population based a cross between the susceptible mutant line Cad0127 to the Cadenza wild type control (population size 139 individuals). For Yr5 and YrSp we developed F2 populations between AvocetS and the NILs carrying the corresponding Yr gene (94 individuals for YrSp and 376 for Yr5). We extracted DNA from leaf tissue at the seedling stage (Z11). Rqtl package was used to produce the genetic map based on a general likelihood ratio test and genetic distances were calculated from recombination frequencies (v1.41-6).
We used markers linked to Yr7, Yr5, YrSP (WMS526, WMS501 and WMC175, WMC332, respectively) in addition to closely linked markers WMS120, WMS191 and WMC360 (based on the GrainGenes database https://wheat.pw.usda.gov/GG3/) to define the physical region on RefSeq v1.0. Two different approaches were used for genetic mapping depending on the material. For Yr7, we used the public data for Cad0127 (www.wheat-tilling.com) to identify nine mutations located within the Yr7 physical interval based on BLAST analysis against RefSeq v1.0. We used KASP primers when available and manually designed additional ones including an assay targeting the Cad0127 mutation in the Yr7 candidate contig (Table 10). We genotyped the Cad0127 F2 populations using these ten KASP assays and confirmed genetic linkage between the Cad0127 Yr7 candidate mutation and the nine mutations across the physical interval (
For Yr5 and YrSP, we first aligned the candidate contigs to the best BLAST hit in an AvocetS RenSeq de novo assembly. We then designed KASP primers targeting polymorphism between these sequences and used them to genotype the corresponding F2 population. We also used markers polymorphic between parental lines to determine the presence of Yr5/YrSP in breeding material (Table 10). For both candidate contigs we confirmed genetic linkage with the genetic intervals for these Yr genes (
1.5. Yr7 Gene-Specific Markers
We aligned the Yr7 sequence with the best BLAST hits in the genomes listed on Table 2 and designed KASP primers targeting polymorphisms that were Yr7-specific. Three markers were retained after testing on a selected panel of Cadenza-derivatives and varieties that were positive for Yr7 markers in the literature, including the Yr7 reference cultivar Lee (Table 10 for the primers, Tables 11 and 12 for the results). The panel of Cadenza-derivatives was phenotyped with three PST isolates: PST 08/21 (Yr7-avirulent), PST 15/151 (Yr7-avirulent—virulent to Yr1,2,3,4,6,9,17,25,32,Rendezvous, Sp, Robigus, Solstice) and PST 14/106 (Yr7-virulent, virulent to Yr1,2,3,4,6,7,9,17,25,32, Sp, Robigus, Solstice, Warrior, Ambition, Cadenza, KWS Sterling, Apache) to determine whether Yr7-positive varieties as determined by the three KASP markers displayed a consistent specificity. Pathology assays were performed as for the screening of the Cadenza mutant population. We retrieved pedigree information for the analysed varieties from the Genetic Resources Information System for Wheat and Triticale database (GRIS, www.wheatpedigree.net) and used the Helium software (v1.17) to illustrate the breeding history of Yr7 in the UK (
We used the three Yr7 KASP markers to genotype (i) varieties from the AHDB Wheat Recommended List from 2005-2018 (https://cereals.andb.org.uk/varieties/andb-recommended-lists.aspx); (ii) the Gediflux collection that gathers European bread wheat varieties released between 1920 and 2010 and (iii) the core Watkins collection, which represents a global set of wheat landraces collected in the 1930s. Results are reported in Tables 13-15.
Yr5 Gene-Specific Markers
We identified a 774 bp insertion in the Yr5 allele 29 bp upstream the STOP codon with respect to the Cadenza and Claire alleles. gDNA from YrSP confirmed that the insertion was specific to Yr5.
