TREA

HIV-1 virus isolates of a subtype and its differential diagnostics

Follow

Information

  • Patent Grant
  • 5965135
  • Patent Number
    5,965,135
  • Date Filed
    Thursday, April 20, 1995
    29 years ago
  • Date Issued
    Tuesday, October 12, 1999
    24 years ago
Information
Abstract
Three new HIV-1 isolates HIV-1 D747(ECACC V92082718), HIV-1 D757(ECACC V92082719) and HIV-1 D760(ECACC V92082720) are disclosed, which represent a further independent subtype of the HIV-1 family and have been recovered from Indian patients which at the time when the virus was isolated showed no typical AIDS symptoms. Also disclosed are vaccines against HIV-1 infections by this subtype and a process for producing the same, as well as the use of the HIV-1 infection, as well as for differential diagnosis.
Description

The invention relates to new HIV-1 virus isolates of a subtype, vaccines against HIV-1 virus infections of this subtype, methods of producing same, and the use of the virus isolates for the production of vaccines and for differential diagnostics.
Hitherto, efforts to develop agents for the prophylaxis and therapy of HIV infections have focused on the inhibition of the reverse transcriptase or some other enzyme of the HIV-1 virus such as, for example, protease. Thereby a specific inhibition of viral replication in contrast to cellular replication is intended to be accomplished. Nevertheless, the antiviral agents of prior art suffer from the drawback that they are accompanied by a relatively high toxicity towards the cells, i.e. they do not only affect the virus.
Those groups of substances which have been identified as being active against HIV viruses include, inter alia, various nucleoside analogues (azidothymidine, di-deoxyinosine and di-deoxycytidine). However, a massive formation of resistence of the virus has been detected after some relatively short periods of therapy with these substances {Zimmermann et al., Abstract No. 3656, IV International Conference on AIDS, Stockholm, 1988, Rubsamen-Waigmann et al., Infection 19, Suppl. 2, 77-82, 1991}. Furthermore, all of the substances mentioned produce considerable side-effects, at least when applied in higher doses.
Another inhibitor of reverse transcriptase is the substance Suramin. However, this substance, due to its toxicity towards the mammal organism, is also not suitable for prophylaxis or therapy of HIV-virus infections {H. Mitsuya et al. "Suramin Protection of T-Cells in vitro against Infectivity and Cytopathic Effect of HTLV-III", Science 226 (1984), pages 172-174}.
Further development has led to reverse transcriptase inhibitors which are less toxic towards the mammal organism. These include substances such as dextran sulfate and pentosan polysulfate, which have proven to display a HIV-1-inhibiting effect in vivo, as has been described in DE 36 01 136 and in EP 0 293 826.
In addition to a chemotherapeutic treatment of HIV infections there is basically the possibility of a gene therapy or immunotherapy. Gene therapy comprises the incorporation of parts of viral nucleic acids in human cells, especially in the target cells of the HIV virus, for example the CD4-positive cells of the immune system. Then, the viral messenger RNA (m-RNA) can be neutralized by the formation of an "antisense" RNA, i.e. an RNA complementary to m-RNA, and hence the virus proliferation can be terminated. In some other form, oligonucleotides or structures chemical related thereto that are complementary to m-RNA can be employed. In immunotherapy, antigens are administered after the infection which are expected to support the immune response to HIV.
Meanwhile, the World Health Organization (WHO) estimates a number of at least 13 million of HIV-infected people worldwide; no country has been left free from infections with HIV-1 or HIV-2 or both viruses at the same time. It is urgently necessary to develop a vaccine for protection from HIV infections in order to prevent the epidemic from farther spreading. Here, and also in immunotherapy, the main problem is the high variability of the HIV viruses: a prophylactic inoculation should and must include all of the possible virus variants. Epidemiologic investigations in combination with the genetic characterization of the viruses produced the result that several subtypes do already exist in both virus families {Myers et al., Human Retroviruses and AIDS, Los Alamos, 1991; Dietrich et al., Nature 342, 948-950, 1989}, which subtypes are significantly distinguished from one another with respect to their hereditary information to a degree such that one single vaccine will not be capable to be active against all variants. Moreover, these subtypes are also subject to different geographic distributions.
The present invention provides three new HIV 1 virus isolates HIV-1.sub.D757, HIV-1.sub.D747, HIV-1.sub.D760, which, surprisingly, form a further independent subtype of the HIV-1 family and have been recovered from three Indian patients who, at the time of virus isolation, did not show any typical AIDS symptoms. Furthermore, the invention also includes virus isolates of the HIV-1 type which are up to 30%, and preferably up to 5%, divergent from HIV-1.sub.D757, HIV-1.sub.D747, and HIV-1.sub.D760.
The virus isolates, in accordance with the regulations according to the Budapest Treaty, have been deposited with the European Collection of Animal Cell Cultures (ECACC), Porton Down, Salisbury, Wiltshire, United Kingdom, on Aug. 27, 1992, under the following Accession Numbers:
HIV-1.sub.D747 --ECACC V92082718
HIV-1.sub.D757 --ECACC V92082719
HIV-1.sub.D760 --ECACC V92082720
The virus isolates proliferate on fresh mononuclear cells of peripheral blood, i.e. lymphocytes and macrophages.
The invention further provides a vaccine having an activity spectrum against this specific HIV-1 subtype.
The vaccine contains, as the active ingredient, the peptides
1. MPNGTKSNS SEQ ID NO: 7, MPNGTKGNS SEQ ID NO: 8, MPNGTKSNL SEQ ID NO: 9,
2. RNEKDLLALDSWKN SEQ ID NO: 10,
combinations comprising said peptides or longer or shorter subpeptides thereof being up to 7 amino acids in length.
Said peptides are derived from the env region of the strains according to the invention (cf. FIG. 1). The nucleotide sequences of these viruses in the env gene over a range of 1.8 kb are only to 79.4-81.6% homologous with viruses of the North American/European subtype and to 78.9-81.2% homologous with prototype viruses of the Central African subtype. The homology on the amino acid level is 72.1-75.9% and 71.2-74.2%, respectively (cf. Table) . Thus, these viruses genetically are to be classified between these two subtypes and form some further independent subtype which is also distinguished from the subtypes found in Rwanda/Uganda and in Northern Thailand by genetic equidistance.
Upon comparison of the amino acid sequences of the env proteins of HIV-1.sub.D757, HIV-1.sub.D747, HIV-1.sub.D760 with the consensus sequences as derived for all of the HIV env sequences already published, there result for the env region two short ranges, in which the three Indian sequences are different from all of the other HIV-1 sequences in 7 of 9 and in 7 of 14 amino acids, respectively (FIG. 1). Peptides from these regions are preferably suitable for a vaccine having a specific spectrum of activity against the Indian subtype, and particularly so, if the vaccine consists of a combination of these peptides.
The peptides according to the invention are synthetically produced and, if advantageous, are chemically modified. These peptides or longer as well as shorter subpeptides, down to 7 amino acids in length, thereof are also a constituent of this invention, and so are their modified forms.
Furthermore, the invention also relates to a vaccine which contains, as the active ingredient, peptides from variable regions of other genes of HIV-1.sub.D757, HIV-1.sub.D747, HIV-1.sub.D760, if the deviation from the corresponding sequence of HIV-1 viruses of other subtypes is more than 30%.
In the vaccine, there may further be used antigens from the viruses according to the invention or peptide combinations or combinations of peptides and antigens. More specifically, the use of such antigens or peptides is preferred which, within the loop of the coat glycoprotein (amino acids 423-450, relative to HIV-1.sub.Lai), is responsible for binding to the CD4-receptor, contain a glycosylation site (NXT/S) immediately in front of cysteine 450 (HIV-1.sub.Lai). This glycosylation site is typical for the Indian viruses HIV-1.sub.D757, HIV-1.sub.D747 und HIV-1.sub.D760. This glycosylation site has not been encountered among 29 HIV-1 envgenes that have been sequenced worldwide.
One preferred embodiment is a vaccine which is employed for prophylaxis prior to infections. Another preferred embodiment consists of that the vaccine is used as an immunotherapeutic to be employed after the infection and also covers the spectrum of variants of this subtype. The vaccine is administered either for injection with adjuvant or as an oral, genital or rectal form of application, e.g. via nanoparticles.
Furtheron, the subject matter of the invention comprises a process for producing a vaccine against HIV-1 virus infections from the viruses HIV-1.sub.D757, HIV-1.sub.D747 and HIV-1.sub.D760 as well as the use of these viruses for the production of a vaccine.
In still one further embodiment, the viruses HIV-1.sub.D757, HIV-1.sub.D747 and HIV-1.sub.D760 are transferred into a suitable host animal and allowed to proliferate therein. Then, the antibodies formed, after appropriate work-up as also known in the art for other vaccines, are used as a passive vaccine against HIV virus infections. As the host animals, more particularly, there may be used, suitable types of monkeys, but also animals that can be immunized without developing HIV symptoms (e.g. rabbits) {Filice et al., Nature 335 (1988), 366-368}.
Human monoclonal antibodies against HIV-1.sub.D757, HIV-1.sub.D747 and HIV-1.sub.D760 are also suitable for producing a vaccine for a protection against HIV-1 virus infections of this subtype.
In a further embodiment, in a suitable vector, DNA from which a RNA complementary to the viral m-RNA can be fully or partially transcribed, is transfected into human cells of the immune system and, hence, is conveyed into man. Thus, the viral m-RNA is competitively excluded from the further augmentation cycle. Likewise, synthetic oligonucleotides can be used for neutralizing the viral m-RNA.
In addition to the applications for therapy and vaccine production, HIV-1.sub.D757, HIV-1.sub.D747 and HIV-1.sub.D760 can also be used for differential diagnostics in order to distinguish infections with this subtype from other subtypes. For differential diagnostics, selected regions of the DNA of HIV-1.sub.D757, HIV-1.sub.D747 and HIV-1.sub.D760 are utilized which either do not occur at all in the prototype HIV-1.sub.Lai or are significantly different therefrom (by more than 30%). From these regions, peptides or nucleic acids for diagnostics are prepared according to conventional methods (labelling with radioactive isotopes, immunofluorescence test, ELISA etc.).
