A computer readable form of the Sequence Listing is filed with this application by electronic submission and is incorporated into this application by reference in its entirety. The Sequence Listing is contained in the file created on Jul. 27, 2023, having the file name “22-1043-US_Sequence-Listing.xml” and is 432,387 bytes in size.
Protein nanoparticle scaffolds are increasingly used in next-generation vaccine designs and several have established records of clinical safety and efficacy. Yet the rules for how immune responses specific to nanoparticle scaffolds affect the immunogenicity of displayed antigens have not been established.
In a first aspect, the disclosure provides polypeptides comprising the amino acid sequence of SEQ ID NO:78-80, substituted with one or more sequon, wherein the N-terminal residue may be present or may be absent. In various embodiments, each sequon may independently consist of the amino acid sequence selected from the group consisting of NET, NDS, NST, FSNES (SEQ ID NO:81), NES, FENES (SEQ ID NO:82), NAS, NGS, NHT, FFNHT (SEQ ID NO:83), NLS, FDNLS (SEQ ID NO:84), NNS, WHNNS (SEQ ID NO:85), NYS, FINYS (SEQ ID NO:86), NIS, FLNAT (SEQ ID NO:87), NAT, FLNAS (SEQ ID NO:88), WVNNS (SEQ ID NO:89), NKS, YLNKS (SEQ ID NO:90), FSNET (SEQ ID NO:91), YVNVT (SEQ ID NO:92), NRS, YANRS (SEQ ID NO:93), WANAS (SEQ ID NO:94), NFT, WANFT (SEQ ID NO:95), NVS, NGT, NVT, WLNHT (SEQ ID NO:96), and NTS.
In certain embodiments, the polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NO:1-3, 5, 8-10, 13, 23, 26-28, 31-32, 34-38, 40, 42-46, 48-55, 59-60, and 67-74, wherein:
In some embodiments X1 is absent. In other embodiments, X1 is present. When present, X1 may be any signal peptide as appropriate for an intended use. In embodiment, X1 may comprise or consist of the amino acid sequence MDSKGSSQKGSRLLLLLVVSNLLLPQGVLA (SEQ ID NO:97). In one embodiment, X3 is absent. In another embodiment, X3 may be present and comprises a purification tag. In one embodiment, X3 may comprise or consist of the amino acid sequence LEEQKLISEEDLHIIHIHH (SEQ ID NO:98).
In some embodiments, X1 and X3 are both absent. In other embodiments, X1 is present and X3 is absent. In further embodiments, X1 and X3 are both present.
In one embodiment, the polypeptide comprises the amino acid sequence selection from the group consisting of SEQ ID NO: 1-3, 5, 8-10, 13, 23, 26-28, 31-32, 34-38, 40, 42-46, 48-55, 59-60, and 67-74. In a further embodiment, the polypeptide comprises the amino acid sequence selection from the group consisting of SEQ ID NO: 49-55, 59-60, and 67-74. In one embodiment, the polypeptide comprises the amino acid sequence selection from the group consisting of SEQ ID NO: 55, 59, 67, and 73.
In another embodiment, the disclosure provides fusion proteins, comprising
In one embodiment, the functional domain comprises a polypeptide antigen. In some embodiments, the antigen comprises a bacterial antigen, a viral antigen, a fungal antigen, or a cancer antigen. In other embodiments, the antigen comprises a SARS-CoV-2 antigen or a variant or homolog thereof.
In other embodiments, the antigen comprises an antigen from an infectious agent listed in Table 5, or comprises and antigen listed in Table 6 or an antigenic fragment or mutated version thereof.
In various embodiments of the fusion proteins of the disclosure, the polypeptide comprises the amino acid sequence selection from the group consisting of SEQ ID NO: 10, 13, 23, 26-28, 31-32, 34-38, 40, 42-46, 48, and 59-60, and 67-74; or the polypeptide comprises the amino acid sequence selection from the group consisting of SEQ ID NO: 59-60 and 67-74; or the polypeptide comprises the amino acid sequence selection from the group consisting of SEQ ID NO: 59, 67, and 73.
The disclosure also provides nanoparticles, comprising:
In one embodiment, each first assembly comprises a plurality of identical first proteins comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 10, 13, and 59-60. In another embodiment, each first assembly comprises a plurality of identical first proteins comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 59-60.
In one embodiment, each second assembly comprising a plurality of second proteins comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1-3, 5, 8-9, 26-28, 31-32, 34-38, 40, 42-46, 48-55, and 67-74. In another embodiment, each second assembly comprising a plurality of second proteins comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 49-55, and 67-74. In a further embodiment, each second assembly comprising a plurality of second proteins comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 55, 67, and 73.
In another embodiment, the disclosure provides nanoparticles, comprising:
In various embodiments, the plurality of second proteins comprise an amino acid sequence selected from the group consisting of SEQ ID NO: 26-28, 31-32, 34-38, 40, 42-46, 48, and 67-77; or the plurality of second proteins comprise an amino acid sequence selected from the group consisting of SEQ ID NO: 67-74; or the plurality of second proteins comprise an amino acid sequence selected from the group consisting of SEQ ID NO: 67 and 73.
In one embodiment of all nanoparticles of the disclosure, some (at least 1%, 5%, 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%) of the second proteins comprise a fusion protein of any embodiment or combination of embodiments herein. In one embodiment, all of the second proteins comprise a fusion protein. In one embodiment, the fusion protein comprises an antigen according to any embodiment disclosed herein, and the nanoparticle displays the antigen(s) on an exterior of the nanoparticle. In some embodiments, each second protein of the nanostructure bears an antigen as a genetic fusion; these nanoparticles display antigen at full (100%) valiancy. In other embodiments, the nanoparticles of the disclosure comprise one or more second proteins bearing antigens as genetic fusions as well as one or more second proteins that do not bear antigens as genetic fusions; these nanoparticles display the antigens at partial valency. In other embodiments, the nanoparticles of the disclosure comprise two or more distinct second proteins bearing different antigens as genetic fusions.
In various embodiments, the nanoparticles are between about 20 nanometers (nm) to about 40 nm in diameter, with interior lumens between about 15 nm to about 32 nm across and pore sizes in the protein shells between about 1 nm to about 14 nm in their longest dimensions.
In another aspect the disclosure provides nucleic acids encoding the polypeptide or fusion protein of any embodiment or combination of embodiments of the disclosure. In a further aspect, the disclosure provides expression vectors comprising the nucleic acid of any aspect of the disclosure operatively linked to a suitable control sequence. In another aspect, the disclosure provides host cells that comprise the polypeptide, fusion protein, nanoparticle, nucleic acid or expression vector (i.e.: episomal or chromosomally integrated) disclosed herein.
In a further aspect, the disclosure provides a composition comprising a plurality of the nucleic acids, expression vectors, proteins, fusion proteins, and/or nanoparticles of the disclosure. In one embodiment, the composition comprises a pharmaceutical composition or an immunogenic composition (such as a vaccine) comprising an effective amount of the nanoparticle of any embodiment or combination of embodiments of the disclosure that incorporates an antigen; and a pharmaceutically acceptable carrier.
In another aspect, the disclosure provides methods for generating an immune response to an antigen in a subject, comprising administering to the subject an effective amount of the immunogenic composition of any embodiment or combination of embodiments of the disclosure to generate the immune response. In a further aspect, the disclosure provides methods for treating or preventing an infection in a subject, comprising administering to the subject an effective amount of the immunogenic composition of any embodiment or combination of embodiments of the disclosure that comprises an antigen, or antigenic fragment thereof, from the infectious agent to be treated or prevented, thereby treating or preventing infection in the subject.
Exemplary antigens and infectious agents are disclosed herein.
All references cited are herein incorporated by reference in their entirety. Within this application, unless otherwise stated, the techniques utilized may be found in any of several well-known references such as: Molecular Cloning: A Laboratory Manual (Sambrook, et al., 1989, Cold Spring Harbor Laboratory Press), Gene Expression Technology (Methods in Enzymology, Vol. 185, edited by D. Goeddel, 1991. Academic Press, San Diego, CA), “Guide to Protein Purification” in Methods in Enzymology (M. P. Deutshcer, ed., (1990) Academic Press, Inc.); PCR Protocols: A Guide to Methods and Applications (Innis, et al. 1990. Academic Press, San Diego, CA), Culture of Animal Cells: A Manual of Basic Technique, 2nd Ed. (R. I. Freshney. 1987. Liss, Inc. New York, NY), Gene Transfer and Expression Protocols, pp. 109-128, ed. E. J. Murray, The Humana Press Inc., Clifton, N.J.).
As used herein, the singular forms “a”, “an” and “the” include plural referents unless the context clearly dictates otherwise.
Any N-terminal methionine residues are optional, and may be present in the claimed polypeptides, or may be absent/deleted.
As used herein, the amino acid residues are abbreviated as follows: alanine (Ala; A), asparagine (Asn; N), aspartic acid (Asp; D), arginine (Arg; R), cysteine (Cys; C), glutamic acid (Glu; E), glutamine (Gln; Q), glycine (Gly; G), histidine (His; H), isoleucine (Ile; I), leucine (Leu; L), lysine (Lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V).
All embodiments of any aspect of the disclosure can be used in combination, unless the context clearly dictates otherwise.
Unless the context clearly requires otherwise, throughout the description and the claims, the words ‘comprise’, ‘comprising’, and the like are to be construed in an inclusive sense as opposed to an exclusive or exhaustive sense; that is to say, in the sense of “including, but not limited to”. Words using the singular or plural number also include the plural and singular number, respectively. Additionally, the words “herein,” “above,” and “below” and words of similar import, when used in this application, shall refer to this application as a whole and not to any particular portions of the application.
