Patent Application
20110091386
The present invention relates to humanized antibodies that immunospecifically recognize amino acid sequence RGD (Arg-Gly-Asp) of an extracellular matrix protein and to their therapeutic and diagnostic uses for various diseases or disorders including cancer, inflammatory diseases, autoimmune diseases, infectious disease, bone disease and the like.
Throughout this provisional application, several publications (including patents and patent applications) are referenced herein. Disclosure of these publications in their entirety is hereby incorporated by reference into this provisional application to more fully describe the state of the art to which the present invention pertains.
Cell adhesion plays an important role in sustaining life of multicellular organisms. Cell adhesions of multicellular organisms are classified into cell-extracellular matrix (hereinafter abbreviated as “ECM”) adhesion and cell-cell adhesion. It has been elucidated that cell-ECM adhesion is mediated by integrins and cell-cell adhesion is mediated by cadherins, claudins and nectins.
Transmembrane adhesion proteins, such as integrins, constitute cell-ECM adhesions. Integrin forms heterodimer of α and β chains. At least 18 types of α chain, 8 types of β chain and 24 types of αβ heterodimer have been identified and confirmed so far. Each type of integrin recognizes a specific ligand. Transmembrane adhesion proteins including integrins relate to, in addition to cell adhesions, intracellular signal transductions from ECM into a cell and regulation of proliferation, mobility and differentiation (F. G. Giancotti, et. al., Science, 285, 1028-1032, 1999).
Many proteins are known as ECM proteins which are classified into collagens (such as type I-XIX), non-collagenous glycoproteins (such as osteopontin (OPN), vitronectin, fibronectin, von Willebrand Factor, laminin, tenascin, fibrinogen, thrombospondin), elastins and proteoglycans. These ECM proteins bind to corresponding integrins and activate intracellular signal transduction pathways to regulate cytoskeletal organization, mobility, proliferation, differentiation, and the like. ECM protein-bound integrin regulates these signal activating pathways by transmitting specific signals depending on the type of ECM protein. The RGD sequence is commonly observed in cell adhesion region of many ECM proteins and exhibits various functions by binding to integrins. The RGD sequence of ECM proteins has been viewed as a possible target for drugs, and a number of small molecule compounds and artificial peptides have been provided.
Some types of integrins such as α3β1 integrin, α5β1 integrin, α8β1 integrin, αvβ1 integrin, αvβ3 integrin, αvβ5 integrin, αvβ6 integrin, αvβ8 integrin have been known to bind to the RGD sequence. The interaction between α5β1 integrin and its specific ligand fibronectin has inspired investigations into the mechanisms of integrin mediated signal transduction. Such investigations show that α5β1 integrin regulates not only cell adhesion and cell mobility, but also cell differentiation and cell mortality. (S. M. Frisch et al., Curr. Opin. Cell Biol., 9, 701-706, 1997). It has also been shown that α5β1 integrin is highly expressed on tumor cells and relates to malignant alteration of cancer. Each integrin mediated signal differs depending on binding ECM proteins, for example, stimulation by growth factor activates growth of fibronectin-bound endothelial cells, but inhibits growth of laminin-1 bound endothelial cells. Also, the signal transmitted from laminin-10/11 to α3β1 integrin is different from the signal transmitted from fibronectin to α5β1 integrin, and significantly enhances mobility of cancerous cells (J. Gu et al., J. Biol. Chem., 276, 27090-27097, 2001) and significantly avoids apoptosis by blood starvation (J. Gu et al., J. Biol. Chem., 277, 19922-19928, 2002). High expression of RGD sequence binding αv integrins has been observed in the osteoclastic cells and neovascular, and inhibition of the RGD sequence and the αv integrins has been viewed as a target for a therapeutic drug for osteoporosis and cancer. It has been indicated that α5β1 integrin is highly expressed on tumor cells and relates to malignant alteration of cancer. From these findings, anti-α5β1 integrin antibody (Volocimab), anti-α4 integrin antibody (Natalizumab), and anti-αvβ3 integrin antibody (Vitaxin) have been developed as antagonistic anti-integrin antibody drugs which inhibit interaction between integrin and ECM protein.
Meanwhile, some ECM proteins such as collagen, osteopontin (OPN), vitronectin, fibronectin, von Willebrand Factor, laminin, tenascin, fibrinogen and thrombospondin have been known to include RGD sequence. Also, some virus and some bacterium have been known to possess RGD sequence to adhere to cells. OPN is an acidic glycoprotein with binding properties to calcium which is contained rich in bone. It is reported that OPN plays an important role in cell adhesion, cell migration, tumor formation, immune response and complement mediated cellular lysis. Outcomes of OPN knockout mice and anti-OPN neutralizing antibodies indicate that OPN relates to hepatitis, autoimmune disease (such as rheumatoid arthritis), and metastasis of cancer. It has been noted that an inhibitor of binding of ECM proteins to cells may be used for treating osteoporosis or cancer. Thus, in addition to the above-mentioned antagonistic drugs targeted to integrins, antagonistic drugs targeted to the ECM proteins which are binding partner of the integrins have been developed.
Although drugs such as small molecules that inhibit the RGD sequence mediated interaction with integrin, antibodies against OPN, and antibodies against integrins have been reported, there are no reports regarding an antibody which specifically recognizes the RGD sequence. Since the RGD sequence is one of the conserved sequences in ECM proteins, an antibody which specifically recognizes the RGD sequence may have an effect in both human and therapeutic model animals, and, hence, may be considered as a very useful active ingredient for the development of a therapeutic agent. Hence, there is a need for such an antibody which specifically recognizes the RGD sequence.