Therefore, it is also a constituent of this invention to use HIV-1.sub.D757, HIV-1.sub.D747 and HIV-1.sub.D760, or antigens, peptides or nucleic acids thereof, for the differential diagnostics for differentiating between infections with the subtype, characterized by HIV-1.sub.D757, HIV-1.sub.D747 or HIV-1.sub.D760, and infections with other HIV-1 subtypes as defined by the prototypes HIV-1.sub.Lai (U.S.A./Europe) HIV-1.sub.Mal (Central Africa), HIV-1.sub.U455 (Uganda/Rwanda) and Northern Thailand.
It is also possible to employ peptide residues or PCR tests based on HIV-1.sub.D757, HIV-1.sub.D747 or HIV-1.sub.D760, by means of which distinction can be made between viruses of this subtypes from other HIV-viruses.





Hereinbelow, the Figures and the Table are described:
The Table shows the nucleotide and amino acid sequence homology between HIV-1.sub.D757, HIV-1.sub.D747 or HIV-1.sub.D760 and other HIV-1 virus subtypes in percent. The sequences were compared by using Mikrogenie.TM. sequencing software by the company Beckman.
FIG. 1 shows the amino acid sequences in single character notation of the three Indian env clones in comparison to the corresponding sections of other subtypes. Highlighted are the two peptides 1 and 2, in which the Indian subtype is mainly different from the other sequences, and the additional glycolisation site (underlined) in immediate vicinity to the CD4 binding domain.
(-) denotes identical amino acids;
(.) denotes missing aminoacids.
FIG. 2 shows the relation of the sequences HIV-1.sub.D757, HIV-1.sub.D747 or HIV-1.sub.D760 to the remaining viruses in the phylogenetic tree of the viruses. This tree was established with the use of PAUP {Smith, T. F. et al., Nature 333, 573-575 (1988)} and the Version 3.21 of the PHYLIP bootstrappin algorithm.





TABLE__________________________________________________________________________Homology of Indian HIV-1 isolates and American/European or prototypicalAfrican HIV-1 sequences (1.8 kb PCR-fragment, corresponding to positions 6129-7976 ofHIV-1.sub.Lai)HIV-1 Lai SF2 Eli Mal SIVepz__________________________________________________________________________D757 79.7 (75.7) 81.6 (75.9) 81.2 (74.2) 80.6 (73.7) 66.1 (61.2) D747 79.4 (73.5) 80.9 (75.6) 80.7 (72.8) 78.9 (73.2) 65.8 (63.2) D760 80.7 (72.1) 81.4 (73.6) 80.9 (71.2) 80.2 (71.7) 66.1 (61.0) Lai 90.0 (84.1) 83.7 (76.2) 82.8 (74.3) 65.0 (60.1) SF2 83.8 (75.6) 82.8 (74.6) 64.3 (62.0) Eli 85.2 (76.9) 65.7 (61.9) Mal 66.4 (63.2)__________________________________________________________________________
__________________________________________________________________________FIG. 1__________________________________________________________________________HIV-1.sub.Bru S-K--DLGNATN-NSSN.TNSSSGEMMMEKG--------IS- - HIV-1.sub.SF2 DLGKATN-NSSN.WKEEI......KG--------I-- - HIV-1.sub.D757 SLWDQSLKPCVKLTPLCVTLNCTNA...NVTYDN..........GNYTEEIKNCSFNTTT - HIV-1.sub.D747H----TYS-S--NS..........T.-N------------ - HIV-1.sub.D760E-G-VNAT-I-NNGE...NNPTNIT--R------P--A-- - HIV-1.sub.EliSD-...ELRNNGTMGNNVTTEEK....GM------V-- - HIV-1.sub.MalVNGTA-NGT-AGSNRTNAELKMEIG-V------I-P - SIVcpzQ-SK-NFSQA.......KNLTNQTSSPPL-M------V-- - HIV-1.sub.Bru SI-GKV--EY-F-----II-I-NDTT-.....-T-TS----V----------E------- - HIV-1.sub.SF2 SI--KI--EN---RN-----I-NASTTTNYTN----H--R-V----------E------- - HIV-1.sub.D757 ELRDQKQKVAALFYKLDVVPLDGNDNSS....YRLINCNTSAITQACPKVSFDPIPIHYC - HIV-1.sub.D747K----Q-----------NTT----....---------------------------- - HIV-1.sub.D760I--RQ---Y----R--I----N-N--T....------------------T--------- - HIV-1.sub.Eli V-K-K--Q-Y----R--I--I-NDSSTNS.TN--------------------E------- - HIV-1.sub.Mal VGS-KR-E.Y-T--N--L-QI-D...-DN.SS---------V--------T--------- - SIVcpzK-KQ-YS---VE---N-GNEN-T.....--I-----T--------T--E------- - HIV-1.sub.BruF----------------T----VQ-----R---------------E-VV---A-FT - HIV-1.sub.SF2 T----F------------K---T----VQ-----R-I-------------E-VV---D-FT - HIV-1.sub.D757 APAGYAILKCNNKTFNGTGPCHNVSTRTCTHGIKPVVSTQLLLNGSLAEGEIIIRSENLA - HIV-1.sub.D747G---------------------I--VQ-------------------------------T - HIV-1.sub.D760VQ-----S-------------------------T - HIV-1.sub.EliF-----RD-K-------T----VQ-----R---------------E-V-------T - HIV-1.sub.MalF------D-K----EI-K----VQ---------------------E--M------T - SIVcpzF------D-D-S-K-K-T----VH---------T----I-------N-TV-V--KS - HIV-1.sub.Bru D-A-----Q-----E-N--------------QR---RA-VTI-K-.-NM--------RA- - HIV-1.sub.SF2A-----Q--E--A-N------------Y-..---RA-HT--R------K------RAQ - HIV-1.sub.D757 NNVKTIIVHLNQSVRIVCTRPNNNTRKSIRI..GPGQTFYATGDIIGDIRQAHCNISEGK - HIV-1.sub.D747E--Y---------GV--..---Q--------------------KH- - HIV-1.sub.D760 D-------------EV---------------..---Q---------------------D- - HIV-1.sub.EliA-N--A---E--K-T-A--YQ---QRTP-..-L--SL-T-R.SRSI-G-------RAQ - HIV-1.sub.Mal D-T-N---Q--ET-T-N----G----RG-HF..----AL-T--.-V----R-Y-T-N-TE - SIVcpz K-TDVW--Q-VEA-SLN-H--G----GEVQ-..---M---NIENVV--T-S-Y-K-NGTT - HIV-1.sub.BruA--KQIAS--R-Q-G-N--.-I-KQ----DP--V------G-------STQ-----WF - HIV-1.sub.SF2N--EQIV---R-Q-G-N--.-V-NQ----DP--VM--------------TQLF..... - HIV-1.sub.D757 WNETLQRVGKKLAEYFPN.KT.IKFASSSGGGLEITTHSFNCRGEFFYCNTSNLFNSTY. - HIV-1.sub.D747H---.--.-R-------D--------------------D---G--. - HIV-1.sub.D760H---.--.----A----D-----Y--------------G---G--. - HIV-1.sub.EliSK---Q-AR--GTLL.-KTI.---KP----DP---------G---------G-----WN - HIV-1.sub.MalDK---Q-AV--GSLL.-KTK.-I-N-----DP-------------------K-----WQ - SIVcpzR-VEE-K-A--TSSNRTAAN-TLNRA---DP-V-H-M---G---------QI-..... - HIV-1.sub.Bru NSTWSTEGSNNTEGSD---LP-----F--------K-------S-Q-R-S--------T- - HIV-1.sub.SF2 NNTWRLNHTEGTKG-D--ILP--------------K-------G-Q-S-S--------T- - HIV-1.sub.D757 .....MPNGTKGNSNSTITIQCRIKQIINMWQEVGRAMYAPPIEGNITCESNITGLLLVR - HIV-1.sub.D747 .....------S--S-----P----------------------A-----K-----I---- - HIV-1.sub.D760 .....------S-L------P------V-L------------FAR----K---------- - HIV-1.sub.Eli ISAWNNITESNNST-TN--L--------K-.VAGRK-I------R--L-S--------T- - HIV-1.sub.Mal NNG.ARLSNSTESTG-.--LP-----------KT-K-------A-V-N-L------I-T- - SIVcpz .........-DNIT-GI-ILP---R--VSS-MR---GI-----R-----N--------TS - HIV-1.sub.BruNN.--G.S-I---------D------------K-E-------K------....Q--- - HIV-1.sub.SF2NVT-D.T-V---------D-----------IK-E---I---K------....Q--- - HIV-1.sub.D757 DGGTESNNT..ETFRPGGG-MRNNWRSELYKYKVVEIKPLGVAPTTAKRRVV....EREK - HIV-1.sub.D747IEL-D-KT--------E--D-----------------------------....