The description of embodiments of the disclosure is not intended to be exhaustive or to limit the disclosure to the precise form disclosed. While the specific embodiments of, and examples for, the disclosure are described herein for illustrative purposes, various equivalent modifications are possible within the scope of the disclosure, as those skilled in the relevant art will recognize.
In a first aspect, the disclosure provides polypeptides comprising the amino acid sequence of I53_dn5A (SEQ ID NO: 78), I53_dn5B (SEQ ID NO:79), or I53-50A (SEQ ID NO:80), substituted with one or more sequon, wherein the N-terminal residue may be present or may be absent. As used herein, a sequon is a sequence of consecutive amino acids that can serve as the attachment site to a polysaccharide.
The polypeptides of the disclosure have the ability to self-assemble in pairs to form nanoparticles that can be used, for example, to display antigens on the exterior surface of the nanoparticle. The nanoparticles so formed include symmetrically repeated, non-covalent polypeptide-polypeptide interfaces that orient a first assembly and a second assembly into a nanoparticle. The attachment of glycans to the polypeptides via the sequons, and nanoparticles comprising the glycosylated polypeptides, helps mimic the natural presentation of sugars on glycoproteins, optimize the pharmacokinetics and biologic activity of protein nanoparticles, and dissect the importance of different protein-carbohydrate combinations for the various applications that protein nanoparticles may be used for (e.g., as vaccine scaffolds and for drug delivery). For example, protein nanoparticle immunogens bearing high-mannose N-linked glycans can traffic more efficiently to draining lymph nodes and B cell follicles in vivo, resulting in enhanced germinal center formation and antibody responses against the displayed antigen or nanoparticle immunogen.
The sequences of SEQ ID NO:78-80 are shown in Table 1. The polypeptides of the disclosure include one or more sequons that replace (“substitute”) amino acid residues in the reference sequence.
In various embodiments, each sequon may independently consist of the amino acid sequence selected from the group consisting of NET, NDS, NST, FSNES (SEQ ID NO:81), NES, FENES (SEQ ID NO:82), NAS, NGS, NHT, FFNHT (SEQ ID NO:83), NLS, FDNLS (SEQ ID NO:84), NNS, WHNNS (SEQ ID NO:85), NYS, FINYS (SEQ ID NO:86), NIS, FLNAT (SEQ ID NO:87), NAT, FLNAS (SEQ ID NO:88), WVNNS (SEQ ID NO:89), NKS, YLNKS (SEQ ID NO:90), FSNET (SEQ ID NO:91), YVNVT (SEQ ID NO:92), NRS, YANRS (SEQ ID NO:93), WANAS (SEQ ID NO:94), NFT, WANFT (SEQ ID NO:95), NVS, NGT, NVT, WLNHT (SEQ ID NO:96), and NTS.
The polypeptide may be substituted with a single sequon or multiple sequons. If substituted with multiple sequons, each sequon may be the same or may be different.
In certain embodiments, the polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 1-3, 5, 8-10, 13, 23, 26-28, 31-32, 34-38, 40, 42-46, 48-55, 59-60, and 67-74, wherein:
The amino acid sequence of these exemplified polypeptides are provided in Table 2, with the sequons underlined.
SAEAWYNLGNAYYERGEYEEAIEYYRKALRLDPNNADAMQNLLNAKMREE-(X2) (SEQ ID NO: 21)
SAEAWYNLGNAYYERGEYEEAIEYYRKALRLDPNNADAMQNLLNAKMREE-(X2) (SEQ ID NO: 22)
NETCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFV
VNVTRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFV
NDTCRKAVNATANFTVSPHLDEEISNFTKEKNVTYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFV
VNITRKAVNATANFTVSPHLDEEISNFTKEKNVTYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFV
NDTCRKAVNATANFTVSPHLDEEISNFTKNATVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFV
VNITRKAVNATANFTVSPHLDEEISNFTKNATVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFV
NETCRKAVESNATFIVSPHLDEEISNFTKEKNVTYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFV
NETCRKAVESGAEFIVSPHLDEEISNFTKEKNVTYMPGVMTPTELVKAMKLNVTILKLFPGEVVGPQFV
NETCRKAVESNATFIVSPHLDEEISNFTKEKNVTYMPGVMTPTELVKAMKLNVTILKLFPGEVVGPQFV
In some embodiments X1 is absent. In other embodiments, X1 is present. This domain is a secretion signal peptide that can be used by mammalian cells to secrete the protein out of the cell; and are not needed when making the protein in bacteria such as E. coli. When present, X1 may be any signal peptide as appropriate for an intended use. In one non-limiting embodiment, X1 may comprise or consist of the amino acid sequence MDSKGSSQKGSRLLLLLVVSNLLLPQGVLA (SEQ ID NO:97).
In one embodiment, X3 is absent. In another embodiment, X3 may be present and comprises a purification tag. When present, X3 may be any purification tag as appropriate for an intended use. In one non-limiting embodiment, X3 may comprise or consist of the amino acid sequence LEEQKLISEEDLHIHHHHH (SEQ ID NO:98).
In some embodiments, X1 and X3 are both absent. In other embodiments, X1 is present and X3 is absent. In further embodiments, X1 and X3 are both present.
Table 3 presents data on expression, glycosylation, and nanoparticle assembly competency of these exemplary polypeptides. Listed are the sequon locations (first, single sequon inserts (SEQ IDs 1-48), and then combinations of sequon inserts (SEQ IDs 49-77)), expression, glycosylation, and nanoparticle assembly competency for each sequence.
Experimentally, first, sequences with a single sequon insert were validated for expression and glycosylation. Next, a limited set of those sequences with single sequon inserts that both expressed and glycosylated were combined into sequences that contained multiple sequon inserts.
Table 3 lists sequences and experimental outcomes of all possible locations in I53-50A, I53_dn5A, and I53_dn5B that can be glycosylated for de novo glycan display, either as single sequon inserts or as combinations of sequon inserts on a single protein chain. For I53-50A, it also discloses other glycan combinations that successfully assembled into nanoparticles that are not exemplified in the examples. Designs according to SEQ ID NO: 1-3, 5, 8-10, 13, 23, 26-28, 31-32, 34-38, 40, 42-46, 48-55, 59-60, and 67-74 showed high levels of both expression and glycosylation.
In one embodiment, the polypeptide comprises the amino acid sequence selection from the group consisting of SEQ ID NO: 1-3, 5, 8-10, 13, 23, 26-28, 31-32, 34-38, 40, 42-46, 48-55, 59-60, and 67-74. In a further embodiment, the polypeptide comprises the amino acid sequence selection from the group consisting of SEQ ID NO: 49-55, 59-60, and 67-74. In one embodiment, the polypeptide comprises the amino acid sequence selection from the group consisting of SEQ ID NO: 55, 59, 67, and 73.
In another embodiment, the disclosure provides fusion proteins, comprising
The functional domain may be any polypeptide domain of interest to be displayed on a nanoparticle comprising the fusion proteins of the disclosure. The functional domain may be N-terminal or C-terminal to the polypeptide. In one embodiment, the functional domain is N-terminal to the polypeptide. In one embodiment, the polypeptide domain and the functional domain are linked via an amino acid linker, which may be of any suitable length or amino acid composition.
Any suitable linker can be used; there is no amino acid sequence requirement to serve as an appropriate linker. In some embodiments, the linker may comprise a Gly-Ser linker (i.e.: a linker consisting of glycine and serine residues) of any suitable length. In various embodiments, the Gly-Ser linker may be 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more amino acids in length. In various embodiments, the Gly-Ser linker may comprise or consist of the amino acid sequence of GSGGSGSGSGGSGSG (SEQ ID NO:180), GGSGGSGS (SEQ ID NO:181), GSGGSGSG (SEQ ID NO:182), AGGA (SEQ ID NO:183), G, AGGAM (SEQ ID NO:184), GS, or GSGS (SEQ ID NO:185).
In other embodiments, the polypeptide domain and the functional domain are linked without an intervening amino acid linker.
In one embodiment, the functional domain comprises a polypeptide antigen. Nanoparticles comprising such fusion proteins are useful, for example, to generate an immune response in a subject in need thereof. Any polypeptide antigen may be used as deemed appropriate for an intended use. In some embodiments, the antigen comprises a bacterial antigen, a viral antigen, a fungal antigen, or a cancer antigen.
In other embodiments, the antigen comprises a SARS-CoV-2 antigen or a variant or homolog thereof. In one embodiment, the SARS-CoV-2 antigen or a variant or homolog thereof comprises an amino acid sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity to a Spike (S) protein extracellular domain (ECD) amino acid sequence, an S1 subunit amino acid sequence, an S2 subunit amino acid sequence, an S1 receptor binding domain (RBD) amino acid sequence, and/or an N-terminal domain (NTD) amino acid sequence, from SARS-CoV-2. In further embodiments, the SARS-CoV-2 antigen or a variant or homolog thereof is at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity to the amino acid sequence selected from the group consisting of SEQ ID NO:99-111. These sequences are shown in Table 4.
In another embodiment, the SARS-CoV-2 antigen or a variant or homolog thereof is at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO:99, and comprise mutations at 1, 2, 3, 4, 5, 6, 7, or all 8 positions relative to SEQ ID NO:99 selected from the group consisting of K90N, K90T, G119S, Y126F, T151I, E157K, E157A, S167P, N174Y, and L125R, including but not limited to mutations comprising one of the following naturally occurring mutations or combinations of mutations:
The amino acid residue numbering of these naturally occurring variants is based on their position within SEQ ID NO:99, while they are generally described based on their residue number in the Spike protein (i.e.: K417 in spike=K90 in RBD; G446 in spike=G119 in RBD; L452 in spike=L125 in RBD; Y453 in spike=Y126 in RBD; T478 in spike=T151 in RBD; E484 in spike=E157 in RBD; S494 in spike=S167 in RBD; N501 in spike=N174 in RBD).