Previously, the inventors isolated mouse monoclonal antibodies that immunospecifically recognize the RGD sequence and are produced by hybridoma clones 33E10 and 35B6 (Depository Accession Nos. FERM BP-10440 and FERM BP-10441, respectively). Herein, the hybridoma clone designations are interchangeably used as the designations of the monoclonal antibodies produced by the clones. All of these mouse anti-RGD antibodies were of IgG1 isotype. These monoclonal antibodies were observed to interfere with RGD sequence-mediated binding between ECM and a cell by binding to the RGD sequence of ECM proteins such as osteopontin. Thus, these anti-RGD antibodies may exhibit therapeutic or diagnostic effects on the RGD sequence-related disease such as cancer, e.g., the growth or metastasis of cancer cells, and inflammatory diseases, e.g., rheumatoid arthritis, osteoarthritis, infectious disease, hepatitis, bronchial asthma, fibrosis, diabetes mellitus, arteriosclerosis, multiple sclerosis, granuloma, an inflammatory bowel disease (ulcerative colitis and Crohn's disease), an autoimmune disease, osteoporosis, and the like.
However, since these monoclonal antibodies are of mouse origin, possible adverse effects due to their immunogenicity in humans have hampered their direct applications to diagnostic or therapeutic uses in humans. In order to reduce the immunogenicity, the present inventors have prepared a humanized antibody that have biological activities corresponding to those exhibited by the original mouse anti-RGD antibody from which said humanized antibody was derived.
Accordingly, the present invention provides a humanized antibody or an antigen-binding fragment thereof, which immunospecifically recognizes the RGD sequence, said antibody or an antigen-binding fragment thereof comprising an antigen-binding region partially derived from a non-human origin and partially derived from a human origin. In some embodiment, the humanized antibody or the antigen-binding fragment thereof of the present invention comprises a complementarity determining region (hereinafter abbreviated as “CDR”) derived from a non-human source (donor) such as 33E10 and 35B6 monoclonal antibodies, and a framework region (hereinafter abbreviated as “FR”) derived from a human source (acceptor). Said humanized antibody or an antigen-binding fragment thereof may inhibit the binding between the RGD sequence and a ligand thereof.
In specific embodiments, said humanized antibody or an antigen-binding fragment thereof that immunospecifically recognizes the RGD sequence comprises: (i) a heavy chain (hereinafter abbreviated as “H-chain”) comprising at least one H-chain FR (hereinafter abbreviated as “FRH”) derived from a variable region (hereinafter abbreviated as “V-region”) of a human H-chain, and at least one H-chain CDR (hereinafter abbreviated as “CDRH”) derived from at least one of the CDRHs of a non-human antibody that immunospecifically recognizes the RGD sequence; or (ii) a light chain (hereinafter abbreviated as “L-chain”) comprising at least one L-chain FR (hereinafter abbreviated as “FRL”) derived from a V-region of a human L-chain, and at least one L-chain CDR (hereinafter abbreviated as “CDRL”) derived from at least one of the CDRLs of a non-human antibody that immunospecifically recognizes the RGD sequence; or both (i) and (ii) above. In one embodiment, at least one of the CDRHs and/or at least one of the CDRLs of the humanized antibody of the present invention may be derived from a monoclonal antibody produced by a hybridoma selected from the group consisting of Depository Accession Nos. FERM BP-10440 and FERM BP-10441. In preferred embodiments, the humanized antibody or an antigen-binding fragment thereof of the present invention comprises: (i) at least one FRH derived from a human FRH, and at least one CDRH comprising an amino acid sequence selected from the group consisting of the amino acid sequences of SEQ ID NOS:1, 2 and 3; or (ii) at least one FRL derived from a human FRL, and at least one CDRL comprising an amino acid sequence selected from the group consisting of the amino acid sequences of SEQ ID NOS. 4, 5 and 6; or (iii) both (i) and (ii) above. In some embodiments, said humanized antibody or an antigen-binding fragment thereof of the present invention may comprise SEQ ID NO:1 at CDRH1, SEQ ID NO:2 at CDRH2 and SEQ ID NO:3 at CDRH3. In some embodiments, said humanized antibody or an antigen-binding fragment thereof of the present invention may comprise SEQ ID NO:4 at CDRL1, SEQ ID NOS: 5 at CDRL2 and SEQ ID NOS: 6 at CDRL3. Preferably, said humanized antibody or an antigen-binding fragment thereof of the present invention comprises SEQ ID NO:1 at CDRH1, SEQ ID NO:2 at CDRH2, SEQ ID NO:3 at CDRH3, SEQ ID NO:4 at CDRL1, SEQ ID NO:5 at CDRL2 and SEQ ID NO:6 at CDRL3.
In some specific embodiments, said humanized antibody or an antigen-binding fragment thereof of the present invention comprises a FRH derived from a V-region of a human H-chain encoded by GenBank Accession No. X65891 (SEQ ID NO:13) or a FRL derived from a V-region of a human κ-L-chain encoded by GenBank Accession No. X72441 (SEQ ID NO:18). In some embodiments, the FRH of the humanized antibody of the present invention comprises at least one amino acid sequence selected from the group consisting of the amino acid sequences of SEQ ID NOS: 14, 15, 16 and 17 (amino acid sequences of FRH1, FRH2, FRH3 and FRH4 of X65891, respectively). In some embodiments, the FRL of the humanized antibody of the present invention comprises at least one amino acid sequence selected from the group consisting of the amino acid sequences of SEQ ID NOS: 19, 20, 21 and 22 (amino acid sequences of FRL1, FRL2, FRL3 and FRL4 of X72441, respectively). In one of the most preferred embodiment, the humanized antibody or an antigen-binding fragment thereof of the present invention comprises: (i) a V-region of H-chain (hereinafter abbreviated as “VH”) comprising the amino acid sequence of SEQ ID NO:24; or (ii) a V-region of L-chain (hereinafter abbreviated as “VL”) comprising the amino acid sequence of SEQ ID NO:26; or (iii) both (i) and (ii) above.