---- - HIV-1.sub.D760EDT-D..T-I-S-------D-----------------------------....---- - HIV-1.sub.Eli..I--STN-----------D------------Q-E-------R------....---- - HIV-1.sub.MalNS-D-SDN--L--------D--I---------R-E-------K------....---- - SIVcpzTPVTN-SGNL.----T--N-KDI-----------R-E--S----K-R-HT-ARQKD-Q- - HIV-1.sub.Bru.---L--------------R-------------------N--------------- - HIV-1.sub.SF2V--M--------------V-L-----------------N---------------- - HIV-1.sub.D757 RAVGI.GAVFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQSNLLRAIEAQQHLLQLT - HIV-1.sub.D747.---------------------V-------------------------------- - HIV-1.sub.D760L.-------------------I---------------------------------- - HIV-1.sub.EliI-L.--M--------------R-V---------M-------N---------------- - HIV-1.sub.MalI-L.--M----------------L-----------------N---------------- - SIVcpzAFGL--L---------------AV-----------------N---K-----------S - HIV-1.sub.BruA-I--V--------------C--------A----A---.-K-LEQ------- - HIV-1.sub.SF2A----V----R---------C--------A----A---.-K-LED------- - HIV-1.sub.D757 VWGIKQLQTRVLAIERYLKDQQLLGIWGRSGKLICTTNVPWNSSWS.NRSQTDIWDNMTW - HIV-1.sub.D747 I-------A----------E--------C--------T--------.------------- - HIV-1.sub.D760M--C--------A--------.------------- - HIV-1.sub.EliA-I--V--------------C---H-------------.---LNE--Q---- - HIV-1.sub.MalA----V----Q--R---M--C---H----F--------.---LD---N---- - SIVcpz I--V----A-L--V----Q---I--L--C---AV-Y-T-------PGSN-TD---G-L-- - HIV-1.sub.BruE---........................................--N---SL-HS-I-E - HIV-1.sub.SF2E-........................................--D---N---T---E - HIV-1.sub.D757 MQWDR........................................EISNYTDTIYRLLED - HIV-1.sub.D747........................................------E-------- - HIV-1.sub.D760........................................------N-------- - HIV-1.sub.EliE-E-........................................--D---GL--S-I-E - HIV-1.sub.MalEK........................................------GI--N-I-E - SIVcpz Q---KLVSNYTGKIFGLLEEAQSQQEKNERDLLELDQWASLWNWFD-T---GK-FG---E - HIV-1.sub.BruK--QE--E--K-AS-----N------------------V--R-V---------- - HIV-1.sub.SF2K--QE--E--K-AS------------------------V--R-V---------- - HIV-1.sub.D757 SQNQQERNEKDLLALDSWKNLWNWFSITNWLWYIKIFIMIVGGLIGLKIIFAVLSIVNRV - HIV-1.sub.D747I--------R------C----- - HIV-1.sub.D760R------------ - HIV-1.sub.EliT---K---E--E--K-AS--------Q-----------I------R-V-----L---- - HIV-1.sub.MalI---K---E--E--K-AS-------SK-----R---IV-------R-------L---- - SIVcpz A-S---K--R---E--Q-AS-----D--K--------L-A---I---R--MT-F-V-R-- - HIV-1.sub.Bru - HIV-1.sub.SF2 - HIV-1.sub.D757 RQGYSPLSFQT - HIV-1.sub.D747 KA--------- - HIV-1.sub.D760 - HIV-1.sub.Eli - HIV-1.sub.MalL-- - SIVcpzL--__________________________________________________________________________ ##STR1##
__________________________________________________________________________# SEQUENCE LISTING - - - - (1) GENERAL INFORMATION: - - (iii) NUMBER OF SEQUENCES: 10 - - - - (2) INFORMATION FOR SEQ ID NO:1: - - (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 1932 base - #pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: unknown (D) TOPOLOGY: unknown - - (ii) MOLECULE TYPE: (genomic) - - (vi) ORIGINAL SOURCE: (A) ORGANISM: HIV-1D757 - - (ix) FEATURE: (A) NAME/KEY: CDS (B) LOCATION: 2..1789 - - (xi) SEQUENCE DESCRIPTION: SEQ ID NO: - #1: - - C AGT TTA TGG GAT CAA AGC CTA AAG CCA TGT - #GTA AAG TTG ACC CCA 46 Ser Leu Trp Asp Gln Ser Leu Lys Pro C - #ys Val Lys Leu Thr Pro 1 - # 5 - # 10 - # 15 - - CTC TGT GTC ACT TTA AAT TGT ACA AAT GCA AA - #T GTT ACC TAT GAT AAT 94 Leu Cys Val Thr Leu Asn Cys Thr Asn Ala As - #n Val Thr Tyr Asp Asn 20 - # 25 - # 30 - - GGT AAC TAC ACT GAA GAA ATA AAA AAT TGC TC - #T TTC AAT ACA ACT ACA 142 Gly Asn Tyr Thr Glu Glu Ile Lys Asn Cys Se - #r Phe Asn Thr Thr Thr 35 - # 40 - # 45 - - GAA CTA AGA GAT CAG AAA CAG AAA GTT GCT GC - #A CTT TTT TAT AAA CTT 190 Glu Leu Arg Asp Gln Lys Gln Lys Val Ala Al - #a Leu Phe Tyr Lys Leu 50 - # 55 - # 60 - - GAT GTA GTA CCA CTT GAT GGT AAT GAT AAC TC - #T AGT TAT AGA TTA ATA 238 Asp Val Val Pro Leu Asp Gly Asn Asp Asn Se - #r Ser Tyr Arg Leu Ile 65 - # 70 - # 75 - - AAT TGT AAT ACC TCA GCC ATA ACA CAA GCC TG - #T CCA AAG GTC TCT TTT 286 Asn Cys Asn Thr Ser Ala Ile Thr Gln Ala Cy - #s Pro Lys Val Ser Phe 80 - # 85 - # 90 - # 95 - - GAC CCA ATC CCT ATA CAT TAT TGT GCT CCA GC - #T GGT TAT GCG ATT CTA 334 Asp Pro Ile Pro Ile His Tyr Cys Ala Pro Al - #a Gly Tyr Ala Ile Leu 100 - # 105 - # 110 - - AAG TGT AAT AAT AAG ACA TTC AAT GGG ACA GG - #A CCA TGC CAT AAT GTC 382 Lys Cys Asn Asn Lys Thr Phe Asn Gly Thr Gl - #y Pro Cys His Asn Val 115 - # 120 - # 125 - - AGC ACA CGT ACA TGT ACA CAT GGA ATT AAG CC - #A GTA GTA TCA ACT CAA 430 Ser Thr Arg Thr Cys Thr His Gly Ile Lys Pr - #o Val Val Ser Thr Gln 130 - # 135 - # 140 - - CTA CTG TTA AAT GGT AGC CTA GCA GAA GGA GA - #G ATA ATA ATT AGA TCT 478 Leu Leu Leu Asn Gly Ser Leu Ala Glu Gly Gl - #u Ile Ile Ile Arg Ser 145 - # 150 - # 155 - - GAA AAT CTG GCA AAC AAT GTC AAA ACA ATA AT - #A GTA CAT CTT AAT CAA 526 Glu Asn Leu Ala Asn Asn Val Lys Thr Ile Il - #e Val His Leu Asn Gln 160 1 - #65 1 - #70 1 -#75 - - TCT GTA AGA ATT GTG TGT ACA AGA CCC AAC AA - #T AAT ACA AGA AAAAGT 574 Ser Val Arg Ile Val Cys Thr Arg Pro Asn As - #n Asn Thr Arg Lys Ser 180 - # 185 - # 190 - - ATA AGG ATA GGA CCA GGA CAA ACA TTC TAT GC - #A ACA GGA GAC ATA ATA 622 Ile Arg Ile Gly Pro Gly Gln Thr Phe Tyr Al - #a Thr Gly Asp Ile Ile 195 - # 200 - # 205 - - GGA GAC ATA AGA CAA GCA CAT TGT AAC ATT AG - #T GAA GGT AAA TGG AAT 670 Gly Asp Ile Arg Gln Ala His Cys Asn Ile Se - #r Glu Gly Lys Trp Asn 210 - # 215 - # 220 - - GAA ACT TTA CAA AGG GTA GGT AAA AAA TTA GC - #A GAA TAC TTC CCT AAT 718 Glu Thr Leu Gln Arg Val Gly Lys Lys Leu Al - #a Glu Tyr Phe Pro Asn 225 - # 230 - # 235 - - AAA ACA ATA AAA TTT GCA TCA TCC TCA GGA GG - #G GGC CTA GAA ATT ACA 766 Lys Thr Ile Lys Phe Ala Ser Ser Ser Gly Gl - #y Gly Leu Glu Ile Thr 240 2 - #45 2 - #50 2 -#55 - - ACA CAT AGC TTT AAT TGT AGA GGA GAA TTT TT - #C TAT TGC AAT ACATCA 814 Thr His Ser Phe Asn Cys Arg Gly Glu Phe Ph - #e Tyr Cys Asn Thr Ser 260 - # 265 - # 270 - - AAC CTG TTT AAT AGT ACA TAC ATG CCT AAT GG - #T ACA AAA GGT AAT TCA 862 Asn Leu Phe