In another embodiment, the SARS-CoV-2 antigen or a variant or homolog thereof is at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO:104, and wherein the antigen comprises mutations at 1, 2, 3, 4, 5, 6, 7, or all 8 positions relative to SEQ ID NO:104 selected from the group consisting of L18F, T20N, P26S, deletion of residues 69-70, D80A, D138Y, R190S, D215G, K417N, K417T, G446S, L452R, Y453F, T4781, E484K, S494P, N501Y, A570D, D614G, H655Y, P681H, A701V, T716L including but not limited to mutations comprising one of the following naturally occurring mutations or combinations of mutations:
In other embodiments, the antigen comprises an antigen from an infectious agent listed in Table 5, or comprises and antigen listed in Table 6 or an antigenic fragment or mutated version thereof.
In various embodiments of the fusion proteins of the disclosure, the polypeptide comprises the amino acid sequence selection from the group consisting of SEQ ID NO: 10, 13, 23, 26-28, 31-32, 34-38, 40, 42-46, 48, and 59-60, and 67-74; or the polypeptide comprises the amino acid sequence selection from the group consisting of SEQ ID NO: 59-60 and 67-74; or the polypeptide comprises the amino acid sequence selection from the group consisting of SEQ ID NO: 59, 67, and 73.
burgdorferi GN = ospA PE = 3 SV = 1
Bordetella
pertussis
pertussis (strain Tohama I/ATCC BAA-589/NCTC 13251)
vivax (strain Belem) PE = 3 SV = 2
Neisseria
meningitidis OX = 487 GN = gna1870 PE = 1 SV = 1
meningitidis
Neisseria
meningitidis OX = 487 GN = nadA2 PE = 3 SV = 1
meningitidis
The disclosure also provides nanoparticles, comprising:
A plurality (2, 3, 4, 5, 6, or more) of first proteins self-assemble to form a first assembly, and a plurality (2, 3, 4, 5, 6, or more) of second proteins self-assemble to form a second assembly. A plurality of these first and second assemblies then self-assemble non-covalently via the designed interfaces to produce the nanoparticles (i.e., particles having a dimension on the nanometer scale).
The number of first proteins in the first assemblies may be the same or different than the number of second proteins in the second assemblies. In one exemplary embodiment, the first assembly comprises trimers of the first proteins, and the second assembly comprises pentamers of the second proteins.
In one embodiment, each first assembly comprises a plurality of identical first proteins comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 10, 13, and 59-60. In another embodiment, each first assembly comprises a plurality of identical first proteins comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 59-60.
In one embodiment, each second assembly comprising a plurality of second proteins comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1-3, 5, 8-9, 26-28, 31-32, 34-38, 40, 42-46, 48-55, and 67-74. In another embodiment, each second assembly comprising a plurality of second proteins comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 49-55, and 67-74. In a further embodiment, each second assembly comprising a plurality of second proteins comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 55, 67, and 73.
In another embodiment, the disclosure provides nanoparticles, comprising:
In various embodiments, the plurality of second proteins comprise an amino acid sequence selected from the group consisting of SEQ ID NO: 26-28, 31-32, 34-38, 40, 42-46, 48, and 67-77; or the plurality of second proteins comprise an amino acid sequence selected from the group consisting of SEQ ID NO: 67-74; or the plurality of second proteins comprise an amino acid sequence selected from the group consisting of SEQ ID NO: 67 and 73.
In one embodiment of all nanoparticles of the disclosure, some (at least 1%, 5%, 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%) of the second proteins comprise a fusion protein of any embodiment or combination of embodiments herein. In one embodiment, all of the second proteins comprise a fusion protein. In one embodiment, the fusion protein comprises an antigen according to any embodiment disclosed herein, and the nanoparticle displays the antigen(s) on an exterior of the nanoparticle. As used herein, “on an exterior of the nanoparticle” means that an antigenic portion of the one or more antigens or antigenic fragments thereof, are accessible for binding by B cell receptors, antibodies, or antibody fragments and not buried within the nanoparticle. In some embodiments, each second protein of the nanostructure bears an antigen as a genetic fusion; these nanoparticles display antigen at full (100%) valency. In other embodiments, the nanoparticles of the disclosure comprise one or more second proteins bearing antigens as genetic fusions as well as one or more second proteins that do not bear antigens as genetic fusions; these nanoparticles display the antigens at partial valency. In other embodiments, the nanoparticles of the disclosure comprise two or more distinct second proteins bearing different antigens as genetic fusions.
In various embodiments, the nanoparticles are between about 20 nanometers (nm) to about 40 nm in diameter, with interior lumens between about 15 nm to about 32 nm across and pore sizes in the protein shells between about 1 nm to about 14 nm in their longest dimensions.
In another aspect the disclosure provides nucleic acids encoding the polypeptide or fusion protein of any embodiment or combination of embodiments of the disclosure. The nucleic acid sequence may comprise single stranded or double stranded RNA or DNA in genomic or cDNA form, or DNA-RNA hybrids, each of which may include chemically or biochemically modified, non-natural, or derivatized nucleotide bases. Such nucleic acid sequences may comprise additional sequences useful for promoting expression and/or purification of the encoded peptide or chimeric molecular construct, including but not limited to polyA sequences, modified Kozak sequences, and sequences encoding epitope tags, export signals, and secretory signals, nuclear localization signals, and plasma membrane localization signals. It will be apparent to those of skill in the art, based on the teachings herein, what nucleic acid sequences will encode the peptide or chimeric molecular construct of the disclosure.
In a further aspect, the disclosure provides expression vectors comprising the nucleic acid of any aspect of the disclosure operatively linked to a suitable control sequence. “Expression vector” includes vectors that operatively link a nucleic acid coding region or gene to any control sequences capable of effecting expression of the gene product. “Control sequences” operably linked to the nucleic acid sequences of the disclosure are nucleic acid sequences capable of effecting the expression of the nucleic acid molecules. The control sequences need not be contiguous with the nucleic acid sequences, so long as they function to direct the expression thereof. Thus, for example, intervening untranslated yet transcribed sequences can be present between a promoter sequence and the nucleic acid sequences and the promoter sequence can still be considered “operably linked” to the coding sequence. Other such control sequences include, but are not limited to, polyadenylation signals, termination signals, and ribosome binding sites. Such expression vectors can be of any type, including but not limited plasmid and viral-based expression vectors. The control sequence used to drive expression of the disclosed nucleic acid sequences in a mammalian system may be constitutive (driven by any of a variety of promoters, including but not limited to, CMV, SV40, RSV, actin, EF) or inducible (driven by any of a number of inducible promoters including, but not limited to, tetracycline, ecdysone, steroid-responsive). The expression vector must be replicable in the host organisms either as an episome or by integration into host chromosomal DNA. In various embodiments, the expression vector may comprise a plasmid, viral-based vector, or any other suitable expression vector.
In another aspect, the disclosure provides host cells that comprise the polypeptide, fusion protein, nanoparticle, nucleic acid or expression vector (i.e.: episomal or chromosomally integrated) disclosed herein, wherein the host cells can be either prokaryotic or eukaryotic. The cells can be transiently or stably engineered to incorporate the expression vector of the disclosure, using techniques including but not limited to bacterial transformations, calcium phosphate co-precipitation, electroporation, or liposome mediated-, DEAE dextran mediated-, polycationic mediated-, or viral mediated transfection.
In a further aspect, the disclosure provides a composition comprising a plurality of the proteins, fusion proteins, nucleic acids, expression vectors, and/or nanoparticles of the disclosure. In one embodiment, the composition comprises a pharmaceutical composition or an immunogenic composition (such as a vaccine) comprising an effective amount of the proteins, fusion proteins, nucleic acids, expression vectors, and/or nanoparticles of any embodiment or combination of embodiments of the disclosure that incorporates an antigen; and a pharmaceutically acceptable carrier. The composition may comprise (a) a lyoprotectant; (b) a surfactant; (c) a bulking agent; (d) a tonicity adjusting agent; (e) a stabilizer; (f) a preservative and/or (g) a buffer.
In some embodiments, the buffer in the pharmaceutical composition is a Tris buffer, a histidine buffer, a phosphate buffer, a citrate buffer or an acetate buffer. The composition may also include a lyoprotectant, e.g. sucrose, sorbitol or trehalose. In certain embodiments, the composition includes a preservative e.g. benzalkonium chloride, benzethonium, chlorohexidine, phenol, m-cresol, benzyl alcohol, methylparaben, propylparaben, chlorobutanol, o-cresol, p-cresol, chlorocresol, phenylmercuric nitrate, thimerosal, benzoic acid, and various mixtures thereof. In other embodiments, the composition includes a bulking agent, like glycine. In yet other embodiments, the composition includes a surfactant e.g., polysorbate-20, polysorbate-40, polysorbate-60, polysorbate-65, polysorbate-80 polysorbate-85, poloxamer-188, sorbitan monolaurate, sorbitan monopalmitate, sorbitan monostearate, sorbitan monooleate, sorbitan trilaurate, sorbitan tristearate, sorbitan trioleaste, or a combination thereof. The composition may also include a tonicity adjusting agent, e.g., a compound that renders the formulation substantially isotonic or isoosmotic with human blood. Exemplary tonicity adjusting agents include sucrose, sorbitol, glycine, methionine, mannitol, dextrose, inositol, sodium chloride, arginine and arginine hydrochloride. In other embodiments, the composition additionally includes a stabilizer, e.g., a molecule which substantially prevents or reduces chemical and/or physical instability of the nanostructure, in lyophilized or liquid form. Exemplary stabilizers include sucrose, sorbitol, glycine, inositol, sodium chloride, methionine, arginine, and arginine hydrochloride.