In the other embodiments, the humanized antibody or an antigen-binding fragment thereof of the present invention comprises: (i) at least one FRH derived from a human FRH, and at least one CDRH comprising an amino acid sequence selected from the group consisting of the amino acid sequences of SEQ ID NOS:7, 8 and 9; or (ii) at least one FRL derived from a human FRL, and at least one CDRL comprising an amino acid sequence selected from the group consisting of the amino acid sequences of SEQ ID NOS:10, 11 and 12; or (iii) both (i) and (ii) above. In some embodiments, said humanized antibody or an antigen-binding fragment thereof of the present invention may comprise SEQ ID NO:7 at CDRH1, SEQ ID NO:8 at CDRH2 and SEQ ID NO:9 at CDRH3. In some embodiments, said humanized antibody or an antigen-binding fragment thereof, of the present invention comprises SEQ ID NO:10 at CDRL1, SEQ ID NO:11 at CDRL2 and SEQ ID NO:12 at CDRL3. Preferably, said humanized antibody or an antigen-binding fragment thereof of the present invention comprises SEQ ID NO:7 at CDRH1, SEQ ID NO:8 at CDRH2, SEQ ID NO:9 at CDRH3, SEQ ID NO:10 at CDRL1, SEQ ID NO:11 at CDRL2 and SEQ ID NO:12 at CDRL3.
In some specific embodiments, said humanized antibody or an antigen-binding fragment thereof of the present invention comprises a FRH derived from a V-region of a human H-chain encoded by GenBank Accession No. X65891 (SEQ ID NO:13) or a FRL derived from a V-region of a human κ-L-chain encoded by GenBank Accession No. X72441 (SEQ ID NO:18). In some embodiments, the FRH of the humanized antibody of the present invention comprises at least one amino acid sequence selected from the group consisting of the amino acid sequences of SEQ ID NOS: 14, 15, 16 and 17 (amino acid sequences of FRH1, FRH2, FRH3 and FRH4 of X65891, respectively). In some embodiments, the FRL of the humanized antibody of the present invention comprises at least one amino acid sequence selected from the group consisting of the amino acid sequences of SEQ ID NOS: 19, 20, 21 and 22 (amino acid sequences of FRL1, FRL2, FRL3 and FRL4 of X72441, respectively). In one of the most preferred embodiment, the humanized antibody or an antigen-binding fragment thereof of the present invention comprises: (i) a VH comprising the amino acid sequence of SEQ ID NO:28; or (ii) a VL comprising the amino acid sequence of SEQ ID NO:30; or (iii) both (i) and (ii) above.
The present invention further provides an isolated nucleic acid molecule comprising a nucleotide sequence encoding the humanized antibody or an antigen-binding fragment thereof of the present invention which immunospecifically recognizes the RGD sequence. Specifically, the present invention provides an isolated nucleic acid molecule comprising a nucleotide sequence encoding a humanized H-chain comprising at least one amino acid sequence selected from the group consisting of SEQ ID NOS:1, 2, 3, 7, 8 and 9, or a humanized L-chain comprising at least one amino acid sequence selected from the group consisting of SEQ ID NOS:4, 5, 6, 10, 11 and 12, or both said humanized H-chain and said humanized L-chain. In preferred specific embodiments, such an isolated nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO:23, which encodes a VH, or a nucleotide sequence encoding the amino acid sequence of SEQ ID NO:24. In some preferred specific embodiments, such an isolated nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO:25, which encodes a VL, or a nucleotide sequence encoding the amino acid sequence of SEQ ID NO:26. Preferably, the isolated nucleic acid molecule of the present invention comprises the nucleotide sequences both of SEQ ID NO:23 and SEQ ID NO:25. In preferred specific embodiments, the isolated nucleic acid molecule of the present invention further comprises a nucleotide sequence encoding a signal peptide of donor origin, such as the amino acid sequences of SEQ ID NOS:32 and 34, or of heterologous origin.
In the other preferred specific embodiments, such an isolated nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO:27, which encodes a VH, or a nucleotide sequence encoding the amino acid sequence of SEQ ID NO:28. In some preferred specific embodiments, such an isolated nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO:29 which encodes a VL, or a nucleotide sequence encoding the amino acid sequence of SEQ ID NO:30. Preferably, the isolated nucleic acid molecule of the present invention comprises the nucleotide sequences both of SEQ ID NO:27 and SEQ ID NO:29. In preferred specific embodiments, the isolated nucleic acid molecule of the present invention further comprises a nucleotide sequence encoding a signal peptide of donor origin, such as the amino acid sequences of SEQ ID NOS:36 and 38, or of heterologous origin.
The present invention further provides a vector, e.g., an expression vector, comprising a nucleotide sequence encoding a H-chain or a L-chain, or both, of the humanized antibody or an antigen-binding fragment thereof of the present invention that immunospecifically recognizes the RGD sequence. In such a vector, the nucleotide sequence of the present invention may be operably linked to one or more regulatory elements. The nucleotide sequence of the present invention may include a nucleotide sequence encoding a signal peptide native to a non-human donor antibody from which a CDR is derived, or a signal peptide of heterologous origin.