Asn Ser Thr Tyr Met Pro Asn Gl - #y Thr Lys Gly Asn Ser 275 - # 280 - # 285 - - AAC TCA ACC ATC ACA ATC CAA TGC AGA ATA AA - #A CAA ATT ATA AAC ATG 910 Asn Ser Thr Ile Thr Ile Gln Cys Arg Ile Ly - #s Gln Ile Ile Asn Met 290 - # 295 - # 300 - - TGG CAG GAG GTA GGA CGA GCA ATG TAT GCC CC - #T CCC ATT GAA GGA AAC 958 Trp Gln Glu Val Gly Arg Ala Met Tyr Ala Pr - #o Pro Ile Glu Gly Asn 305 - # 310 - # 315 - - ATA ACG TGT GAA TCC AAT ATC ACA GGA CTA CT - #A TTG GTA CGT GAT GGA 1006 Ile Thr Cys Glu Ser Asn Ile Thr Gly Leu Le - #u Leu Val Arg Asp Gly 320 3 - #25 3 - #30 3 -#35 - - GGA ACA GAG TCA AAT AAT ACA GAG ACA TTC AG - #A CCT GGA GGA GGAGAT 1054 Gly Thr Glu Ser Asn Asn Thr Glu Thr Phe Ar - #g Pro Gly Gly Gly Asp 340 - # 345 - # 350 - - ATG AGG AAC AAT TGG AGA AGT GAA TTA TAT AA - #A TAT AAA GTG GTA GAA 1102 Met Arg Asn Asn Trp Arg Ser Glu Leu Tyr Ly - #s Tyr Lys Val Val Glu 355 - # 360 - # 365 - - ATT AAG CCA TTG GGA GTA GCG CCC ACT ACT GC - #A AAA AGG AGA GTG GTG 1150 Ile Lys Pro Leu Gly Val Ala Pro Thr Thr Al - #a Lys Arg Arg Val Val 370 - # 375 - # 380 - - GAG AGA GAA AAA AGA GCA GTG GGA ATA GGA GC - #T GTG TTC CTT GGG TTC 1198 Glu Arg Glu Lys Arg Ala Val Gly Ile Gly Al - #a Val Phe Leu Gly Phe 385 - # 390 - # 395 - - TTG GGA GCA GCA GGA AGC ACT ATG GGC GCG GC - #A TCA ATG ACG CTG ACG 1246 Leu Gly Ala Ala Gly Ser Thr Met Gly Ala Al - #a Ser Met Thr Leu Thr 400 4 - #05 4 - #10 4 -#15 - - GTA CAG GCC AGA CAA TTG TTG TCT GGT ATA GT - #G CAA CAG CAA AGCAAT 1294 Val Gln Ala Arg Gln Leu Leu Ser Gly Ile Va - #l Gln Gln Gln Ser Asn 420 - # 425 - # 430 - - TTG CTG AGG GCT ATA GAG GCG CAA CAG CAT CT - #G TTG CAA CTC ACG GTC 1342 Leu Leu Arg Ala Ile Glu Ala Gln Gln His Le - #u Leu Gln Leu Thr Val 435 - # 440 - # 445 - - TGG GGC ATT AAG CAG CTC CAG ACA AGA GTC CT - #G GCT ATA GAA AGA TAC 1390 Trp Gly Ile Lys Gln Leu Gln Thr Arg Val Le - #u Ala Ile Glu Arg Tyr 450 - # 455 - # 460 - - CTA AAG GAT CAA CAG CTC CTA GGG ATT TGG GG - #C CGC TCT GGA AAA CTC 1438 Leu Lys Asp Gln Gln Leu Leu Gly Ile Trp Gl - #y Arg Ser Gly Lys Leu 465 - # 470 - # 475 - - ATC TGC ACC ACT AAT GTA CCT TGG AAC TCC AG - #C TGG AGT AAC AGA TCT 1486 Ile Cys Thr Thr Asn Val Pro Trp Asn Ser Se - #r Trp Ser Asn Arg Ser 480 4 - #85 4 - #90 4 -#95 - - CAA ACA GAT ATT TGG GAT AAC ATG ACC TGG AT - #G CAG TGG GAT AGAGAA 1534 Gln Thr Asp Ile Trp Asp Asn Met Thr Trp Me - #t Gln Trp Asp Arg Glu 500 - # 505 - # 510 - - ATT AGT AAT TAC ACA GAC ACA ATA TAC AGG TT - #G CTT GAA GAC TCG CAA 1582 Ile Ser Asn Tyr Thr Asp Thr Ile Tyr Arg Le - #u Leu Glu Asp Ser Gln 515 - # 520 - # 525 - - AAC CAG CAG GAA AGA AAT GAA AAA GAT TTA TT - #A GCA TTG GAC AGT TGG 1630 Asn Gln Gln Glu Arg Asn Glu Lys Asp Leu Le - #u Ala Leu Asp Ser Trp 530 - # 535 - # 540 - - AAA AAT CTG TGG AAT TGG TTT AGC ATA ACA AA - #T TGG CTG TGG TAT ATA 1678 Lys Asn Leu Trp Asn Trp Phe Ser Ile Thr As - #n Trp Leu Trp Tyr Ile 545 - # 550 - # 555 - - AAA ATA TTC ATA ATG ATA GTA GGA GGC TTG AT - #A GGT TTG AAA ATA ATT 1726 Lys Ile Phe Ile Met Ile Val Gly Gly Leu Il - #e Gly Leu Lys Ile Ile 560 5 - #65 5 - #70 5 -#75 - - TTT GCT GTG CTC TCT ATA GTG AAT AGA GTT AG - #G CAG GGA TAC TCACCT 1774 Phe Ala Val Leu Ser Ile Val Asn Arg Val Ar - #g Gln Gly Tyr Ser Pro 580 - # 585 - # 590 - - TTA TCG TTT CAG ACC CTTACCCCGA ACCCAGGGGG ACCCGACAG - #G CTCGAAAGAA 1829 Leu Ser Phe Gln Thr 595 - - TCGAAGGAGG AGGTGGAGAG CAAGACAAAG ACAGATCCAT TCGCTTAGTG AA -#CGGATTCT 1889 - - TAGCACTTGC CTGGGACGAC TGCGGAGCCT GTGCCTCTTC AGC - # 193 - #2 - - - - (2) INFORMATION FOR SEQ ID NO: 2: - - (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 596 amino - #acids (B) TYPE: amino acid (D) TOPOLOGY: linear - - (ii) MOLECULE TYPE: protein - - (xi) SEQUENCE DESCRIPTION: SEQ ID NO: - #2: - - Ser Leu Trp Asp Gln Ser Leu Lys Pro Cys Va - #l Lys Leu Thr Pro Leu 1 5 - # 10 - # 15 - - Cys Val Thr Leu Asn Cys Thr Asn Ala Asn Va - #l Thr Tyr Asp Asn Gly 20 - # 25 - # 30 - - Asn Tyr Thr Glu Glu Ile Lys Asn Cys Ser Ph - #e Asn Thr Thr Thr Glu 35 - # 40 - # 45 - - Leu Arg Asp Gln Lys Gln Lys Val Ala Ala Le - #u Phe Tyr Lys Leu Asp 50 - # 55 - # 60 - - Val Val Pro Leu Asp Gly Asn Asp Asn Ser Se - #r Tyr Arg Leu Ile Asn 65 - # 70 - # 75 - # 80 - - Cys Asn Thr Ser Ala Ile Thr Gln Ala Cys Pr - #o Lys Val Ser Phe Asp 85 - # 90 - # 95 - - Pro Ile Pro Ile His Tyr Cys Ala Pro Ala Gl - #y Tyr Ala Ile Leu Lys 100 - # 105 - # 110 - - Cys Asn Asn Lys Thr Phe Asn Gly Thr Gly Pr - #o Cys His Asn Val Ser 115 - # 120 - # 125 - - Thr Arg Thr Cys Thr His Gly Ile Lys Pro Va - #l Val Ser Thr Gln Leu 130 - # 135 - # 140 - - Leu Leu Asn Gly Ser Leu Ala Glu Gly Glu Il - #e Ile Ile Arg Ser Glu 145 1 - #50 1 - #55 1 -#60 - - Asn Leu Ala Asn Asn Val Lys Thr Ile Ile Va - #l His Leu Asn GlnSer 165 - # 170 - # 175 - - Val Arg Ile Val Cys Thr Arg Pro Asn Asn As - #n Thr Arg Lys Ser Ile 180 - # 185 - # 190 - - Arg Ile Gly Pro Gly Gln Thr Phe Tyr Ala Th - #r Gly Asp Ile Ile Gly 195 - # 200 - # 205 - - Asp Ile Arg Gln Ala His Cys Asn Ile Ser Gl - #u Gly Lys Trp Asn Glu 210 - # 215 - # 220 - - Thr Leu Gln Arg Val Gly Lys Lys Leu Ala Gl - #u Tyr Phe Pro Asn Lys 225 2 - #30 2 - #35 2 -#40 - - Thr Ile Lys Phe Ala Ser Ser Ser Gly Gly Gl - #y Leu Glu Ile ThrThr 245 - # 250 - # 255 - - His Ser Phe Asn Cys Arg Gly Glu Phe Phe Ty - #r Cys Asn Thr Ser Asn 260 - # 265 - # 270 - - Leu Phe Asn Ser Thr Tyr Met Pro Asn Gly Th - #r Lys Gly Asn Ser Asn 275 - # 280 - # 285 - - Ser Thr Ile Thr Ile Gln Cys Arg Ile Lys Gl - #n Ile Ile Asn Met Trp 290 - # 295 - # 300 - - Gln Glu Val Gly Arg Ala Met Tyr Ala Pro Pr - #o Ile Glu Gly Asn Ile 305 3 - #10 3 - #15 3 -#20 - - Thr Cys Glu Ser Asn Ile Thr Gly Leu Leu Le - #u Val Arg Asp GlyGly 325 - # 330 - # 335 - - Thr Glu Ser Asn Asn Thr Glu Thr Phe Arg Pr - #o Gly Gly Gly Asp Met 340 - # 345 - # 350 - - Arg Asn Asn Trp Arg Ser Glu Leu Tyr Lys Ty - #r Lys Val Val Glu Ile 355 - # 360 - # 365 - - Lys Pro Leu Gly Val Ala Pro Thr Thr Ala Ly - #s Arg Arg Val Val Glu 370 - # 375 - # 380 - - Arg Glu Lys Arg Ala Val Gly Ile Gly Ala Va - #l Phe Leu Gly Phe Leu 385 3 - #90 3 - #95 4 -#00 - - Gly Ala Ala Gly Ser Thr Met Gly Ala Ala Se - #r Met Thr Leu ThrVal 405 - # 410 - # 415 - - Gln Ala Arg Gln Leu Leu Ser Gly Ile Val Gl - #n Gln Gln Ser Asn Leu 420 - # 425 - # 430 - - Leu Arg Ala Ile Glu Ala Gln Gln His Leu Le - #u Gln Leu Thr Val Trp 435 - # 