The nanoparticle may be the sole active agent in the composition, or the composition may further comprise one or more other agents suitable for an intended use, including but not limited to adjuvants to stimulate the immune system generally and improve immune responses overall. Any suitable adjuvant can be used. The term “adjuvant” refers to a compound or mixture that enhances the immune response to an antigen. Exemplary adjuvants include, but are not limited to, Adju-Phos™, Adjumer™, albumin-heparin microparticles, Algal Glucan, Algammulin, Alum, Antigen Formulation, AS-2 adjuvant, autologous dendritic cells, autologous PBMC, Avridine™, B7-2, BAK, BAY R1005, Bupivacaine, Bupivacaine-HCl, BWZL, Calcitriol, Calcium Phosphate Gel, CCR5 peptides, CFA, Cholera holotoxin (CT) and Cholera toxin B subunit (CTB), Cholera toxin A1-subunit-Protein A D-fragment fusion protein, CpG, CRL1005, Cytokine-containing Liposomes, D-Murapalmitine, DDA, DHEA, Diphtheria toxoid, DL-PGL, DMPC, DMPG, DOC/Alum Complex, Fowlpox, Freund's Complete Adjuvant, Gamma Inulin, Gerbu Adjuvant, GM-CSF, GMDP, hGM-CSF, hIL-12 (N222L), hTNF-alpha, IFA, IFN-gamma in pcDNA3, IL-12 DNA, IL-12 plasmid, IL-12/GMCSF plasmid (Sykes), IL-2 in pcDNA3, IL-2/Ig plasmid, IL-2/Ig protein, IL-4, IL-4 in pcDNA3, Imiquimod™, ImmTher™ Immunoliposomes Containing Antibodies to Costimulatory Molecules, Interferon-gamma, Interleukin-1 beta, Interleukin-12, Interleukin-2, Interleukin-7, ISCOM(s)™, Iscoprep 7.0.3™, Keyhole Limpet Hemocyanin, Lipid-based Adjuvant, Liposomes, Loxoribine, LT(R192G), LT-OA or LT Oral Adjuvant, LT-R192G, LTK63, LTK72, MF59, MONTANIDE ISA 51, MONTANIDE ISA 720, MPL.TM., MPL-SE, MTP-PE, MTP-PE Liposomes, Murametide, Murapalmitine, NAGO, nCT native Cholera Toxin, Non-Ionic Surfactant Vesicles, non-toxic mutant E112K of Cholera Toxin mCT-E112K, p-Hydroxybenzoique acid methyl ester, pCIL-10, pCIL12, pCMVmCAT1, pCMVN, Peptomer-NP, Pleuran, PLG, PLGA, PGA, and PLA, Pluronic L121, PMMA, PODDS™, Poly rA: Poly rU, Polysorbate 80, Protein Cochleates, QS-21, Quadri A saponin, Quil-A, Rehydragel HPA, Rehydragel LV, RIBI, Ribilike adjuvant system (MPL, TMD, CWS), S-28463, SAF-1, Sclavo peptide, Sendai Proteoliposomes, Sendai-containing Lipid Matrices, Span 85, Specol, Squalane 1, Squalene 2, Stearyl Tyrosine, Tetanus toxoid (TT), Theramide™, Threonyl muramyl dipeptide (TMDP), Ty Particles, and Walter Reed Liposomes. Selection of an adjuvant depends on the subject to be treated. Preferably, a pharmaceutically acceptable adjuvant is used.
In another aspect, the disclosure provides methods for generating an immune response to an antigen in a subject, comprising administering to the subject an effective amount of the immunogenic composition of any embodiment or combination of embodiments of the disclosure to generate the immune response. In a further aspect, the disclosure provides methods for treating or preventing an infection in a subject, comprising administering to the subject an effective amount of the immunogenic composition of any embodiment or combination of embodiments of the disclosure that comprises an antigen, or antigenic fragment thereof, from the infectious agent to be treated or prevented, thereby treating or preventing infection in the subject. Exemplary antigens and infectious agents are disclosed herein.
As used herein, “treat” or “treating” includes, but is not limited to accomplishing one or more of the following (depending on the infectious agent): (a) reducing viral titer in the subject; (b) limiting any increase of viral titer in the subject; (c) reducing the severity of infectious agent symptoms; (d) limiting or preventing development of infectious agent symptoms after infection; (e) inhibiting worsening of infectious agent symptoms; (f) limiting or preventing recurrence of infectious agent symptoms in subjects that were previously symptomatic; and/or promoting maternal transmission of infectious agent antibodies to infants (after maternal immunization).
When the method comprises limiting an infection, the immunogenic compositions are administered prophylactically to a subject that is not known to be infected, but may be at risk of exposure to the infectious agent of interest. As used herein, “limiting” means to limit infection in subjects at risk of infection.
As used herein, an “effective amount” refers to an amount of the immunogenic composition that is effective for treating and/or limiting infection. The immunogenic compositions are typically formulated as a pharmaceutical composition, such as those disclosed above, and can be administered via any suitable route, including orally, parentally, by inhalation spray, rectally, or topically in dosage unit formulations containing conventional pharmaceutically acceptable carriers, adjuvants, and vehicles. The term parenteral as used herein includes, subcutaneous, intravenous, intra-arterial, intramuscular, intrasternal, intratendinous, intraspinal, intracranial, intrathoracic, infusion techniques or intraperitoneally. Polypeptide compositions may also be administered via microspheres, liposomes, immune-stimulating complexes (ISCOMs), or other microparticulate delivery systems or sustained release formulations introduced into suitable tissues (such as blood). Dosage regimens can be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response). A suitable dosage range may, for instance, be 0.1 ug/kg-100 mg/kg body weight of the antigen or antigenic fragment thereof. The composition can be delivered in a single bolus, or may be administered more than once (e.g., 2, 3, 4, 5, or more times) as determined by attending medical personnel.
The rules for how immune responses specific to nanoparticle scaffolds affect the immunogenicity of displayed antigens have not been established. Here we define relationships between anti-scaffold and antigen-specific antibody responses elicited by protein nanoparticle immunogens. We found that dampening anti-scaffold responses by physical masking did not enhance antigen-specific antibody responses. In a series of immunogens that all used the same nanoparticle scaffold but displayed four different antigens, only HIV-1 envelope glycoprotein (Env) was subdominant to the scaffold. Yet we also demonstrated that scaffold-specific antibody responses can competitively inhibit antigen-specific responses when the scaffold is provided in excess. Overall, our results suggest that anti-scaffold antibody responses are unlikely to suppress antigen-specific antibody responses for protein nanoparticle immunogens in which the antigen is immunodominant over the scaffold.
Here, we address questions about the role of anti-scaffold responses in shaping the immunogenicity of protein nanoparticle immunogens through (1) physically masking the nanoparticle scaffold using three different approaches, (2) studying how antigen immunodominance impacts anti-scaffold responses, and (3) assessing immunogenic competition between the displayed antigen and nanoparticle scaffold. We found that scaffold masking reduced scaffold-specific antibody responses, which may be desirable in a vaccine intended to elicit protective antibody responses against a displayed antigen. Reducing anti-scaffold responses would be particularly useful in instances where the same animal or human receives different vaccines displaying distinct antigens but using the same underlying nanoparticle scaffold.
Design and Characterization of HA-I53_Dn5 Nanoparticle Immunogens with a Glycosylated, PEGylated, or PASylated Nanoparticle Scaffold
To test the impact of masking the nanoparticle scaffold on antigen-specific antibody responses, we selected as our model scaffold the I53_dn5 protein nanoparticle (Ueda et al., 2020) due to its robust self-assembly and stability and its use as the scaffold for a mosaic nanoparticle influenza vaccine in clinical testing (Boyoglu-Barnum et al., 2021; NCT04896086). I53_dn5 is a 25 nm, two-component nanoparticle with icosahedral symmetry constructed from 12 pentameric and 20 trimeric building blocks. We compared three different approaches to masking I53_dn5 surfaces: glycosylation, PEGylation, and genetic fusion of unstructured polypeptides rich in Pro, Ala, and Ser (i.e., PASylation (Schlapschy et al., 2013)).
To introduce NxT/S potential N-linked glycosylation sites (PNGS) into the exposed surfaces of the I53_dn5A pentamer and the I53_dn5B trimer, we used a custom “sugarcoat” protocol that we recently developed (Adolf-Bryfogle et al., 2021) as part of the Rosetta™ macromolecular modeling and design software (Fleishman et al., 2011; Leman et al., 2020).