Furthermore, the present invention provides a host cell comprising the nucleic acid molecule of the present invention, including a vector comprising the nucleic acid molecule of the present invention. In one embodiment, the present invention provides an isolated host cell comprising a first nucleic acid molecule encoding a humanized H-chain of the present invention and a second nucleic acid molecule encoding a humanized L-chain of the present invention, said first and second nucleic acid molecules are each operably linked to a regulatory element in such a way that the biologically functional humanized antibody or antigen-binding fragment thereof of the present invention is expressed.
Accordingly, the present invention further provides a method for preparing the humanized antibody or an antigen-binding fragment thereof of the present invention, comprising culturing the host cell of the invention under conditions so that the humanized antibody or an antigen-binding fragment thereof is expressed; and collecting the produced humanized antibody.
The present invention further provides a composition comprising at least one of the humanized antibodies or an antigen-binding fragment thereof of the present invention. In addition, the present invention provides a pharmaceutical composition for preventing or treating a disorder or disease that is associated with the RGD-proteins, comprising at least one of the humanized antibodies or an antigen-binding fragment thereof of the present invention, and a pharmaceutically acceptable carrier. Either of said compositions can further comprise another active compound that can additively or synergistically ameliorate the disorder or disease. Said active compounds include, but not limited to, anti-inflammatory compounds, chemotherapeutic compounds and the like. Said active compounds also include small molecule compounds and antibodies or an antigen-binding fragment thereof, such as human α4 integrin specific antibody or human α9 integrin specific antibody.
In another aspect, the present invention provides a method for preventing or treating a disorder or disease that is associated with or involves the RGD-proteins, said method comprising administering a prophylactically or therapeutically effective amount of at least one of the humanized antibodies or an antigen-binding fragment thereof of the present invention to a subject in need thereof. For such uses, the humanized antibody or an antigen-binding fragment thereof of the present invention may be conjugated to a therapeutic moiety that enhances the biological effect of the humanized antibody or an antigen-binding fragment thereof. Examples of such a therapeutic moiety include another antibody, cytotoxins that are cytostatic or cytocidal, radioactive elements, and/or other therapeutic agents, including anti-inflammatory agents, antibiotics and the like.
In yet another aspect, the present invention provides a method for diagnosing a disorder or disease, in a subject, that is associated with or involves RGD-proteins, said method comprising administering a diagnostically effective amount of the humanized antibody or an antigen-binding fragment thereof of the present invention to a subject to be examined. For such diagnostic uses, the humanized antibody of the present invention may be labeled with detectable markers, such as radioactive elements.
As used herein, the term “antibody” refers to an antibody molecule capable of immunospecifically binding to a desired antigen or a desired sequence (such as the RGD sequence), and encompasses an antibody molecule as a whole or a fragment thereof, including an antigen-binding fragment.
The term “an antigen-binding fragment” used herein refers to any fragment of an antibody that retains an ability to immunospecifically bind to a target polypeptide, protein or sequence, in particular the RGD sequence, which includes single chain antibodies, Fab fragments, F(ab′)2 fragments, disulfide-linked Fvs and fragments containing either a VL and/or a VH or a CDR that specifically binds to a target polypeptide, protein or sequence. Thus, such antigen-binding fragments of humanized antibody may or may not include partial or full-length human constant regions. Various methods for obtaining the antibody fragments described above are well known in the art.
The term “immunospecifically recognize” used herein refers to an ability of an antibody or an antigen-binding fragment thereof to bind specifically to a target polypeptide, protein or sequence, in particular, human RGD sequence. Such an antibody does not non-specifically bind to other polypeptides or proteins. However, an antibody or an antigen-binding fragment thereof that immunospecifically binds to the target polypeptide or protein (e.g., RGD-protein) may cross-react with other antigens. For example, the humanized antibody or an antigen-binding fragment thereof of the present invention that immunospecifically recognizes human RGD-proteins may cross-react with murine RGD-proteins. Preferably, an antibody or an antigen-binding fragment thereof that immunospecifically recognizes RGD-proteins does not cross-react with other antigens.
The term “derived from a human source” or “derived from a non-human source” used herein refers to an antibody portion whose amino acid sequence is derived from a corresponding portion of a human antibody or of a non-human antibody, respectively.
The term “an acceptor sequence” used herein refers to a nucleotide sequence or an amino acid sequence of FRs from a human antibody VH or VL that serves as an acceptor for CDRs from a donor antibody which is usually a non-human antibody.
Antibodies that immunospecifically recognize the RGD sequence may be generated by any suitable method known in the art.
RGD-protein or peptides which includes cell adhesive “RGD” sequence (hereinafter abbreviated as “RGD-peptides”) in the present invention or may be (1) derived from human ECMs that express RGD-protein or from all tissues where these ECMs are present, (2) recombinant proteins or peptides which are obtained by expression of the DNA (preferably cDNA) encoding the RGD-protein or RGD-peptide by transfecting into bacteria, yeast, cell lines such as animal cells, etc., or (3) synthetic proteins or peptides.
The RGD-peptides used as an antigen in the present invention may be able to produce antibodies against the RGD sequence by immunization. The RGD-peptides include the RGD-peptides an amino acid sequence CVDVPNGRGDSLAYGLR (SEQ ID NO:71) which is a cell adhesive sequence of murine ECM protein. The RGD-proteins or the RGD-peptides include such as OPN, vitronectin, fibronectin, von Willebrand Factor, collagens, laminin, tenascin, fibrinogen, thrombospondin and RGD including fragment thereof. Artificial or natural variations such as substitutions, deletions, modifications and additions of the amino acid can be applied to the said proteins or said peptides as far as the proteins or the peptides include the RGD-sequence. The variant proteins or peptides may comprise an amino acid sequence, wherein multiple amino acids, preferably 1 to 10 amino acids and more preferably 1 to several (e.g., 1 to 5) amino acids are substituted deleted, modified, added or inserted.