440 - # 445 - - Gly Ile Lys Gln Leu Gln Thr Arg Val Leu Al - #a Ile Glu Arg Tyr Leu 450 - # 455 - # 460 - - Lys Asp Gln Gln Leu Leu Gly Ile Trp Gly Ar - #g Ser Gly Lys Leu Ile 465 4 - #70 4 - #75 4 -#80 - - Cys Thr Thr Asn Val Pro Trp Asn Ser Ser Tr - #p Ser Asn Arg SerGln 485 - # 490 - # 495 - - Thr Asp Ile Trp Asp Asn Met Thr Trp Met Gl - #n Trp Asp Arg Glu Ile 500 - # 505 - # 510 - - Ser Asn Tyr Thr Asp Thr Ile Tyr Arg Leu Le - #u Glu Asp Ser Gln Asn 515 - # 520 - # 525 - - Gln Gln Glu Arg Asn Glu Lys Asp Leu Leu Al - #a Leu Asp Ser Trp Lys 530 - # 535 - # 540 - - Asn Leu Trp Asn Trp Phe Ser Ile Thr Asn Tr - #p Leu Trp Tyr Ile Lys 545 5 - #50 5 - #55 5 -#60 - - Ile Phe Ile Met Ile Val Gly Gly Leu Ile Gl - #y Leu Lys Ile IlePhe 565 - # 570 - # 575 - - Ala Val Leu Ser Ile Val Asn Arg Val Arg Gl - #n Gly Tyr Ser Pro Leu 580 - # 585 - # 590 - - Ser Phe Gln Thr 595 - - - - (2) INFORMATION FOR SEQ ID NO: 3: - - (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 1944 base - #pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: unknown (D) TOPOLOGY: unknown - - (ii) MOLECULE TYPE: DNA (genomic) - - (vi) ORIGINAL SOURCE: (A) ORGANISM: HIV-1D747 - - (ix) FEATURE: (A) NAME/KEY: CDS (B) LOCATION: 131..1930 - - (xi) SEQUENCE DESCRIPTION: SEQ ID NO: - #3: - - TAATGTCTGG GCAACACATG CCTGTGTACC CACAGACCCC AACCCACAAG AG -#ATGGTTTT 60 - - GGGAAATGTA ACAGAAAATT TTAACATGTG GAGAAATGAC ATGGTGAATC AG -#ATGCATGA 120 - - GGATGTAATC AGT TTA TGG GAT CAA AGC CTA AAG CC - #A TGT GTA AAG TTG 169 Ser Leu Trp Asp - #Gln Ser Leu Lys Pro Cys Val Lys Leu 1 - # 5 - # 10 - - ACC CCA CTC TGT GTC ACT TTA CAT TGT ACA AA - #T GCT ACC TAT AGT AAT 217 Thr Pro Leu Cys Val Thr Leu His Cys Thr As - #n Ala Thr Tyr Ser Asn 15 - # 20 - # 25 - - AGT ACC TAC AAT AGT ACC TAC AAT GAA GAA AT - #A AAA AAT TGC TCT TTC 265 Ser Thr Tyr Asn Ser Thr Tyr Asn Glu Glu Il - #e Lys Asn Cys Ser Phe 30 - # 35 - # 40 - # 45 - - AAT ACA ACT ACG GAA CTA AGA GAT AAG AAA CA - #G AAA GTA CAA GCA CTT 313 Asn Thr Thr Thr Glu Leu Arg Asp Lys Lys Gl - #n Lys Val Gln Ala Leu 50 - # 55 - # 60 - - TTT TAT AAA CTT GAT GTA GTA CCA CTT AAT AC - #T ACT GAT AAC TCT AGT 361 Phe Tyr Lys Leu Asp Val Val Pro Leu Asn Th - #r Thr Asp Asn Ser Ser 65 - # 70 - # 75 - - TAT AGA TTA ATA AAT TGT AAT ACC TCA GCC AT - #A ACA CAA GCC TGT CCA 409 Tyr Arg Leu Ile Asn Cys Asn Thr Ser Ala Il - #e Thr Gln Ala Cys Pro 80 - # 85 - # 90 - - AAG GTC TCA TTT GAC CCA ATT CCT ATA CAT TA - #T TGT GCT GGA GCT GGT 457 Lys Val Ser Phe Asp Pro Ile Pro Ile His Ty - #r Cys Ala Gly Ala Gly 95 - # 100 - # 105 - - TAT GCG ATT CTA AAG TGT AAT AAT AAG ACA TT - #C AAT GGG ACA GGA CCA 505 Tyr Ala Ile Leu Lys Cys Asn Asn Lys Thr Ph - #e Asn Gly Thr Gly Pro 110 1 - #15 1 - #20 1 -#25 - - TGC CAT AAT ATC AGC ACA GTA CAA TGT ACA CA - #T GGA ATT AAG CCAGTA 553 Cys His Asn Ile Ser Thr Val Gln Cys Thr Hi - #s Gly Ile Lys Pro Val 130 - # 135 - # 140 - - GTA TCA ACT CAA CTA CTG TTA AAT GGT AGC CT - #A GCA GAA GGA GAG ATA 601 Val Ser Thr Gln Leu Leu Leu Asn Gly Ser Le - #u Ala Glu Gly Glu Ile 145 - # 150 - # 155 - - ATA ATT AGA TCT GAA AAT CTG ACA AAC AAT GT - #C AAA ACA ATA ATA GTA 649 Ile Ile Arg Ser Glu Asn Leu Thr Asn Asn Va - #l Lys Thr Ile Ile Val 160 - # 165 - # 170 - - CAT CTT AAT CAA TCT GTA GAA ATT GTG TAT AC - #A AGA CCC AAC AAT AAT 697 His Leu Asn Gln Ser Val Glu Ile Val Tyr Th - #r Arg Pro Asn Asn Asn 175 - # 180 - # 185 - - ACA AGG AAA GGT GTA AGG ATA GGA CCA GGA CA - #A ACA TTC TAT GCA ACA 745 Thr Arg Lys Gly Val Arg Ile Gly Pro Gly Gl - #n Thr Phe Tyr Ala Thr 190 1 - #95 2 - #00 2 -#05 - - GGA GAC ATA ATA GGA GAC ATA AGA CAA GCA CA - #T TGT AAC ATT AGTAAA 793 Gly Asp Ile Ile Gly Asp Ile Arg Gln Ala Hi - #s Cys Asn Ile Ser Lys 210 - # 215 - # 220 - - CAT AAA TGG AAT GAA ACT TTA CAA AGG GTA GG - #T AAA AAA TTA GCA GAA 841 His Lys Trp Asn Glu Thr Leu Gln Arg Val Gl - #y Lys Lys Leu Ala Glu 225 - # 230 - # 235 - - CAC TTC CCT AAT AAA ACA ATA AGA TTT GCA TC - #A TCC TCA GGA GGG GAC 889 His Phe Pro Asn Lys Thr Ile Arg Phe Ala Se - #r Ser Ser Gly Gly Asp 240 - # 245 - # 250 - - CTA GAA ATT ACA ACA CAT AGC TTT AAT TGT AG - #A GGA GAA TTT TTC TAT 937 Leu Glu Ile Thr Thr His Ser Phe Asn Cys Ar - #g Gly Glu Phe Phe Tyr 255 - # 260 - # 265 - - TGC AAT ACA TCA GAC CTG TTT AAT GGT ACA TA - #C ATG CCT AAT GGT ACA 985 Cys Asn Thr Ser Asp Leu Phe Asn Gly Thr Ty - #r Met Pro Asn Gly Thr 270 2 - #75 2 - #80 2 -#85 - - AAA AGT AAT TCA AGC TCA ACC ATC ACA ATT CC - #A TGC AGA ATA AAACAA 1033 Lys Ser Asn Ser Ser Ser Thr Ile Thr Ile Pr - #o Cys Arg Ile Lys Gln 290 - # 295 - # 300 - - ATT ATA AAC ATG TGG CAG GAG GTA GGA CGA GC - #A ATG TAT GCC CCT CCC 1081 Ile Ile Asn Met Trp Gln Glu Val Gly Arg Al - #a Met Tyr Ala Pro Pro 305 - # 310 - # 315 - - ATT GCA GGA AAC ATA ACG TGT AAA TCC AAT AT - #T ACA GGA ATA CTA TTG 1129 Ile Ala Gly Asn Ile Thr Cys Lys Ser Asn Il - #e Thr Gly Ile Leu Leu 320 - # 325 - # 330 - - GTA CGT GAT GGA GGA ATA GAG CTA AAT GAT AC - #A AAG ACA GAG ACA TTC 1177 Val Arg Asp Gly Gly Ile Glu Leu Asn Asp Th - #r Lys Thr Glu Thr Phe 335 - # 340 - # 345 - - AGA CCG GGA GGA GGA GAA ATG AGG GAC AAT TG - #G AGA AGT GAA TTA TAT 1225 Arg Pro Gly Gly Gly Glu Met Arg Asp Asn Tr - #p Arg Ser Glu Leu Tyr 350 3 - #55 3 - #60 3 -#65 - - AAA TAT AAA GTG GTA GAA ATT AAG CCA TTG GG - #A GTA GCG CCC ACTACT 1273 Lys Tyr Lys Val Val Glu Ile Lys Pro Leu Gl - #y Val Ala Pro Thr Thr 370 - # 375 - # 380 - - GCA AAA AGG AGA GTG GTG GAG AGA GAA AAA AG - #A GCA GTG GGA ATA GGA 1321 Ala Lys Arg Arg Val Val Glu Arg Glu Lys Ar - #g Ala Val Gly Ile Gly 385 - # 390 - # 395 - - GCT GTA TTC CTT GGG TTC TTG GGA GCA GCA GG - #A AGC ACT ATG GGC GCG 1369 Ala Val Phe Leu Gly Phe Leu Gly Ala Ala Gl - #y Ser Thr Met Gly Ala 400 - # 405 - # 410 - - GCG TCA ATG ACC GTG ACG GTA CAG GCC AGA CA - #A TTG TTG TCT GGT ATA 1417 Ala Ser Met Thr Val Thr Val Gln Ala Arg Gl - #n Leu Leu Ser Gly Ile 415 - # 420 - # 425 - - GTG CAA CAG CAA AGC AAT TTG CTG AGG GCT AT - #A GAG GCG CAA CAG CAT 1465 Val Gln Gln Gln Ser Asn Leu Leu Arg Ala Il - #e Glu Ala Gln Gln His 430 4 - #35 4 - #40 4 -#45 - - CTG TTG CAA CTC ACG ATC TGG GGG ATT AAG CA - #G CTC CAG GCA AGAGTC 1513 Leu Leu Gln Leu Thr Ile Trp Gly Ile Lys Gl - #n Leu Gln Ala Arg Val 450 - # 455 - # 460 - - CTG GCT ATA GAA AGA TAC CTA AAG GAA CAA CA - #G CTC CTA GGG ATT TGG 1561 Leu Ala Ile Glu Arg Tyr Leu