Sequences corresponding to design models containing a single inserted NxT/S sequon, modeled with and without a Man9 glycan tree present, that had a Rosetta™ “total_energy”<500, as well as <0.25 Å and <0.40 Å backbone (Ca) root mean square deviation (RMSD) compared to the parent I53_dn5A and I53_dn5B design models, respectively, were tested for protein expression and glycosylation (
PNGase F digestion of N-linked glycans followed by reducing SDS-PAGE analysis verified glycosylation of the I53_dn5A_2gly component of the SEC-purified HA-I53_dn5_Agly particles (
To specifically couple PEG to precise locations on the I53_dn5 nanoparticle surface, we designed I53_dn5A pentamer variants with surface-exposed cysteines to enable PEG-maleimide conjugation (Goodson and Katre, 1990). We did not design I53_dn5B trimer cysteine knock-ins due to the potential for coupled PEG to occlude membrane-proximal epitopes on fused antigens (e.g., the conserved HA stem region). Seven I53_dn5A cysteine knock-ins were designed with either one or two surface-exposed cysteines per protomer. Two designs (I53_dn5A_D120C, I53_dn5A_S84C_D120C) had acceptable expression (>100 mg/L of bacterial expression media); did not aggregate during 4° C. storage; coupled efficiently to 1, 2, and 5 kDa PEG; and assembled into PEGylated I53_dn5 nanoparticles based on SEC purification (
An alternative physical masking approach to PEGylation is the genetic fusion of hydrophilic unstructured polypeptides, such as XTENylation and PASylation (Schellenberger et al., 2009; Schlapschy et al., 2013; Zaman et al., 2019); these have been expressed on ferritin to extend its circulation time in vivo (Falvo et al., 2016; Lee et al., 2017). To express XTEN and PAS polypeptides on the outer surface of the I53_dn5A pentamer, we first designed a circularly permuted variant of I53_dn5A, called I53_dn5Acp7, with the N and C termini both facing outward. I53_dn5 nanoparticle formation was observed via SEC when XTEN, PAS, and another unstructured polypeptide known as ELP (Luginbuhl et al., 2017) were fused to the C terminus of the I53_dn5Acp7 pentamer (
Overall, based on SEC and SDS-PAGE analysis, the larger PAS polypeptide and PEG molecules impeded efficient nanoparticle assembly (
Masking the I53_Dn5 Nanoparticle Scaffold does not Enhance Anti-HA Antibody Responses
We first tested how effectively these three different surface masking strategies dampen antibody responses against the I53_dn5 nanoparticle without any viral glycoprotein antigen present. After three immunizations of 0.6 μg protein adjuvanted with AddaVax, the presence of glycans on either the I53_dn5B trimer (I53_dn5_Bgly) or both the I53_dn5A pentamer and I53_dn5B trimer (I53_dn5_ABgly) significantly reduced anti-I53_dn5A pentamer antibody responses compared to immunization with unmodified I53_dn5 nanoparticle (
We next assessed the immunological impact of masking the nanoparticle scaffold when the HA antigen was presented on the nanoparticle. Scaffold-masked HA-I53_dn5 nanoparticle immunogens were formed by assembling HA-I53_dn5B with I53_dn5A pentamers bearing either 10 glycans (HA-I53_dn5_Agly), 10 linear 2 kDa PEG chains (HA-I53_dn5_2C2kPEG), or 5 unstructured PAS polypeptides (HA-I53_dn5_PAS) (
Interestingly, a non-assembling control immunogen in which the trimeric component lacked the computationally designed interface that drives nanoparticle assembly (HA-1na0C3int2+I53_dn5A; (Ueda et al., 2020)) elicited significantly higher anti-I53_dn5A pentamer titers (
To further characterize the magnitude of the response to various parts of the HA-bearing nanoparticle immunogens, we quantified antigen- and scaffold-specific IgG concentrations in neat serum as well as antigen- and scaffold-specific B cells in lymph node germinal centers (GCs). We found the amount of anti-HA IgG in undiluted serum (˜3 mg/mL) was ˜3-fold higher than the amount of anti-I53_dn5 IgG (˜1 mg/mL), for both the HA-I53_dn5 and HA-I53_dn5_2C2kPEG immunogens (
We also assessed anti-HA IgG quality and binding affinity in a chaotropic ELISA that challenged serum IgG binding with 2 M NaSCN, which showed a non-significant trend of diminished antibody avidity in sera after the second and third immunizations for the non-assembling immunogen and the nanoparticle immunogens with PEG and PAS masking (
In summary, these three scaffold masking strategies reduced antibody responses against the I53_dn5 particle when no viral glycoprotein antigen was displayed. However, when HA and RSV F were presented on the I53_dn5 and I53-50 scaffolds, respectively, scaffold masking did not dampen anti-scaffold antibody responses and did not enhance, but in some cases diminished (e.g., PEG and PAS), antigen-specific antibody responses.
In a Series of Nanoparticle Immunogens that all Used the Same I53-50 Scaffold, Only HIV-1 Env was Subdominant to the Nanoparticle Scaffold
To our knowledge, there is no reported head-to-head immunogenicity study of different viral glycoprotein antigens on the same protein nanoparticle scaffold (Klasse et al., 2020). To comparatively evaluate the immunogenicity of a range of different viral glycoprotein antigens displayed on the same protein nanoparticle scaffold and the level of anti-scaffold antibody responses elicited by each, we displayed five different viral glycoprotein antigens (prefusion RSV F, SARS-CoV-2 RBD, influenza HA, and two different native-like HIV-1 Env trimers: ConM and AMC009) separately on the two-component nanoparticle I53-50 (
Following one, two, and three immunizations with 72.4 pmol antigen (equal to 5 μg HIV-1 Env ConM and 3.0 μg I53-50 for each nanoparticle immunogen;
The antigen-specific and scaffold-specific antibody titers did not correlate with the physical size of the antigen, measured by either antigen height or molecular weight. Furthermore, for the most part there are not substantial differences between the anti-scaffold responses in corresponding assembling and non-assembling groups (the exception being the RBD immunogens at Week 6) (
Competition from Excess I53-50 Nanoparticle Scaffold Suppresses Antigen-Specific Antibody Responses
To better understand the antigen vs. scaffold immunodominance hierarchies observed above and the potential role of antigenic competition between the displayed antigen and nanoparticle scaffold, we compared antigen-specific and scaffold-specific antibody responses elicited by a 10,000-fold dose range of RBD-I53-50 co-administered with a constant dose of excess I53-50 protein. Although we were unable to observe clear evidence of antigenic competition in the experiments presented above, we hypothesized that the addition of excess I53-50—to artificially inflate the scaffold to antigen ratio-might allow us to observe suppression of antigen-specific antibody responses due to antigenic competition, similar to how excess carrier protein outcompeted and suppressed hapten-specific antibody responses (Woodruff et al., 2018). We used the RBD nanoparticle immunogen in this experiment based on our finding above that the RBD is strongly immunodominant to the I53-50 scaffold (
We immunized mice with RBD-I53-50 comprising 1.7, 0.1, 0.01, 0.001, or 0.0001 μg RBD with or without co-administration of excess I53-50 to a total of 3 μg of the nanoparticle scaffold. After a single immunization, we observed a typical dose-response effect in both the RBD-specific and anti-scaffold antibody responses, with loss of detectable antibodies at 0.0001 g RBD and 0.002 μg I53-50, respectively. The effect of co-administering excess I53-50 was already apparent post-prime. RBD-specific antibodies were 8.1- and 4.4-fold lower at the 0.1 and 0.01 μg RBD doses relative to the conditions without excess scaffold, respectively, while anti-scaffold responses, in the presence of excess I53-50, were roughly constant over the entire dose range. The average post-prime antigen-specific to scaffold-specific AUC ratio was greater than 1 for all groups post-prime except for the 0.01, 0.001, and 0.0001 μg RBD doses with excess I53-50. Post-boost, these trends were amplified, with the exception that there was no diminution in the RBD-specific antibody responses when decreasing the RBD dose from 1.7 to 0.01 μg, although further decreases in dose led to lower anti-RBD responses. Suppression of the RBD-specific antibodies by excess I53-50 was more pronounced post-boost, with decreases of 113-, 266-, and 147-fold at doses of 0.1, 0.01, and 0.001 μg RBD relative to the conditions without excess scaffold, respectively. There was also a trend of reduced post-boost pseudovirus neutralization (IC50) in the presence of excess I53-50, with decreases of 23-, 32-, and 13-fold at doses of 0.1, 0.01, and 0.001 μg RBD, respectively. There was still a clear dose-response effect in the anti-scaffold responses in the absence of co-administered I53-50. Interestingly, the anti-scaffold responses with co-administered I53-50 trended higher than the 1.7 μg dose of RBD-I53-50, despite containing the same total amount of I53-50 scaffold. The average post-boost antigen-specific to scaffold-specific AUC ratio was less than 1 for only the 0.001 and 0.0001 μg RBD doses with excess I53-50, whereas this AUC ratio progressively increased for 1.7, 0.1, 0.01, and 0.001 μg RBD when no excess I53-50 was present. We also tried a similar competition experiment with ConM (but with a smaller dose range), but the anti-ConM antibody responses were so weak that no suppression of anti-ConM titers was detected when excess I53-50 was co-delivered. In addition, we tested if excess heterologous nanoparticle scaffold suppressed antigen-specific antibody responses by immunizing mice with RBD-I53-50 in the presence of excess I53_dn5 nanoparticles. Interestingly, we found that excess heterologous I53_dn5 scaffold did not suppress RBD-specific antibodies. Taken together, these data confirm that in the context of protein nanoparticle immunogens that display viral glycoprotein antigens, excess homologous nanoparticle scaffold, but not heterologous nanoparticle scaffold, can compete with and suppress antigen-specific binding and pseudovirus neutralizing antibody responses.