Herein, the RGD-peptide comprises at least about 5 amino acids, preferably about 5 to 50 amino acids, and more preferably about 10 to 20 amino acids. The RGD-proteins or the RGD-peptides as an antigen in the present invention can be produced by using methods well known in the art, such as chemical synthesis method, cell culture method, gene recombinant method and its proper modification. For example, the RGD-peptide can be obtained by cleaving ECM protein with protease appropriately. The RGD-protein or the RGD-peptide can be derived from mammal such as murine, rat, rabbit, swine, bovine, monkey and human. Any methods well known in the art can be used for preparing the RGD-protein or the RGD-peptide which can be used for preparing an anti-RGD antibody.
Examples of the methods for producing variant polypeptides include a synthetic oligonucleotide site-directed mutagenesis (gapped duplex method), a point mutagenesis method which involves introducing a point mutation at random by treatment with nitrite or sulfite, a method which involves preparing a deletion mutant with Ba131 enzyme, or other enzymes, a cassette mutagenesis, a linker scanning method, a miss incorporation method, a mismatch primer method, a DNA segment synthesis method, and the like.
The RGD-peptide can be bound with other biologic macromolecule such as thyrogloblin, Keyhole Limpet Haemocyanin (KLH), bovine serum albumin (BSA), ovalbumin (OVA) or bovine globulin, preferably thyrogloblin. The method for binding RGD-peptide to a biologic macromolecule may be achieved by using coupling reagent such as a binding reagent having active ester group and maleic imide group (the active ester group binds to amino group of a protein or a peptide and the maleic imide group binds to thiol group of a protein or a peptide; S. Yoshirake et al., Eur. J. Biochem., 101, 395-399, 1979), by using mixed anhydride method (B. F. Erlanger et al., J. Biol. Chem., 234, 1090-1094, 1954), or by using active ester method (A. E. Kant et al., J. Agric. Food Chem., 42, 301-309, 1994). The method for binding RGD-peptide to a biologic macromolecule is preferably achieved by using coupling reagent.
As an antigen, a cell per se that overexpresses the RGD-protein or the RGD-peptide can be also used. Cells overexpressing the RGD-protein or the RGD-peptide may be prepared by recombinant DNA technologies well known in the art.
Using appropriate antigens prepared as described above, antibodies specific for the RGD sequence may be prepared by various methods well known in the art. Polyclonal antibodies to the RGD sequence can be produced by various procedures well known in the art. For example, an antigen of interest can be administered to various host animals including, but not limited to, rabbits, mice, rats, etc., to induce the production of antisera containing polyclonal antibodies specific for the antigen. Various adjuvants may be used to increase the immunological response, depending on the host species, which include but are not limited to, Freund's (complete and incomplete) adjuvant, mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanins, dinitrophenol, and potentially useful adjuvants for humans such as BCG (Bacille Calmette-Guerin) and Corynebacterium parvum. Such adjuvants are also well known in the art.
Monoclonal antibodies can be prepared by using a wide variety of techniques known in the art including the use of hybridoma, recombinant and phage display technologies, or a combination thereof. For example, monoclonal antibodies can be produced by using hybridoma techniques including those known in the art and taught in, for example, Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling, et al., in: Monoclonal Antibodies and T-Cell Hybridomas, pp. 563-681 (Elsevier, N.Y., 1981) (both of which are incorporated by reference in their entirety). The term “monoclonal antibody” as used herein is not limited to antibodies produced through hybridoma technology. The term “monoclonal antibody” refers to an antibody derived from a single clone, and includes any eukaryotic, prokaryotic or phage clone, but not limited to the method it is produced.
Methods for producing and screening for specific antibodies using hybridoma technology are routine and well known in the art. In a non-limiting example, mice can be immunized with an antigen of interest or a cell expressing such an antigen. Once an immune response is detected, e.g., antibodies specific for the antigen are detected in the mouse serum, the mouse spleen is harvested and splenocytes isolated. The splenocytes are then fused by well known techniques to any suitable myeloma cells (e.g., P3U1, P3X63-Ag8, P3X63-Ag8-U1, P3NS1-Ag4, SP2/0-Ag14, P3X63-Ag8-653, etc.). Hybridomas are selected and cloned by limiting dilution. The hybridoma clones are then assayed by methods known in the art for cells that secrete antibodies capable of binding the antigen. Ascites fluid, which generally contains high levels of antibodies, can be generated by inoculating mice intraperitoneally with positive hybridoma clones.
Antibody fragments what recognize specific epitopes may be generated by known techniques. For example, Fab and F(ab′)2 fragments may be produced by proteolytic cleavage of immunoglobulin molecules, using enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab′)2 fragments). F(ab′)2 fragments contain the complete L-chain, and the V-region, the CH1 region and the hinge region of the H-chain.
The antibodies of the invention or an antigen-binding fragment thereof may be produced by any method known in the art for synthesis of antibodies, in particular, by chemical synthesis or preferably by recombinant expression techniques.