We used this polymorphism to design primers flanking the insertion and tested them on a subset of the collections mentioned above. We included DNA from Triticum aestivum ssp. spelta var. Album (Yr5 donor) and Spaldings Prolific (YrSP donor) to assess their amplification profiles. PCR amplification was conducted using a touchdown programme with the first 10 cycles from 67° C. to 62° C. (−0.5° C. per cycle) and the remaining 25 cycles at 62° C. This allowed to increase the specificity of the reaction. We observed three different profiles on the tested varieties (i)1,281 bp amplicon in Yr5 positive cultivars, (ii) 507 bp amplicon in the alternate Yr5 alleles carriers including YrSP, Cadenza and Claire and (iii) no amplification in other varieties. We sequenced the different amplicons and confirmed the insertion in Yr5 compared to the alternate alleles. The lack of amplicon in some varieties might respresent the absence of the loci in the tested varieties.
1.6. In Silico Allele Mining for Yr7 and Yr5
We used the Yr7 and Yr5 sequences to retrieve the best BLAST hits in the T. aestivum and T. turgdium wheat genomes listed in Table 4. The best Yr5 hits shared between 93.6 and 99.3% sequence identity, which was comparable to what was observed for alleles derived from the barley Pm3 (>97% identity) and flax L (>90% identity) genes. Yr7 was identified only in Paragon and Cadenza (Table 5a and b; see
1.7. Analysis of the Yr7 and Yr5/YrSP Cluster on RefSeq v1.0
Definition of Syntenic Regions Across Grass Genomes
We used NLR-Annotator to identify putative NLR loci on RefSeq v1.0 chromosome 2B and identified the best BLAST hits to Yr7 and Yr5 on RefSeq v1.0. Additional BED-NLRs and canonical NLRs were annotated in close physical proximity to these best BLAST hits. Therefore, to better define the NLR cluster we selected ten non-NLR genes located both distal and proximal to the region and identified orthologs in barley, Brachypodium and rice in EnsemblPlants (https://plants.ensembl.org/). We used different % ID cutoffs for each species (>92% for barley, >84% for Brachypodium and >76% for rice) and determined the syntenic region when at least three consecutive orthologues were found. A similar approach was conducted for Triticum ssp and Ae. tauschii (Table 16).
1.8. Definition of the NLR Content of the Syntenic Region
We extracted the previously defined syntenic region from the grass genomes listed in Table 4 and annotated NLR loci with NLR-Annotator. We maintained previously defined gene models where possible, but also defined new gene models which were further analysed through a BLASTx analysis to confirm the NLR domains (Tables 16-18). The presence of BED domains in these NLRs was also confirmed by CD-Search (https://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi). All NLR and BED-NLR encoding sequences were taken forward for reciprocal BLAST analyses across all genomes to identify orthologous relationships. NLRs are known to be more variable than other gene classes so we used a lower threshold to define orthologues (80% ID across 80% of the alignment for the Triticeae (brown lines on
1.9. Phylogenetic and Neighbour Network Analyses
We aligned the translated NB-ARC domains from the NLR-Annotator output with MUSCLE and standard parameters (v.3.8.31). We verified and manually curated the alignment with Jalview (v2.10.1). We built a Maximum Likelihood tree with the RAxML program and the following parameters: raxmlHPC -f a -x 12345-p 12345-N 1000-m PROTCATJTT -s <input_alignmentlasta>(MPI version v8.2.10). The best scoring tree with associated bootstrap values was visualised with Dendroscope (v3.5.9).
We used the Neighbour-net method implemented in SplitsTree4 to analyse relationships between BED domains from NLR and non-NLR proteins (v4.16). We first retrieved all BED-containing proteins from RefSeq v1.0 as follows: we used hmmer (v3.1b2, http://hmmer.org/) to identify conserved domain in protein sequences from RefSeq v1.0. We applied a cut-off of 0.01 on i-evalue to filter-off any irrelevant identified domains. We separated the set between NLR and non-NLRs based on the presence of the NB-ARC and sequence homology for single BED proteins. BED domains were extracted from the corresponding protein sequences based on the hmmer output and were verified on the CD-search database. Alignments of the BED domains were performed the same way as for NB-ARC domains and were used to generate a neighbour network in SplitsTree4 based on the uncorrected P distance matrix.