To better understand the role of anti-scaffold immune responses, we masked the underlying I53_dn5 nanoparticle in the HA-I53_dn5 immunogen using three different approaches: glycosylation, PEGylation, and PASylation. All three approaches successfully yielded nanoparticle immunogens co-displaying a large glycoprotein antigen and the masking moieties, showcasing the robustness and versatility of computationally designed two-component nanoparticles as a multivalent display platform. However, there are limits to what can be displayed on the nanoparticle exterior: the efficiency of in vitro assembly was substantially reduced for the PASylated particle. We then examined how shielding the scaffold impacted anti-HA antibody responses. To our knowledge, this is the first report of immune responses to a protein nanoparticle immunogen comprising a masked scaffold displaying an oligomeric viral glycoprotein antigen. Overall, scaffold masking did not increase anti-HA antibody titers and in some instances (i.e., PEGylation and PASylation) appeared to occlude cross-reactive epitopes in the HA stem. The partial disassembly of HA-I53_dn5_PAS nanoparticles due to their instability may also have contributed to the reduced HA stem responses. Overall, these observations suggest that masking the scaffolds of other nanoparticle immunogens that display an immunodominant antigen may be ineffective at improving the magnitude of the antigen-specific antibody response, although there are other beneficial effects that could derive from scaffold masking, particularly with glycans. For example, protein nanoparticle immunogens bearing high-mannose N-linked glycans can traffic more efficiently to draining lymph nodes and B cell follicles in vivo, resulting in enhanced germinal center formation and antibody responses against the displayed antigen or nanoparticle immunogen.
Here, we confirmed the immunodominance of prefusion RSV F, SARS-CoV-2 RBD, and influenza HA on the I53-50 scaffold, and showed the subdominance of two variants of HIV-1 Env (ConM and AMC009) on I53-50. To our knowledge, this is the first head-to-head comparison of the immunogenicity of different viral glycoprotein nanoparticle immunogens that all use the same scaffold. This study design allowed for direct comparison of the antigen-specific and scaffold-specific immune responses, and we showed that anti-scaffold antibody responses are not negatively correlated with antigen-specific responses for this set of immunogens. The subdominance of HIV-1 Env suggests that, in contrast to the other immunodominant antigens, masking the underlying scaffold may enhance anti-Env antibody responses.
Antigenic competition determines immunodominance patterns for complex immunogens (Brody and Siskind, 1969; Johansson et al., 1987). Subdominant antibody responses arise when BCR access is occluded and/or low frequency B cells or those with low-affinity BCRs cannot compete for expansion within germinal centers (Abbott and Crotty, 2020; Abbott et al., 2018; Dosenovic et al., 2018). Here, we showed that co-delivery of excess I53-50 scaffold with RBD-I53-50 immunogens suppressed immunodominant antigen-specific antibody responses, but co-delivery of excess heterologous I53_dn5 scaffold with RBD-I53-50 immunogens did not suppress antigen-specific antibody responses. These data suggest that immunodominant antibody responses (e.g., RBD-specific) are suppressed when subdominant (e.g., scaffold) epitopes are increased in abundance, are no longer physically linked to immunodominant epitopes, and/or are more accessible to BCRs. Therefore, for nanoparticle immunogens in which scaffold- and antigen-specific responses are on a roughly equal footing, anti-scaffold responses may impede antigen-specific responses. Our data also imply that protein nanoparticle immunogens with reduced antigen valency, in which some of the potential antigen-bearing sites are left vacant, could suffer from anti-scaffold responses suppressing antigen-specific responses. Overall, we have shown that protein nanoparticle scaffolds are a potential source of antigenic competition, which is an important consideration when designing complex immunogens.
In summary, our results inform the design of protein nanoparticle immunogens. Physically masking protein nanoparticle scaffolds reduces antibody responses against the scaffolds themselves, which is desirable since these antibodies will not contribute to protection upon subsequent infection. Scaffold masking using N-linked glycans in particular can have the additional benefit of enhancing vaccine trafficking and uptake in vivo.
Expi293F cells are derived from the HEK293F cell line (Life Technologies). Expi293F cells were grown in Expi293 Expression Medium (Life Technologies), cultured at 36.5° C. with 8% C02 and shaking at 150 rpm. HEK293T/17 is a female human embryonic kidney cell line (ATCC). VeroE6-TMPRSS2 cells are an African Green monkey Kidney cell line expressing TMPRSS2 (Lempp et al., 2021). Adherent cells were cultured at 37° C. with 5% C02 in flasks with DMEM+10% FBS (Hyclone)+1% penicillin-streptomycin. Adherent cells were not tested for mycoplasma contamination nor authenticated.
Female BALB/c mice (Stock #000651, BALB/c cByJ mice) four weeks old were obtained from Jackson Laboratory, Bar Harbor, Maine, and maintained at the Comparative Medicine Facility at the University of Washington, Seattle, WA, accredited by the American Association for the Accreditation of Laboratory Animal Care International (AAALAC). Animal procedures were performed under the approvals of the Institutional Animal Care and Use Committee (IACUC) of the University of Washington, Seattle, WA.
Detailed methods and code are reported elsewhere (Adolf-Bryfogle et al., 2021). Briefly, all possible residues on the outward facing surfaces of the I53_dn5A pentamer and I53_dn5B trimer when assembled into I53_dn5 nanoparticles were manually selected as candidate locations for designing in an NxT/S PNGS. Next, the CreateGlycanSequonMover in Rosetta™ was used to sequentially knock-in a single NxT/S sequon at these selected locations and obtain calculated energies of the new protein structure using the Rosetta™ score function. Both typical and enhanced sequons, which include an aromatic amino acid in the N-2 position to potentially increase glycosylation efficiency (Huang et al., 2017; Murray et al., 2015), were attempted at each position. Protein structures were first scored by Rosetta™ without a model glycan tree present to eliminate any potential interference of the glycan atoms. To filter out bad designs, outputs with a “total_energy” of >500 and an RMSD>0.25 Å and >0.40 Å compared to the original I53_dn5A and I53_dn5B scaffolds, respectively, were discarded. The re-designed protein structures that passed this filtering step were then glycosylated using the SimpleGlycosylateMover with a model tri-antennary Man9 N-linked glycan, modeled using the GlycanTreeModeler, and scored by Rosetta™. A second round of filtering was performed using the same criteria as above. After proteins with a single PNGS were experimentally screened for expression and glycan occupancy (see below), combinations of PNGS were designed using the same computational pipeline. The XML file for this combinatorial selection is provided as Supplementary Material. The recently reported I53-50A_4gly subunit (Read et al., 2022) was used to generate the glycosylated RSV F-I53-50 immunogen shown in
For each design that resulted from the above computational pipeline, the final construct contained an N-terminal signal peptide derived from bovine prolactin (MDSKGSSQKGSRLLLLLVVSNLLLPQGVLA; SEQ ID NO:97) and C-terminal myc and hexa-histidine tags (LEEQKLISEEDLHI-HHHHH; SEQ ID NO:98). These constructs and others used in this study were cloned by GenScript into the pCMV/R (VRC 8400) mammalian expression vector using the restriction sites Xbal and AvrII. Preparation of plasmids for expression of the following proteins have been previously described: I53_dn5A pentamer and I53_dn5B trimer (Ueda et al., 2020), I53-50B.4PT1 pentamer (Bale et al., 2016), influenza HIMI15 fusion to I53_dn5B trimer (Boyoglu-Barnum et al., 2021), HIV-1 ConM Env fusion to I53-50A trimer (Brouwer et al., 2019), HIV-1 AMC009 Env trimer (Sliepen et al., 2019), RSV DS-Cav1 fusion to I53-50A trimer (Marcandalli et al., 2019), SARS-CoV-2 RBD fusion to I53-50A trimer (Walls et al., 2020), and SARS-CoV-2 Spike HexaPro trimer (Hsieh et al., 2020). HIV-1 AMC009 Env trimer was fused to I53-50A trimers as described in (Brouwer et al., 2019). The amino acid sequences for all proteins used in this study are provided in Supplementary Table 1.
The nanoparticle components I53-50A and I53-50B.4.PT1 (Bale et al., 2016), and I53_dn5A and I53_dn5B (Ueda et al., 2020), were expressed in Lemo21 (DE3) (NEB) in LB (10 g Tryptone, 5 g Yeast Extract, 10 g NaCl) and grown in 2 L baffled shake flasks. Cells were grown at 37° C. to an OD600 ˜0.8, and then induced with 1 mM IPTG. Expression temperature was reduced to 18° C. and the cells were shaken for ˜16 h. The cells were harvested and lysed by microfluidization using a Microfluidics M110P at 18,000 psi in 50 mM Tris, 500 mM NaCl, 30 mM imidazole, 1 mM PMSF, (with 0.75% CHAPS only for I53-50 proteins). Lysates were clarified by centrifugation at 24,000 g for 30 min and applied to a 2.6×10 cm Ni Sepharose™ 6 FF column (Cytiva) for purification by IMAC on an AKTA Avant150 FPLC system (Cytiva). Protein of interest was eluted over a linear gradient of 30 mM to 500 mM imidazole in a background of 50 mM Tris pH 8, 500 mM NaCl, (with 0.75% CHAPS only for I53-50 proteins) buffer. Peak fractions were pooled, concentrated in 10K MWCO centrifugal filters (Millipore), sterile filtered (0.22 m) and applied to a Superdex™ 200 Increase 10/300 SEC column (Cytiva) using 50 mM Tris pH 8, 500 mM NaCl, (with 0.75% CHAPS only for I53-50 proteins) buffer. After sizing, bacterial-derived components were tested to confirm low levels of endotoxin before using for nanoparticle assembly.
Small-scale 2.0 mL cultures of Expi293F cells were grown in suspension to a density of 3.0×106 cells per mL and transiently transfected using PEI-MAX (Polyscience) and cultivated for 5 days in Expi293F expression medium (Life Technologies) at 37° C., 70% humidity, 8% C02, and rotating at 150 rpm. Supernatants were clarified by centrifugation (5 min at 4000 ref), PDADMAC solution was added to a final concentration of 0.0375% (Sigma Aldrich, #409014), and a final spin was performed (5 min at 4000 rcf). Supernatants were concentrated using a 5 kDa MWCO spin filter (Sartorius) to a final volume of ˜50 μL. These concentrated supernatants were then assessed for protein expression by Western blot using an anti-myc mouse primary antibody and an anti-mouse HRP-conjugated goat secondary antibody. Glycan occupancy for each protein design was assessed by increased molecular weight gel shifts on the Western blots compared to the unglycosylated parent protein.