The nucleotide sequence encoding an antibody may be obtained from any information available to those skilled in the art (i.e., from Genbank, the literature, or by routine cloning and sequence analysis). If a clone containing a nucleic acid encoding a particular antibody or an epitope-binding fragment thereof is not available, but the sequence of the antibody molecule or epitope-binding fragment thereof is known, a nucleic acid encoding the immunoglobulin may be chemically synthesized or obtained from a suitable source (e.g., an antibody cDNA library, or a cDNA library generated from, or nucleic acid, preferably poly A+RNA, isolated from any tissue or cells expressing the antibody, such as hybridoma cells selected to express an antibody) by PCR amplification using synthetic primers hybridizable to the and 5′ ends of the sequence or by cloning using an oligonucleotide probe specific for the particular gene sequence to identify, e.g., a cDNA clone from a cDNA library that encodes the antibody. Amplified nucleic acids generated by PCR may then be cloned into replicable cloning vectors using any method well known in the art.
The nucleotide sequence of the antibody may be manipulated by using methods well known in the art for the manipulation of nucleotide sequences, e.g., recombinant DNA techniques, site directed mutagenesis, PCR and the like (see, for example, the techniques described in Sambrook et al., supra; and Ausubel et al., eds., 1998, Current Protocols in Molecular Biology, John Wiley & Sons, NY, which are both incorporated by reference herein in their entirety). Antibodies may be introduced mutations such as substitutions, deletions and/or insertions of amino acid at epitope-binding domain regions or at any portion to enhance or reduce biological activities.
An expression vector containing a nucleotide sequence that encodes the antibody can be used for recombinant expression of an antibody or an antigen-binding fragment thereof. The vector including a nucleotide sequence encoding an antibody molecule, a H-chain and/or a L-chain of an antibody or a portion thereof for production of the antibody or an antigen-binding fragment thereof may be produced by recombinant DNA technology using techniques well known in the art as discussed in the previous sections. Methods which are well known to those skilled in the art can be used to construct expression vectors containing antibody or an antigen-binding fragment thereof coding sequences and appropriate transcriptional and translational control signals. These methods include, for example, in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. The nucleotide sequence encoding the VH, the VL, both of the VH and the VL, an antigen-binding fragment of the VH and/or VL, or one or more CDRs of an antibody may be cloned into such a vector for expression. Such a sequence may be fused with a polynucleotide encoding a signal peptide which may be native or a heterologous to the original antibody. The expression vector thus-prepared can be then introduced into appropriate host cells for the expression of the antibody. Accordingly, the invention includes host cells containing a polynucleotide encoding a humanized antibody or an antigen-binding fragment thereof that immunospecifically recognizes the RGD sequence.
The host cell may be co-transfected with two expression vectors of the invention, wherein the first vector encodes a H-chain derived polypeptide and the second vector encodes a L-chain derived polypeptide. The two vectors may contain identical selectable markers which enable equal expression of H-chain and L-chain polypeptides or different selectable markers to ensure maintenance of both plasmids. Alternatively, a single vector may be used which encodes, and is capable of expressing, both of H-chain and L-chain polypeptides. The coding sequences for the H-chain and L-chain may comprise cDNA or genomic DNA.
In another embodiment, antibodies can also be generated using various phage display methods known in the art. In phage display methods, functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them. In a particular embodiment, such phage can be utilized to display antigen binding domains, such as Fab and Fv or disulfide-bond stabilized Fv, expressed from a repertoire or combinatorial antibody library (e.g., human or murine). Phage expressing an antigen binding domain that binds the antigen of interest can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead. Phages used in these methods are typically filamentous phage, including fd and M13. The antigen binding domains are expressed as a recombinantly fused protein to either the phage gene III or gene VIII protein. Examples of phage display methods that can be used to make the immunoglobulins, or fragments thereof, of the present invention include those disclosed in Brinkman et al., J. Immunol. Methods, 182:41-50, 1995; Ames et al., J. Immunol. Methods, 184:177-186, 1995; Kettleborough et al., Eur. J. Immunol., 24:952-958, 1994; Persic et al., Gene, 187:9-18, 1997; Burton et al., Advances in Immunology, 57:191-280, 1994; PCT application No. PCT/GB91/01134; PCT publications WO 90/02809; WO 91/10737; WO 92/01047; WO 92/18619; WO 93/11236; WO 95/15982; WO 95/20401; and U.S. Pat. Nos. 5,698,426; 5,223,409; 5,403,484; 5,580,717; 5,427,908; 5,750,753; 5,821,047; 5,571,698; 5,427,908; 5,516,637; 5,780,225; 5,658,727; 5,733,743 and 5,969,108; each of which is incorporated herein by reference in its entirety.
As described in the above references, after phage selection, the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including human antibodies, or any other desired fragments, and expressed in any desired host, including mammalian cells, insect cells, plant cells, yeast, and bacteria, e.g., as described in detail below. For example, techniques to recombinantly produce Fab, Fab′ and F(ab′)2 fragments can also be employed using methods known in the art such as those disclosed in PCT publication WO 92/22324; Mullinax et al., BioTechniques, 12(6):864-869, 1992; and Sawai et al., AJRI, 34:26-34, 1995; and Better et al., Science, 240:1041-1043, 1988 (each of which is incorporated by reference in its entirety). Examples of techniques which can be used to produce single-chain Fvs and antibodies include those described in U.S. Pat. Nos. 4,946,778 and 5,258,498; Huston et al., Methods in Enzymology, 203:46-88, 1991; Shu et al., PNAS, 90:7995-7999, 1993; and Skerra et al., Science, 240:1038-1040, 1988.