1.10. Transcriptome Analysis
Kronos Analysis
We reanalysed RNA-Seq from cultivar Kronos to determine whether the Kronos Yr5 alelle was expressed. We followed the same strategy as that described to define the Yr7 and Yr5 gene structure (candidate contig confirmation and gene annotation section). We generated a de novo assembly of the Kronos NLR repertoire from Kronos RenSeq data and used it as a reference to map read data of one replicate from the wild-type Kronos heading stage. Read depths up to 30× were present in the Yr5 allele which allowed to confirm its expression. Likewise, the RNA-Seq reads confirmed the gene structure, which is similar to YrSP, and the premature termination codon in Kronos Yr5.
Re-Analysis of RNAseq Data in Dobon et al., 2016
Briefly, two RNA-Seq time-courses were used based on samples taken from leaves at 0, 1, 2, 3, 5, 7, 9 and 11 days post-inoculation for the susceptible cultivar Vuka and 0, 1, 2, 3 and 5 days post inoculation for the resistant AvocetS-Yr5. We used normalised read counts (Transcript Per Million, TPM) from Ramirez-Gonzalez et al. (2018; under review) to produce the heatmap shown in
Although the present invention has been described with reference to preferred or exemplary embodiments, those skilled in the art will recognize that various modifications and variations to the same can be accomplished without departing from the spirit and scope of the present invention and that such modifications are clearly contemplated herein. No limitation with respect to the specific embodiments disclosed herein and set forth in the appended claims is intended nor should any be inferred.
All documents cited herein are incorporated by reference in their entirety.
indicates data missing or illegible when filed
to draw the plot presented next to the table. The proportion of harvested Yr7 wheat varieties is shown in dark green and prevalence of yellow rust isolates virulent to Yr7 in orange (UK, from 1990 to 2016).
indicates data missing or illegible when filed
Triticum aestivum
Cadenza
Triticum aestivum
Paragon
Triticum aestivum
Claire
Triticum aestivum
Robigus
Triticum turgidum
Kronos
Triticum turgidum
Svevo
Triticum turgidum
Zavitan
Aegilops tauschii
Tauschii
Oryza sativa
Japonica
Brachypodium distachyon
Hordeum vulgare
Morex
indicates data missing or illegible when filed
tauschii subsp. taus
tauschii subsp. taus
indicates data missing or illegible when filed
indicates data missing or illegible when filed
indicates data missing or illegible when filed
indicates data missing or illegible when filed
TACCAGCAGGAATTTATACCTTGCTTCAACGAATTTGTTGTAATTGTTTATATACGTCTGCTTGAGAGCCCATTGTTGTTCTGAATTTCT
ATGGAGCCGGCGGGAGACTCTTCCCTGGAGGCCGCGATTGCATGGCTGGTGCAGACCATCCTTGCAACGCTCCTCATGGACAAGATGGAG
LEKEHSVICTNKSAVHETNTSSTGDATCNVRSVEVGSSSNGKRKRTNEDDTQTTAANIHAQWDKADLSNRIIKITEKLQLQDIQGALSKV
IWVCVSCKFDEVELTKEMLDFFPRERHEGINNFAKLQEILKEEVEYQAKSFLLILDDVSDSMDYEKWNKLLNPLLSSQAKNIILVTTRNL
SVAQRLSTLEPIKLGALENDDMWLLLKSCAFGFGNYEGTENLSTIGRQIAEKLKGNPLAAVTAGALLEDNLSIDEWSNILKNEKWKSLGL
SGGIMPALKLSYDELTYRLQQCFSYCSIFPDKYRFLGKDLVYIWISQGFVNCTQNKRLEETGWEYLNQLVNLGPPQQIEEQQELDGEEEP
LKIEEGRGISRLPEAGLPHSLEELEIKICSKLEDECRRLATCEGKLKVKIDGRYVN-
| Number | Date | Country | Kind |
|---|---|---|---|
| 1805865.1 | Apr 2018 | GB | national |
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/EP2019/058963 | 4/9/2019 | WO | 00 |