For large-scale protein expression, 800 mL cultures of Expi293F cells were transiently transfected and cultivated for 5 days as described above. Proteins were purified from clarified supernatants via a batch bind method where Talon cobalt affinity resin (Takara) was added to supernatants and allowed to incubate for 15 min with gentle shaking. Resin was isolated using 0.2 μm vacuum filtration and transferred to a gravity column, where it was washed with 20 mM Tris pH 8.0, 300 mM NaCl, and protein was eluted with 3 column volumes of 20 mM Tris pH 8.0, 300 mM NaCl, 300 mM imidazole. This batch bind process was repeated a second time on the supernatant flow-through from the filtration step. Eluate with protein was concentrated to ˜2 mL using a 30 kDa MWCO Amicon concentrator (Millipore Sigma). The concentrated sample was sterile filtered (0.2 μm) and applied to a Superdex™ 200 Increase 10/300 SEC column (Cytiva) using 25 mM Tris pH 8.0, 150 mM NaCl, 0.75% CHAPS, 5% glycerol buffer.
Env-I53-50A constructs together with a plasmid expressing furin were transfected into Expi293F cells using PEI-MAX and cultured for 6 days. Furin was added to ensure optimal furin-mediated cleavage of Env (ConM-I53-50A:furin ratio was 3:1, AMC009-I53-50A:furin ratio was 2:1). Cells were spun down and supernatants filtered through a 0.2 μm Steritop™ filter. Env-I53-50A proteins were purified by running the clarified supernatant over a PGT145 bNAb-affinity chromatography column. Eluted proteins were concentrated using vivaspin 100 kDa spin columns. Concentrated proteins were subsequently applied to a Superose™ 6 increase 10/300 GL column (Cytiva) to remove aggregated proteins using a buffer of 25 mM Tris pH 8.0, 125 mM NaCl, 5% glycerol. I53-50B.4PT1 was added in a 1:1 ratio and incubated at 4° C. overnight. Assembled particles were again applied to a Superose™ 6 increase 10/300 GL column (GE healthcare) to remove unassembled components. Particles were buffer-exchanged into PBS with 250 mM sucrose by dialysis at 4° C. overnight, followed by a second dialysis step of 4 h, using a Slide-A-Lyzer™ MINI dialysis device (20 kDa cutoff, ThermoFisher Scientific). The 250 mM sucrose was added to increase recovery after freeze-thawing.
Protein with reduced unpaired cysteines was first purified by size exclusion chromatography (SEC) using buffer that contained 1 mM TCEP, and then SEC-purified again to exchange buffer with HEPES coupling buffer (pH 7.4, 20 mM HEPES, 150 mM NaCl, 1 mM EDTA, 0.75% CHAPS). Using a freshly prepared 10 mM PEG-maleimide solution in HEPES coupling buffer, a 1.0 mL maleimide-thiol coupling reaction was prepared at 5:1 PEG:Cys (mol/mol) and a 50 μM final protein concentration. This reaction was incubated with rocking at ambient temperature for 3 h, then overnight at 4° C. The reaction was quenched by adding reduced glutathione (GSH) to 2 mM. Unreacted PEG was removed using SEC.
The protein concentration of individual nanoparticle components (e.g., I53_dn5A pentamer and I53_dn5B trimer, or I53-50A trimer and I53-50B.4PT1 pentamer) was determined by measuring 280 nm absorbance using a UV/vis spectrophotometer (Agilent Cary 8454) and estimated extinction coefficients (Marcandalli et al., 2019). Particle assembly was performed by adding equimolar amounts of trimer and pentamer components to reach a final protein concentration of 20 μM (10 μM for each individual component) and resting on ice for at least 30 min. Assembled particles were sterile filtered (0.2 μm) immediately before SEC purification using a Superose™ 6 Increase 10/300 GL column or a HiLoad™ 26/600 Superdex™ 200 pg column for the RBD-I53-50 nanoparticle immunogen.
A sample volume of 3 μL at a concentration of 70 μg/mL protein in 50 mM Tris pH 8, 150 mM NaCl, 5% v/v glycerol was applied to a freshly glow-discharged 300-mesh copper grid (Ted Pella) and incubated on the grid for 1 minute. The grid was then dipped in a 40 μL droplet of water, excess liquid was blotted away with filter paper (Whatman), the grid was dipped into 3 μL of 0.75% w/v uranyl formate stain, stain was immediately blotted off with filter paper, then the grid was dipped again into another 3 μL of stain and incubated for ˜30 seconds. Finally, the stain was blotted away and the grids were allowed to dry for 1 minute prior to storage or imaging. Prepared grids were imaged in a Talos model L120C transmission electron microscope using a Gatan camera at 57,000×.
ELISA was used to measure binding of HA-foldon, HA-1na0C3int2, HA-ferritin, HA-I53_dn5, HA-I53-dn5_ABgly, and HA-I53_dn5_2C2kPEG to monoclonal antibodies CR9114 and 5J8 using the ELISA method described below. Monoclonal antibodies were serially diluted from 300 to 0.5 ng/mL.
Dynamic light scattering (DLS) was used to measure the hydrodynamic diameter of nanoparticle immunogens on a DynaPro™ NanoStar instrument (Wyatt Technologies). 2 μL of 0.1 mg/mL protein was applied to a quartz cuvette to obtain intensity measurements from 10 acquisitions of 10 s each. Increased viscosity due to 5% glycerol in the buffer was accounted for by the software.
Endotoxin levels in immunogen samples were measured using the EndoSafe Nexgen-MCS System (Charles River). Samples were diluted 1:100 in Endotoxin-free LAL reagent water, and applied into wells of an EndoSafe LAL reagent cartridge. Endotoxin content was analyzed using Charles River EndoScan-V software, which automatically back-calculates for the 1:100 dilution factor. Endotoxin values reported as EU/mL were converted to EU/mg based on protein concentration obtained by UV-Vis measurements. All endotoxin values were <100 EU/mg.
Mice were inoculated with 0.9 μg HA and/or 0.6 μg I53_dn5 scaffold (1.2 μg I53_dn5 scaffold for the HA-I53_dn5_ABgly group due to 50% HA valency) for the scaffold masking experiments (
The protocol was adapted from Tiller et al. (Tiller et al., 2008). First, protein or goat anti-mouse IgG+IgM (Jackson ImmunoResearch, 115-005-068) was incubated for 1 h on 96-well Nunc MaxiSorp plates (Thermo Scientific) (2.0 μg/mL, 50 μL per well). Then, 200 μL of Tris Buffered Saline Tween (TBST: 25 mM Tris pH 8.0, 150 mM NaCl, 0.05% (v/v) Tween20) with 2% (w/v) BSA was added to each well and incubated for 1 h. Plates were washed 3× in TBST using a robotic plate washer (BioTek). Then, 50 μL of serum dilutions starting at 1:100 and serially diluting 5-fold seven times using TBST with 2% (w/v) BSA (8 total dilutions) were added to each well and incubated for 1 h. In wells with anti-mouse IgG capture antibody, mouse IgG lambda control (BD Pharminogen, 553485) was serially diluted from 500 to 0.5 ng/mL in TBST in triplicate and 50 μL of each dilution incubated for 1 h. After washing plates 3× with TBST, 50 μL of anti-mouse HRP-conjugated goat secondary antibody (CellSignaling Technology) diluted 1:2,000 in TBST with 2% (w/v) BSA was incubated in each well for 1 h. Following a final 3× TBST plate wash, 100 μL of ABTS (2,2′-Azinobis [3-ethylbenzothiazoline-6-sulfonic acid]-diammonium salt, Thermo Scientific) or TMB (3,3′,5′,5-tetramethylbenzidine, SeraCare) was added to each well and rested for 30 or 2 min, respectively. TMB was quenched with 100 μL of 1 N HCl. Absorbance at 405 or 450 nm, respectively, was immediately collected for each well on a SpectraMax™ M5 plate reader (Molecular Devices). All steps were performed at ambient temperature. Data were plotted in Prism (GraphPad) to determine AUC values. A logarithmic equation fit to the linear portion of the sigmoidal curve of the mouse IgG control was used to calculate concentration (mg/mL) of IgG in mouse sera for anti-I53_dn5 and anti-HA titers.
The protocol was adapted from Langowski et al. (Langowski et al., 2020). First, recombinant I53_dn5 nanoparticle or H1 MI15-foldon protein was incubated for 1 h on 96-well Nunc MaxiSorp™ plates (Thermo Scientific) (2.0 μg/mL, 50 μL per well). Then, 200 μL of Tris Buffered Saline Tween (TBST: 25 mM Tris pH 8.0, 150 mM NaCl, 0.05% (v/v) Tween20) with 2% (w/v) BSA was added to each well and incubated for 1 hr. Plates were washed 3× in TBST using a robotic plate washer (BioTek). Then, 50 μL of a 1:2,500 serum dilution in TBST with 2% (w/v) BSA was added to each well and incubated for 1 hr. To test for avidity, 50 μL of 2 M sodium thiocyanate (NaSCN) or PBS (control) was added to wells for 15 min. After washing plates 3× with TBST, 50 μL of anti-mouse HRP-conjugated goat secondary antibody (CellSignaling Technology) diluted 1:2,000 in TBST with 2% (w/v) BSA was incubated in each well for 1 hr. Following a final 3× TBST plate wash, 100 μL of TMB (SeraCare) was added to each well and rested for 2 min before quenching with 100 μL of 1 N HCl. Absorbance at 450 nm was immediately collected for each well on a SpectraMax M5 plate reader (Molecular Devices). All steps were performed at ambient temperature. Percentage OD450 in the corresponding NaSCN/PBS wells were used to determine the avidity index.