Lys Glu Gln Gl - #n Leu Leu Gly Ile Trp 465 - # 470 - # 475 - - GGC TGC TCT GGA AAA CTC ATC TGC ACC ACT AC - #T GTA CCT TGG AAC TCC 1609 Gly Cys Ser Gly Lys Leu Ile Cys Thr Thr Th - #r Val Pro Trp Asn Ser 480 - # 485 - # 490 - - AGT TGG AGT AAC AGA TCT CAA ACA GAT ATT TG - #G GAT AAC ATG ACC TGG 1657 Ser Trp Ser Asn Arg Ser Gln Thr Asp Ile Tr - #p Asp Asn Met Thr Trp 495 - # 500 - # 505 - - ATG CAG TGG GAT AGA GAA ATT AGT AAT TAC AC - #A GAA ACA ATA TAC AGG 1705 Met Gln Trp Asp Arg Glu Ile Ser Asn Tyr Th - #r Glu Thr Ile Tyr Arg 510 5 - #15 5 - #20 5 -#25 - - TTG CTT GAA GAC TCG CAA AAC CAG CAG GAA AG - #A AAT GAA AAA GATTTA 1753 Leu Leu Glu Asp Ser Gln Asn Gln Gln Glu Ar - #g Asn Glu Lys Asp Leu 530 - # 535 - # 540 - - TTA GCA TTG GAC AGT TGG AAA AAT CTG TGG AA - #T TGG TTT AGC ATA ACA 1801 Leu Ala Leu Asp Ser Trp Lys Asn Leu Trp As - #n Trp Phe Ser Ile Thr 545 - # 550 - # 555 - - AAT TGG CTA TGG TAT ATA AAA ATA TTC ATA AT - #A ATA GTA GGA GGC TTG 1849 Asn Trp Leu Trp Tyr Ile Lys Ile Phe Ile Il - #e Ile Val Gly Gly Leu 560 - # 565 - # 570 - - ATA GGC TTG AGA ATA ATT TTT GCT GTG CTT TG - #T ATA GTA AAT AGA GTT 1897 Ile Gly Leu Arg Ile Ile Phe Ala Val Leu Cy - #s Ile Val Asn Arg Val 575 - # 580 - # 585 - - AAG GCA GGA TAC TCA CCT TTG TCG TTT CAG AC - #C CTTACCCCGA ACCC 1944 Lys Ala Gly Tyr Ser Pro Leu Ser Phe Gln Th - #r 590 5 - #95 6 - #00 - - - - (2) INFORMATION FOR SEQ ID NO: 4: - - (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 600 amino - #acids (B) TYPE: amino acid (D) TOPOLOGY: linear - - (ii) MOLECULE TYPE: protein - - (xi) SEQUENCE DESCRIPTION: SEQ ID NO: - #4: - - Ser Leu Trp Asp Gln Ser Leu Lys Pro Cys Va - #l Lys Leu Thr Pro Leu 1 5 - # 10 - # 15 - - Cys Val Thr Leu His Cys Thr Asn Ala Thr Ty - #r Ser Asn Ser Thr Tyr 20 - # 25 - # 30 - - Asn Ser Thr Tyr Asn Glu Glu Ile Lys Asn Cy - #s Ser Phe Asn Thr Thr 35 - # 40 - # 45 - - Thr Glu Leu Arg Asp Lys Lys Gln Lys Val Gl - #n Ala Leu Phe Tyr Lys 50 - # 55 - # 60 - - Leu Asp Val Val Pro Leu Asn Thr Thr Asp As - #n Ser Ser Tyr Arg Leu 65 - # 70 - # 75 - # 80 - - Ile Asn Cys Asn Thr Ser Ala Ile Thr Gln Al - #a Cys Pro Lys Val Ser 85 - # 90 - # 95 - - Phe Asp Pro Ile Pro Ile His Tyr Cys Ala Gl - #y Ala Gly Tyr Ala Ile 100 - # 105 - # 110 - - Leu Lys Cys Asn Asn Lys Thr Phe Asn Gly Th - #r Gly Pro Cys His Asn 115 - # 120 - # 125 - - Ile Ser Thr Val Gln Cys Thr His Gly Ile Ly - #s Pro Val Val Ser Thr 130 - # 135 - # 140 - - Gln Leu Leu Leu Asn Gly Ser Leu Ala Glu Gl - #y Glu Ile Ile Ile Arg 145 1 - #50 1 - #55 1 -#60 - - Ser Glu Asn Leu Thr Asn Asn Val Lys Thr Il - #e Ile Val His LeuAsn 165 - # 170 - # 175 - - Gln Ser Val Glu Ile Val Tyr Thr Arg Pro As - #n Asn Asn Thr Arg Lys 180 - # 185 - # 190 - - Gly Val Arg Ile Gly Pro Gly Gln Thr Phe Ty - #r Ala Thr Gly Asp Ile 195 - # 200 - # 205 - - Ile Gly Asp Ile Arg Gln Ala His Cys Asn Il - #e Ser Lys His Lys Trp 210 - # 215 - # 220 - - Asn Glu Thr Leu Gln Arg Val Gly Lys Lys Le - #u Ala Glu His Phe Pro 225 2 - #30 2 - #35 2 -#40 - - Asn Lys Thr Ile Arg Phe Ala Ser Ser Ser Gl - #y Gly Asp Leu GluIle 245 - # 250 - # 255 - - Thr Thr His Ser Phe Asn Cys Arg Gly Glu Ph - #e Phe Tyr Cys Asn Thr 260 - # 265 - # 270 - - Ser Asp Leu Phe Asn Gly Thr Tyr Met Pro As - #n Gly Thr Lys Ser Asn 275 - # 280 - # 285 - - Ser Ser Ser Thr Ile Thr Ile Pro Cys Arg Il - #e Lys Gln Ile Ile Asn 290 - # 295 - # 300 - - Met Trp Gln Glu Val Gly Arg Ala Met Tyr Al - #a Pro Pro Ile Ala Gly 305 3 - #10 3 - #15 3 -#20 - - Asn Ile Thr Cys Lys Ser Asn Ile Thr Gly Il - #e Leu Leu Val ArgAsp 325 - # 330 - # 335 - - Gly Gly Ile Glu Leu Asn Asp Thr Lys Thr Gl - #u Thr Phe Arg Pro Gly 340 - # 345 - # 350 - - Gly Gly Glu Met Arg Asp Asn Trp Arg Ser Gl - #u Leu Tyr Lys Tyr Lys 355 - # 360 - # 365 - - Val Val Glu Ile Lys Pro Leu Gly Val Ala Pr - #o Thr Thr Ala Lys Arg 370 - # 375 - # 380 - - Arg Val Val Glu Arg Glu Lys Arg Ala Val Gl - #y Ile Gly Ala Val Phe 385 3 - #90 3 - #95 4 -#00 - - Leu Gly Phe Leu Gly Ala Ala Gly Ser Thr Me - #t Gly Ala Ala SerMet 405 - # 410 - # 415 - - Thr Val Thr Val Gln Ala Arg Gln Leu Leu Se - #r Gly Ile Val Gln Gln 420 - # 425 - # 430 - - Gln Ser Asn Leu Leu Arg Ala Ile Glu Ala Gl - #n Gln His Leu Leu Gln 435 - # 440 - # 445 - - Leu Thr Ile Trp Gly Ile Lys Gln Leu Gln Al - #a Arg Val Leu Ala Ile 450 - # 455 - # 460 - - Glu Arg Tyr Leu Lys Glu Gln Gln Leu Leu Gl - #y Ile Trp Gly Cys Ser 465 4 - #70 4 - #75 4 -#80 - - Gly Lys Leu Ile Cys Thr Thr Thr Val Pro Tr - #p Asn Ser Ser TrpSer 485 - # 490 - # 495 - - Asn Arg Ser Gln Thr Asp Ile Trp Asp Asn Me - #t Thr Trp Met Gln Trp 500 - # 505 - # 510 - - Asp Arg Glu Ile Ser Asn Tyr Thr Glu Thr Il - #e Tyr Arg Leu Leu Glu 515 - # 520 - # 525 - - Asp Ser Gln Asn Gln Gln Glu Arg Asn Glu Ly - #s Asp Leu Leu Ala Leu 530 - # 535 - # 540 - - Asp Ser Trp Lys Asn Leu Trp Asn Trp Phe Se - #r Ile Thr Asn Trp Leu 545 5 - #50 5 - #55 5 -#60 - - Trp Tyr Ile Lys Ile Phe Ile Ile Ile Val Gl - #y Gly Leu Ile GlyLeu 565 - # 570 - # 575 - - Arg Ile Ile Phe Ala Val Leu Cys Ile Val As - #n Arg Val Lys Ala Gly 580 - # 585 - # 590 - - Tyr Ser Pro Leu Ser Phe Gln Thr 595 - # 600 - - - - (2) INFORMATION FOR SEQ ID NO: 5: - - (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 1952 base - #pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: unknown (D) TOPOLOGY: unknown - - (ii) MOLECULE TYPE: DNA (genomic) - - (vi) ORIGINAL SOURCE: (A) ORGANISM: HIV-1D760 - - (ix) FEATURE: (A) NAME/KEY: CDS (B) LOCATION: 133..1950 - - (xi) SEQUENCE DESCRIPTION: SEQ ID NO: - #5: - - CATAATGTCT GGGCTACATA TGCCTGTGTA CCCACAGGCC CCGACCCACA AG -#AAATAGTT 60 - - TTGGAAAATG TAACAGGAAA TTTTAACATG TGGAAAAATG ACATGGTGGA TC -#AAATGCAT 120 - - GAGGATGTAA TC AGT TTA TGG GAT CAA AGC CTA AAG - # CCA TGT GTA AAG 168 Ser Leu Tr - #p Asp Gln Ser Leu Lys Pro Cys Val Lys 1 - # 5 - # 10 - - TTG ACC CCA CTC TGT GTC ACT TTA GAG TGT GG - #A AAT GTT AAT GCT ACC 216 Leu Thr Pro Leu Cys Val Thr Leu Glu Cys Gl - #y Asn Val Asn Ala Thr 15 - # 20 - # 25 - - AAT ATT ACC AAT AAT GGG GAA AAT AAT CCT AC - #C AAT ATT ACC AAT AAT 264 Asn Ile Thr Asn Asn Gly Glu Asn Asn Pro Th - #r Asn Ile Thr Asn Asn 30 - # 35 - # 40 - - AGG GAA GAA ATA AAA AAT TGC CCT TTC AAT GC - #A ACC ACA GAA ATA AGA 312 Arg Glu Glu Ile Lys Asn Cys Pro Phe Asn Al - #a Thr Thr Glu Ile Arg 45 - # 50 - # 55 - # 60 - - GAT AGG CAG CAG AAA GTG TAT GCA