Once an antibody molecule of the invention has been produced by any methods described above, it may then be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A or Protein G purification, and sizing column chromatography), centrifugation, differential solubility, or by any other standard techniques for the purification of proteins. Further, the antibodies of the present invention or fragments thereof may be fused to heterologous polypeptide sequences described herein or otherwise known in the art to facilitate purification.
For some uses, including in vivo use of antibodies in humans and in vitro detection assays, it may be preferable to use chimeric, humanized, or human antibodies. Chimeric antibodies and humanized antibodies are discussed in details in Section 5.3, infra.
Antibodies fused or conjugated to other compounds or heterologous polypeptides may be used in in vitro immunoassays, in purification methods (e.g., affinity chromatography), as well as in vivo therapeutic or diagnostic uses. See e.g., PCT publication Number WO 93/21232; EP 439,095; Naramura et al., Immunol. Lett., 39:91-99, 1994; U.S. Pat. No. 5,474,981; Gillies et al., PNAS, 89:1428-1432, 1992; and Fell et al., J. Immunol., 146:2446-2452, 1991, which are incorporated herein by reference in their entirety. For example, antibodies can be labeled in various ways using a known method or commercially available kit (e.g., biotin labeling, FITC labeling, APC labeling). As another example, antibodies may be conjugated to a therapeutic moiety that enhances the biological effect of the antibodies in vivo. Examples of such a therapeutic moiety include another antibody, cytotoxins that are cytostatic or cytocidal, radioactive element, and/or other therapeutic agents, including anti-inflammatory agents, antibiotics, and the like. In the present invention, the humanized anti-RGD antibody may be conjugated to another antibody to form a bispecific antibody. As another example, the humanized antibody of the present invention may be labeled with detectable markers, such as radioactive elements, for in vivo diagnostic uses.
A chimeric antibody is a molecule in which different portions of the antibody are derived from different animal species, such as antibodies having a V-region derived from a murine monoclonal antibody and a constant region derived from a human immunoglobulin. Methods for producing chimeric antibodies are known in the art. See e.g., Morrison, Science, 229:1202, 1985; Oi et al., BioTechniques, 4:214 1986; Gillies et al., J. Immunol. Methods, 125:191-202, 1989; U.S. Pat. Nos. 5,807,715; 4,816,567; and 4,816,397, which are incorporated herein by reference in their entirety.
A humanized antibody is a molecule that binds a desired antigen and comprises a V-region containing one or more CDRs derived from a non-human species and one or more FRs derived from a human immunoglobulin molecule. The typical methods for humanizing non-human antibodies have been described in various references, such as those: by Queen et al., 1989, Proc. Natl. Acad. Sci. USA 86:10029-10033 and U.S. Pat. Nos. 5,585,089 and 5,693,762; by Riechmann et al., Nature, 332:323, 1988; and by Tsurushita et al., Methods 36:69-83, 2005, all of which are incorporated herein by reference in their entirety). For example, the reference by Tsurushita et al. (2005, supra; hereafter “Tsurushita”) provides a practical and instructive protocol for the humanization of mouse monoclonal antibodies based on the antibody-humanization method originally developed by Queen et al. (1989, supra). The general protocol disclosed in Tsurushita is briefly summarized below.
5.3.1. General Protocol for Preparing Humanized Antibodies
Various methods are available for cloning cDNAs encoding the VH and the VL of a target mouse monoclonal antibody. For example, 5′ RACE (rapid amplification of cDNA ends) method using SMART RACE cDNA Amplification Kit (BD Biosciences, CA) or the GeneRacer Kit (Invitrogen, CA) has been commonly used. A gene-specific primer for 5′ RACE can be prepared based on the isotypes of the H-chain and the L-chain of the target monoclonal antibody so that it can bind immediately downstream of the VH and VL. Thus, 5′ RACE primer may be designed to be specific for each subtype in mouse, such as γ1, γ2a, γ2b or γ3. Alternatively, a common primer for all subtypes may be designed based on the consensus or highly homologous region among the subtypes. In Tsurushita, the following 5′ RACE primers are disclosed as examples:
PCR-amplified V-region gene fragments can be directly cloned into a plasmid vector, for example, using the Zero Blunt TOPO PCR Cloning Kit (Invitrogen), and their DNA sequences determined. The obtained sequences should be confirmed by, for example, comparing their encoding amino acid sequences with those of the target monoclonal antibody determined by the N-terminal amino acid sequencing, using, for example a Model 241 Protein Sequencer (Hewlett-Packard, CA). Typically, the determination of at least 15-20 amino acid residues at the N-terminus of the target antibody, for example, by Edman degradation, is sufficient to confirm the authenticity of the cloned DNA sequences. Tsurushita cautions that when glutamine, which is one of the two most common N-terminal amino acid in mouse, is the N-terminal amino acid, it might have been converted to pyroglutamine and blocks the sequencing at the N-terminus. In that case, it is necessary to deblock the N-terminus to obtain the sequence.
Based on the sequences of the VH and the VL, the framework residues of the target antibody that are potentially important for maintaining the conformational structure of the CDRs, are first identified by the method, for example, described by R. Levy et al., 1989, Biochemistry 28:7168-7175; and by B. Zilber et al., 1990, Biochemistry 29:10032-10041. Typically, each of the VH and VL is divided into 14 structurally meaningful segments, which are β strands and loop-like structures comprising the domain structure of the immunoglobulin superfamily. The amino acid sequence of each of the segments from the target antibody is aligned with the corresponding segments of antibodies of known structures, in the PDB database (see H. M. Berman et al., 2000, Nucleic Acids Res. 28:235-342). By multiple sequence alignment, a corresponding segment having the highest sequence homology to each of the target segment is selected and the three-dimensional model of the V-region is constructed. In order to optimize the structure, the model is subjected to multiple cycles of conjugate gradient energy minimization (e.g., using ENCAD, or as described by Press et al., 1990, in “Numerical Recipes, Cambridge University Press, Cambridge; AMBER by Weiner et al., 1981, J. Comp. Chem. 2:287-303; 3D-JIG-SAW available at BioMolecularModelling or “BMM” web site run by Cancer Research UK; or SWISS-MODEL available at ExPASy Proteomics Server web site run by Swiss Institute of Bioinformatics, Geneva).