The protocol was adapted from Brouwer et al. (Brouwer et al., 2019). First, 50 μL of 6.5 nM His-tagged protein per well was incubated for 1 h in 96-well Ni-NTA plates (Qiagen). Then, 200 μL of Tris Buffered Saline Tween (TBST: 25 mM Tris pH 8.0, 150 mM NaCl, 0.05% v/v Tween20) with 2% (w/v) BSA was added to each well and incubated for 1 h. Plates were washed 3× in TBST using a robotic plate washer (BioTek). Then, 50 μL of serum dilutions starting at 1:100 and serially diluting 5-fold seven times using TBST with 2% (w/v) BSA (8 total dilutions) were added to each well and incubated for 1 h. After washing plates 3× with TBST, 50 μL of anti-mouse HRP-conjugated goat secondary antibody (CellSignaling Technology) diluted 1:2,000 in TBST with 2% (w/v) BSA was incubated in each well for 1 h. Following a final 3× TBST plate wash, 100 μL of TMB (SeraCare) was added to each well and rested for 2 min, then 100 μL of 1 N HCl was added to each well to quench the reaction. Absorbance at 450 nm was immediately collected for each well on a SpectraMax™ M5 plate reader (Molecular Devices). Data were plotted in Prism (GraphPad) to determine AUC values. All steps were performed at ambient temperature.
Depletion antigen (I53_dn5) was added to reach a final concentration of 0.3 mg/mL in the starting 1:100 serum dilution used in ELISA and incubated for 15 min at room temperature. Then, serial dilutions and the ELISA procedure was performed as described above.
Reporter viruses were prepared as previously described (Creanga et al., 2021). In brief, H1N1 virus was made with a modified PB1 segment expressing the TdKatushka reporter gene (R3ΔPB1) and propagated in MDCK-SIAT-PB1 cells, while H5N1 reporter virus was made with a modified HA segment expressing the reporter (R3ΔHA) and produced in cells stably expressing H5 HA. Virus stocks were stored at −80° C. Mouse sera were treated with receptor destroying enzyme (RDE II; Denka Seiken) and heat-inactivated before use in neutralization assays. Immune sera was serially diluted and incubated for 1 h at 37° C. with pre-titrated virus. Serum-virus mixtures were then transferred to 96-well plates (PerkinElmer), and 1.0×104 MDCK-SIAT1-PB1 cells (Bloom et al., 2010; Creanga et al., 2021) were added into each well. After overnight incubation at 37° C., the number of fluorescent cells in each well was counted automatically using a Celigo image cytometer (Nexcelom Biosciences). IC50 values, defined as the serum dilution or antibody concentration that gives 50% reduction in virus-infected cells, were calculated from neutralization curves using a four-parameter nonlinear regression model and plotted with GraphPad Prism.
D614G SARS-CoV-2 S (Crawford et al., 2020) pseudotyped vesicular stomatitis viruses (VSVs) were prepared as described previously (McCallum et al., 2021; Sauer et al., 2021). Briefly, 293T cells in DMEM supplemented with 10% FBS, 1% PenStrep seeded in 10-cm dishes were transfected with the plasmid encoding for the S glycoprotein using lipofectamine 2000 (Life Technologies) following manufacturer's indications. One day post-transfection, cells were infected with VSV(G*ΔG-luciferase) and after 2 h were washed five times with DMEM before adding medium supplemented with anti-VSV-G antibody (I1-mouse hybridoma supernatant, CRL-2700, ATCC). Virus pseudotypes were harvested 18-24 h post-inoculation, clarified by centrifugation at 2,500×g for 5 min, filtered through a 0.45 m cut off membrane, concentrated 10 times with a 30 kDa cut off membrane, aliquoted and stored at −80° C.
VeroE6-TMPRSS2 cells (Lempp et al., 2021) were cultured in DMEM with 10% FBS (Hyclone), 1% PenStrep, and 8 μg/mL puromycin with 5% CO2 in a 37° C. incubator (Caron-VWR). One day prior to infection, 96-well plates were plated with 20,000 cells. The following day, cells were checked to be at 80% confluence. In an empty half-area 96-well plate a 1:3 serial dilution of sera was made in DMEM and then diluted pseudovirus was added to the serial dilution and incubated at room temperature for 30-60 min. After incubation, the sera-virus mixture was added to the cells at 37° C. and 2 hours post-infection, 40 μL 20% FBS-2% PenStrep DMEM was added. After 17-20 hours 40 μL/well of One-Glo-EX™ substrate (Promega) was added to the cells and incubated in the dark for 5-10 min prior to reading on a BioTek plate reader. Measurements were done in at least duplicate. Relative luciferase units were plotted and normalized in Prism (GraphPad). Nonlinear regression of log(inhibitor) versus normalized response was used to determine IC50 values from curve fits.
Recombinant I53_dn5A pentamer, I53_dn5B trimer, and H1 MI15 hemagglutinin trimer were biotinylated using the EZ-Link™ Sulfo-NHS-LC Biotinylation Kit (ThermoFisher). Biotinylated protein was then incubated with differing amounts of streptavidin-PE (Prozyme) and probed with SA-AF680 (Invitrogen) to determine the ratio of biotin to streptavidin at which there was excess biotin available for SA-AF680 to bind. This ratio was used to determine the concentration of biotinylated protein, allowing for calculation of the amount of SA-PE required to create a 6:1 molar ratio of protein protomer to SA-PE. Biotinylated HA was incubated with SA-APC for 30 min at room temperature and purified on a Superose™ 6 Increase 10/300 GL size exclusion column (Cytiva), and the tetramer fraction was centrifuged in a 100 kDa molecular weight cutoff Amicon Ultra filter (Millipore). The tetramer concentration was determined by measuring the absorbance of APC at 650 nm. I53_dn5A and I53_dn5B proteins were biotinylated and tetramerized with SA-PE in the same manner, and the concentration was determined by measuring the absorbance of PE at 565 nm. The APC decoy reagent was generated by conjugating SA-APC to Dylight 755 using a DyLight™ 755 antibody labeling kit (ThermoFisher), washing and removing unbound DyLight 755, and incubating with excess of an irrelevant biotinylated His-tagged protein. The PE decoy was generated in the same manner, by conjugating SA-PE to Alexa Fluor 647 with an AF647 antibody labeling kit (ThermoFisher).
For phenotyping B cells, 6-week old female BALB/c mice, three per dosing group, were immunized intramuscularly with 50 μL per injection site of immunogen formulations mixed 1:1 (vol/vol) with AddaVax™ adjuvant on day 0. All experimental mice were euthanized for harvesting of inguinal and popliteal lymph nodes on day 11. The experiment was repeated twice. Popliteal and inguinal lymph nodes were collected and pooled for individual mice. Cell suspensions were prepared by mashing lymph nodes and filtering through 100 μm Nitex™ mesh. Cells were resuspended in PBS containing 2% FBS and Fc block (2.4G2), and were incubated with 10 nM decoy tetramers at room temperature for 20 min. I53_dn5A-PE tetramer and HA-APC tetramer, or I53_dn5B-PE tetramer and HA-APC tetramer, were added at a concentration of 10 nM and incubated on ice for 20 min. Cells were washed, incubated with anti-PE and anti-APC magnetic beads on ice for 30 min, then passed over magnetized LS columns (Miltenyi Biotec). Bound B cells were stained with anti-mouse B220 (BUV737), CD3 (PerCP-Cy5.5), CD138 (BV650), CD38 (Alexa™ Fluor 700), GL7 (eFluor 450), IgM (BV786), IgD (BUV395), CD73 (PE-Cy7), and CD80 (BV605) on ice for 20 min. Cells were run on a Cytek Aurora and analyzed using FlowJo software (Treestar). Cell counts were determined using Accucheck cell counting beads.
Multi-group comparisons were performed using the Brown-Forsythe one-way ANOVA test and Dunnett's T3 post hoc analysis in Prism 9 (GraphPad) unless mentioned otherwise. All correlations were two-tailed Spearman's correlations based on ranks. Differences were considered significant when P values were less than 0.05.
QKLISEEDLHHHHHH (SEQ ID NO: 160)
QKLISEEDLHHHHHH (SEQ ID NO: 161)
HHHH (SEQ ID NO: 165)
RKDGEWVLLSTFLGSGLNDIFEAQKIEWHEGHHHHHH (SEQ ID NO: 170)
QAYVRKDGEWVLLSTFLGRSLEVLFQGPGHHHHHHHHSAWSHPQFEKGGGSGGGGSGGSAW
SHPQFEK (SEQ ID NO: 173)
QSSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKGSGSGSGLNDIFEAQKIEWHEGSGSGSHH
HHHHHH (SEQ ID NO: 175)
GSGSGGSGHHHHHHHH (SEQ ID NO: 179)
This application claims priority to U.S. Provisional Patent Application Ser. No. 63/369,843 filed Jul. 29, 2022, incorporated by reference herein in its entirety.
This invention was made with government support under Grant No. HDTRA1-18-1-0001, awarded by the Defense Threat Reduction Agency (DTRA). The government has certain rights in the invention.
| Number | Date | Country | |
|---|---|---|---|
| 63369843 | Jul 2022 | US |