CTT TTT TA - #T AGA CTT GAT ATA GTA 360 Asp Arg Gln Gln Lys Val Tyr Ala Leu Phe Ty - #r Arg Leu Asp Ile Val 65 - # 70 - # 75 - - CCA CTT GAT AAT AAT AAT AAT AGC ACC TAT AG - #A TTA ATA AAT TGT AAT 408 Pro Leu Asp Asn Asn Asn Asn Ser Thr Tyr Ar - #g Leu Ile Asn Cys Asn 80 - # 85 - # 90 - - ACC TCA GCC ATA ACA CAA GCC TGT CCA AAG GT - #C ACT TTT GAT CCA ATT 456 Thr Ser Ala Ile Thr Gln Ala Cys Pro Lys Va - #l Thr Phe Asp Pro Ile 95 - # 100 - # 105 - - CCT ATA CAC TAT TGT GCT CCA GCT GGT TAT GC - #G ATT CTA AAG TGT AAT 504 Pro Ile His Tyr Cys Ala Pro Ala Gly Tyr Al - #a Ile Leu Lys Cys Asn 110 - # 115 - # 120 - - AAT AAG ACA TTC AAT GGG ACA GGA CCA TGC CA - #T AAT GTC AGC ACA GTA 552 Asn Lys Thr Phe Asn Gly Thr Gly Pro Cys Hi - #s Asn Val Ser Thr Val 125 1 - #30 1 - #35 1 -#40 - - CAA TGT ACA CAT GGA ATT AGC CCA GTG GTA TC - #A ACT CAA CTA CTGTTA 600 Gln Cys Thr His Gly Ile Ser Pro Val Val Se - #r Thr Gln Leu Leu Leu 145 - # 150 - # 155 - - AAT GGT AGC CTA GCA GAA GGA GAG ATA ATA AT - #T AGA TCT GAA AAT CTG 648 Asn Gly Ser Leu Ala Glu Gly Glu Ile Ile Il - #e Arg Ser Glu Asn Leu 160 - # 165 - # 170 - - ACA GAC AAT GTC AAA ACA ATA ATA GTA CAT CT - #T AAT CAA TCT GTA GAA 696 Thr Asp Asn Val Lys Thr Ile Ile Val His Le - #u Asn Gln Ser Val Glu 175 - # 180 - # 185 - - GTT GTG TGT ACA AGA CCC AAC AAT AAT ACA AG - #A AAA AGT ATA AGG ATA 744 Val Val Cys Thr Arg Pro Asn Asn Asn Thr Ar - #g Lys Ser Ile Arg Ile 190 - # 195 - # 200 - - GGA CCA GGA CAA ACA TTT TAT GCA ACA GGA GA - #C ATA ATA GGA GAC ATA 792 Gly Pro Gly Gln Thr Phe Tyr Ala Thr Gly As - #p Ile Ile Gly Asp Ile 205 2 - #10 2 - #15 2 -#20 - - AGA CAA GCA CAT TGT AAC ATT AGT GAA GAT AA - #A TGG AAT GAA ACTTTA 840 Arg Gln Ala His Cys Asn Ile Ser Glu Asp Ly - #s Trp Asn Glu Thr Leu 225 - # 230 - # 235 - - CAA AGG GTA GGT AAA AAA CTA GCA GAA CAC TT - #C CCT AAT AAA ACA ATA 888 Gln Arg Val Gly Lys Lys Leu Ala Glu His Ph - #e Pro Asn Lys Thr Ile 240 - # 245 - # 250 - - AAA TTT GCA GCA TCC TCA GGA GGG GAC CTA GA - #A ATT ACA ACA TAT AGT 936 Lys Phe Ala Ala Ser Ser Gly Gly Asp Leu Gl - #u Ile Thr Thr Tyr Ser 255 - # 260 - # 265 - - TTT AAT TGT AGA GGA GAA TTT TTC TAT TGC AA - #T ACA TCA GGC CTG TTC 984 Phe Asn Cys Arg Gly Glu Phe Phe Tyr Cys As - #n Thr Ser Gly Leu Phe 270 - # 275 - # 280 - - AAT GGT ACA TAC ATG CCT AAT GGT ACA AAA AG - #T AAT TTA AAC TCA ACC 1032 Asn Gly Thr Tyr Met Pro Asn Gly Thr Lys Se - #r Asn Leu Asn Ser Thr 285 2 - #90 2 - #95 3 -#00 - - ATC ACA ATC CCA TGC AGA ATA AAA CAA ATT GT - #G AAC CTG TGG CAGGAG 1080 Ile Thr Ile Pro Cys Arg Ile Lys Gln Ile Va - #l Asn Leu Trp Gln Glu 305 - # 310 - # 315 - - GTA GGA CGA GCA ATG TAT GCC CCT CCA TTT GC - #C AGG AAC ATA ACA TGT 1128 Val Gly Arg Ala Met Tyr Ala Pro Pro Phe Al - #a Arg Asn Ile Thr Cys 320 - # 325 - # 330 - - AAA TCA AAT ATC ACA GGA CTA CTA TTG GTA CG - #T GAT GGA GGA GAA GAC 1176 Lys Ser Asn Ile Thr Gly Leu Leu Leu Val Ar - #g Asp Gly Gly Glu Asp 335 - # 340 - # 345 - - ACA AAT GAT ACA GAG ATA TTC AGT CCT GGA GG - #A GGA GAT ATG AGG GAC 1224 Thr Asn Asp Thr Glu Ile Phe Ser Pro Gly Gl - #y Gly Asp Met Arg Asp 350 - # 355 - # 360 - - AAT TGG AGA AGT GAA TTA TAC AAA TAT AAA GT - #G GTA GAA ATT AAG CCA 1272 Asn Trp Arg Ser Glu Leu Tyr Lys Tyr Lys Va - #l Val Glu Ile Lys Pro 365 3 - #70 3 - #75 3 -#80 - - TTG GGA GTA GCA CCC ACT ACA GCA AAA AGG AG - #A GTG GTG GAG AGAGAA 1320 Leu Gly Val Ala Pro Thr Thr Ala Lys Arg Ar - #g Val Val Glu Arg Glu 385 - # 390 - # 395 - - AAA AGA GCA GTG GGA TTA GGA GCT GTG TTC CT - #T GGG TTC TTG GGA GCA 1368 Lys Arg Ala Val Gly Leu Gly Ala Val Phe Le - #u Gly Phe Leu Gly Ala 400 - # 405 - # 410 - - GCA GGA AGC ACT ATG GGC GCG GCG TCA ATA AC - #G CTG ACG GTA CAG GCC 1416 Ala Gly Ser Thr Met Gly Ala Ala Ser Ile Th - #r Leu Thr Val Gln Ala 415 - # 420 - # 425 - - AGA CAA TTA CTG TCT GGT ATA GTG CAA CAG CA - #A AGC AAT TTG CTG AGG 1464 Arg Gln Leu Leu Ser Gly Ile Val Gln Gln Gl - #n Ser Asn Leu Leu Arg 430 - # 435 - # 440 - - GCT ATA GAG GCG CAA CAG CAT CTG TTG CAA CT - #C ACG GTC TGG GGC ATT 1512 Ala Ile Glu Ala Gln Gln His Leu Leu Gln Le - #u Thr Val Trp Gly Ile 445 4 - #50 4 - #55 4 -#60 - - AAG CAG CTC CAG ACA AGA GTC CTG GCT ATA GA - #A AGA TAC CTA AAGGAT 1560 Lys Gln Leu Gln Thr Arg Val Leu Ala Ile Gl - #u Arg Tyr Leu Lys Asp 465 - # 470 - # 475 - - CAA CAG CTC CTA GGG ATG TGG GGC TGC TCT GG - #A AAA CTC ATC TGC ACC 1608 Gln Gln Leu Leu Gly Met Trp Gly Cys Ser Gl - #y Lys Leu Ile Cys Thr 480 - # 485 - # 490 - - ACT GCT GTA CCT TGG AAC TCC AGT TGG AGT AA - #C AGA TCT CAA ACA GAT 1656 Thr Ala Val Pro Trp Asn Ser Ser Trp Ser As - #n Arg Ser Gln Thr Asp 495 - # 500 - # 505 - - ATT TGG GAT AAC ATG ACC TGG ATG CAG TGG GA - #T AGG GAA ATT AGT AAT 1704 Ile Trp Asp Asn Met Thr Trp Met Gln Trp As - #p Arg Glu Ile Ser Asn 510 - # 515 - # 520 - - TAC ACA AAT ACA ATA TAC AGG TTG CTT GAA GA - #C TCG CAA AAC CAG CAG 1752 Tyr Thr Asn Thr Ile Tyr Arg Leu Leu Glu As - #p Ser Gln Asn Gln Gln 525 5 - #30 5 - #35 5 -#40 - - GAA AGA AAT GAA AAA GAT TTA TTA GCA TTG GA - #C AGT TGG AAA AATCTG 1800 Glu Arg Asn Glu Lys Asp Leu Leu Ala Leu As - #p Ser Trp Lys Asn Leu 545 - # 550 - # 555 - - TGG AAT TGG TTT AGC ATA ACA AAT TGG CTG TG - #G TAT ATA AAA ATA TTC 1848 Trp Asn Trp Phe Ser Ile Thr Asn Trp Leu Tr - #p Tyr Ile Lys Ile Phe 560 - # 565 - # 570 - - ATA ATG ATA GTA GGA GGC TTG ATA GGT TTG AG - #A ATA ATT TTT GCT GTG 1896 Ile Met Ile Val Gly Gly Leu Ile Gly Leu Ar - #g Ile Ile Phe Ala Val 575 - # 580 - # 585 - - CTC TCT ATA GTG AAT AGA GTT AGG CAG GGA TA - #C TCA CCT TTG TCG TTT 1944 Leu Ser Ile Val Asn Arg Val Arg Gln Gly Ty - #r Ser Pro Leu Ser Phe 590 - # 595 - # 600 - - CAG ACC CT - # - # -# 1952 Gln Thr 605 - - - - (2) INFORMATION FOR SEQ ID NO: 6: - - (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 606 amino - #acids (B) TYPE: amino acid (D) TOPOLOGY: linear - - (ii) MOLECULE TYPE: protein - - (xi) SEQUENCE DESCRIPTION: SEQ ID NO: - #6: - - Ser Leu Trp Asp Gln Ser Leu Lys Pro Cys Va - #l Lys Leu Thr Pro Leu 1 5 - # 10 - # 15 - - Cys Val Thr Leu Glu Cys Gly Asn Val Asn Al - #a Thr Asn Ile Thr Asn 20 - # 25 - # 30 - - Asn Gly Glu Asn Asn Pro Thr Asn Ile Thr As - #n Asn Arg Glu Glu Ile 35 - # 40 - # 45 - - Lys Asn Cys Pro Phe Asn Ala Thr Thr Glu Il - #e Arg Asp Arg Gln Gln 50 - # 55 - # 60 - - Lys Val Tyr Ala Leu Phe Tyr Arg Leu Asp Il - #e Val Pro Leu Asp Asn 65 - # 70 - # 75 - # 80 - - Asn Asn Asn Ser Thr Tyr Arg Leu Ile Asn Cy - #s Asn Thr Ser Ala Ile 85 - # 90 - # 95 - - Thr Gln Ala Cys Pro Lys Val Thr Phe Asp Pr - #o Ile Pro Ile His Tyr 100 - # 105 - # 110 - - Cys Ala Pro Ala Gly Tyr Ala Ile Leu Lys Cy - #s Asn Asn Lys Thr Phe 115 - # 120 - # 125 - - Asn Gly Thr Gly Pro Cys His Asn Val Ser Th - #r Val Gln Cys Thr His 130 - # 135 - # 140 - - Gly Ile Ser Pro Val Val Ser Thr Gln Leu Le - #u Leu Asn Gly Ser Leu 145 1 - #50 1 - #55 1 -#60 - - Ala Glu Gly Glu Ile Ile Ile Arg Ser Glu As - #n Leu Thr Asp AsnVal 165 - # 170 - # 175 - - Lys Thr Ile Ile Val His Leu Asn Gln Ser Va - #l Glu Val Val Cys Thr 180 - # 185 - # 190 - - Arg Pro Asn Asn Asn Thr Arg Lys Ser Ile Ar - #g Ile Gly Pro Gly Gln 195 - # 200 - # 205 - - Thr Phe Tyr Ala Thr Gly Asp Ile Ile Gly As - #p Ile Arg Gln Ala His 210 - # 215 - # 220 - - Cys Asn Ile Ser Glu Asp Lys Trp Asn Glu Th - #r Leu Gln Arg Val Gly 225 2 - #30 2 - #35 2 -#40 - - Lys Lys Leu Ala Glu His Phe Pro Asn Lys Th - #r Ile Lys Phe AlaAla 245 - # 250 - # 255 - - Ser Ser Gly Gly Asp Leu Glu Ile Thr Thr Ty - #r Ser Phe Asn Cys Arg 260 - # 265 - # 270 - - Gly Glu Phe Phe Tyr Cys Asn Thr Ser Gly Le - #u Phe Asn Gly Thr Tyr 275 - # 280 - # 285 - - Met Pro Asn Gly Thr Lys Ser Asn Leu Asn Se - #r Thr Ile Thr Ile Pro 290 - # 295 - # 300 - - Cys Arg Ile Lys Gln Ile Val Asn Leu Trp Gl - #n Glu Val Gly Arg Ala 305 3 - #10 3 - #15 3 -#20 - - Met Tyr Ala Pro Pro Phe Ala Arg Asn Ile Th - #r Cys Lys Ser AsnIle 325 - # 330 - # 335 - - Thr Gly Leu Leu Leu Val Arg Asp Gly Gly Gl - #u Asp Thr Asn Asp Thr 340 - # 345 - # 350 - - Glu Ile Phe Ser Pro Gly Gly Gly Asp Met Ar - #g Asp Asn Trp Arg Ser 355 - # 360 - # 365 - - Glu Leu Tyr Lys Tyr Lys Val Val Glu Ile Ly - #s Pro Leu Gly Val Ala 370 - # 375 - # 380 - - Pro Thr Thr Ala Lys Arg Arg Val Val Glu Ar - #g Glu Lys Arg Ala Val 385 3 - #90 3 - #95 4 -#00 - - Gly Leu Gly Ala Val Phe Leu Gly Phe Leu Gl - #y Ala Ala Gly SerThr 405 - # 410 - # 415 - - Met Gly Ala Ala Ser Ile Thr Leu Thr Val Gl - #n Ala Arg Gln Leu Leu 420 - # 425 - # 430 - - Ser Gly Ile Val Gln Gln Gln Ser Asn Leu Le - #u Arg Ala Ile Glu Ala 435 - # 440 - # 445 - - Gln Gln His Leu Leu Gln Leu Thr Val Trp Gl - #y Ile Lys Gln Leu Gln 450 - # 455 - # 460 - - Thr Arg Val Leu Ala Ile Glu Arg Tyr Leu Ly - #s Asp Gln Gln Leu Leu 465 4 - #70 4 - #75 4 -#80 - - Gly Met Trp Gly Cys Ser Gly Lys Leu Ile Cy - #s Thr Thr Ala ValPro 485 - # 490 - # 495 - - Trp Asn Ser Ser Trp Ser Asn Arg Ser Gln Th - #r Asp Ile Trp Asp Asn 500 - # 505 - # 510 - - Met Thr Trp Met Gln Trp Asp Arg Glu Ile Se - #r Asn Tyr Thr Asn Thr 515 - # 520 - # 525 - - Ile Tyr Arg Leu Leu Glu Asp Ser Gln Asn Gl - #n Gln Glu Arg Asn Glu 530 - # 535 - # 540 - - Lys Asp Leu Leu Ala Leu Asp Ser Trp Lys As - #n Leu Trp Asn Trp Phe 545 5 - #50 5 - #55 5 -#60 - - Ser Ile Thr Asn Trp Leu Trp Tyr Ile Lys Il - #e Phe Ile Met IleVal 565 - # 570 - # 575 - - Gly Gly Leu Ile Gly Leu Arg Ile Ile Phe Al - #a Val Leu Ser Ile Val 580 - # 585 - # 590 - - Asn Arg Val Arg Gln Gly Tyr Ser Pro Leu Se - #r Phe Gln Thr 595 - # 600 - # 605 - - - - (2) INFORMATION FOR SEQ ID NO: 7: - - (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 9 amino - #acids (B) TYPE: amino acid (D) TOPOLOGY: unknown - - (ii) MOLECULE TYPE: peptide - - (xi) SEQUENCE DESCRIPTION: SEQ ID NO: - #7: - - Met Pro Asn Gly Thr Lys Ser Asn Ser 1 5 - - - - (2) INFORMATION FOR SEQ ID NO: 8: - - (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 9 amino - #acids (B) TYPE: amino acid (D) TOPOLOGY: unknown - - (ii) MOLECULE TYPE: peptide - - (xi) SEQUENCE DESCRIPTION: SEQ ID NO: - #8: - - Met Pro Asn Gly Thr Lys Gly Asn Ser 1 5 - - - - (2) INFORMATION FOR SEQ ID NO: 9: - - (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 9 amino - #acids (B) TYPE: amino acid (D) TOPOLOGY: unknown - - (ii) MOLECULE TYPE: peptide - - (xi) SEQUENCE DESCRIPTION: SEQ ID NO: - #9: - - Met Pro Asn Gly Thr Lys Ser Asn Leu 1 5 - - - - (2) INFORMATION FOR SEQ ID NO: 10: - - (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 14 amino - #acids (B) TYPE: amino acid (D) TOPOLOGY: unknown - - (ii) MOLECULE TYPE: peptide - - (xi) SEQUENCE DESCRIPTION: SEQ ID NO: - #10: - - Arg Asn Glu Lys Asp Leu Leu Ala Leu Asp Se - #r Trp Lys Asn 1 5 - # 10__________________________________________________________________________
Claims
  • 1. A polypeptide selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, and SEQ ID NO: 6.
  • 2. A peptide selected from the group consisting of SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, and SEQ ID NO: 10.
  • 3. A process for producing antibodies comprising: a) injecting an animal with peptides selected from the group consisting of SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, and SEQ ID NO: 10; and
  • b) recovering the antibodies produced by the animal in response to the peptides.
  • 4. A process for producing antibodies comprising:
  • a) injecting an animal with polypeptides selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, and SEQ ID NO: 6; and
  • b) recovering the antibodies produced by the animal in response to the polypeptides.
Priority Claims (1)
Number Date Country Kind
42 28 787 Aug 1992 DEX
Parent Case Info

This application is a 371 of PCT/EP93/02275 filed on Aug. 25, 1993.

PCT Information
Filing Document Filing Date Country Kind 102e Date 371c Date
PCT/EP93/02275 8/25/1993 4/20/1995 4/20/1995
Publishing Document Publishing Date Country Kind
WO94/05327 3/17/1994
US Referenced Citations (3)
Number Name Date Kind
5030449 Berzofsky et al. Jul 1991
5128319 Arlinghaus Jul 1992
5576000 Reitz et al. Nov 1996
Foreign Referenced Citations (4)
Number Date Country
0 498 905 Aug 1982 EPX
0 327 180 Aug 1989 EPX
WO 8810267 Dec 1988 WOX
WO 9205800 Apr 1992 WOX
Non-Patent Literature Citations (5)
Entry
International Search Report, PCT/EP 93/ 02275, Feb. 11, 1994.
International Preliminary Examination Report, PCT/EP 93/02275, Dec. 9, 1994.
Cohen, J: Jitters Jeopardize AIDS Vaccine Trials: Science vol. 262: pp. 980-981: 1993.
Pietrich, V., et al: Detection of Highly Divergent HIV Strains on India: Int. Conf. AIDS(Netherlands): 8(a) pH:12: Abstract BAQ 2095:1992.
Dietrich, et al. : Detection of highly divergent HIV strains in India: Int. Conf. AIDS: 8(2): pA12 (abstract No. PoA 2055).