In parallel with modeling the structure of the V-regions, the amino acid sequences deduced from the cDNA cloning of the mouse VH and VL, respectively, are compared to human V-region sequences in the databases, for example, the Kabat database (see Johnson et al., 2000, Nucleic Acids Res. 28:214-218.), GenBank, and so forth. Human FRs that have overall sequence identity of at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, or at least 95% identity, with the mouse sequence, can be searched using, for example, the Smith-Waterman algorithm (by Gusfield, 1997, in “Algorithms on Strings, Trees, and Sequences”, Cambridge University Press, Cambridge), or BLAST (by Karlin et al., 1990, Proc. Natl. Acad. Sci. USA 87:2264-2268), and the like. These human sequences may be based on cDNA-based and protein-derived sequences; however, the use of germline is often preferable as it may be useful in eliminating potential immunogenicity associated with somatic hypermutations in cDNA-based, protein-derived sequences. In the alternative, as described in Queen et al. (1989, supra), the use of a consensus framework sequence can also identify and remove such hypermutated residues in the framework obtained from cDNA-based or protein-derived sequences. In the case where a germline VH segment is used as an acceptor framework, VH segments encoded on chromosome 14, rather than 15 and 16, should be used as only those on chromosome 14 produce functional VH.
According to Queen et al. (1989, supra), it is necessary to identify framework amino acids within about 4-6 Å of the CDRs as these residues are considered to be potential key framework residues that support the correct CDR structures. Such a process can be achieved using a computer program, such as RASMOL available at Molecular Visualization Freeware web site supported by National Science Foundation (NSF), that calculates interatomic distances from the atomic coordinates or, through manual inspection of a computer model. If amino acids at key framework positions are different between mouse donor and human acceptor sequences, those of mouse donor usually replace the human residues. However, if such residues have minimal contribution to support the CDR structures, the corresponding human residues are typically used. Also, if the selected human acceptor contains “atypical” amino acids, which occur in less than about 10-20% of the V region sequences, they may be the result of somatic hypermutation during affinity maturation and should be replaced with the donor residues in order to avoid potential immunogenicity in humans.
In addition, other factors, such as residues of potential N-linked glycosylation signals, need to be carefully considered in order to design humanized V regions (see Tsurushita for details).
Humanized antibodies may contain a human constant region or a portion thereof from the human κ or λ L-chain, and/or the γ1, γ2, γ3, γ4, μ, α1, α2, δ, or ε H-chain of human antibodies, or variants thereof, depending on the effector functions required or to be eliminated for therapeutic uses. For example, a Fc portion of the constant region containing a mutation may be fused to the V-region of the chimeric or humanized antibody of the present invention so as to reduce the binding of the antibody to Fc receptors and/or to reduce its ability to fix complement (see, for example, Winter et al., GB 2,209,757 B; Morrison et al., WO 89/07142, Morgan et al., WO 94/29351). Such manipulations of antibody molecules can be carried out by recombinant DNA technology as described in Section 5.2.
Preferably the resulting chimeric or humanized antibody has the same specificity as the non-human donor antibody and an affinity similar to or at least about ⅓, at least about ½, or at least about ⅔, of that of the non-human donor antibody. In another aspect, the resulting chimeric or humanized antibody has an affinity constant of at least about 1×107 M−1, preferably at least about 1×108 M−1, and most preferably at least about 1×109 M−1.
In addition to the general protocol described above, antibodies can be humanized using a variety of techniques known in the art including, for example, CDR-grafting (EP 239,400; PCT publication WO 91/09967; U.S. Pat. Nos. 5,225,539; 5,530,101 and 5,585,089), veneering or resurfacing (EP 592,106; EP 519,596; Padlan, Molecular Immunology, 28(4/5):489-498, 1991; Studnicka et al., Protein Engineering, 7(6):805-814, 1994; Roguska et al., Proc Natl. Acad. Sci. USA, 91:969-973, 1994), and chain shuffling (U.S. Pat. No. 5,565,332), all of which are hereby incorporated by reference in their entirety.
5.3.2. Additional Considerations for Preparing Humanized Antibodies as Pharmaceuticals
To offer humanized antibodies as pharmaceuticals, an efficient and consistent production system therefore needs to be prepared. For example, an appropriate expression vector for humanized antibodies is prepared by inserting H-chain and L-chain sequences, and a high-productivity cell line transfected with the expression vector can be obtained as a seed cell for a master cell bank (MCB), which serves as a stable and semi-permanent source for a working cell bank (WCB). Humanized antibodies can be then prepared by culturing working cells from the WCB and collecting the culture medium.
Various expression vectors with appropriate regulatory genes can be used for the preparation of such a production cell line. As a host cell, those commonly used for expressing mammalian proteins can be used for the expression of humanized antibodies. Examples of such host cells include, but are not limited to, Chinese Hamster Ovary (CHO) cells, SP2/0-Ag14.19 cells, NSO cells, and the like. The productivity of humanized antibodies can be maximized by selecting the best combination of an expression vector and a host cell. Furthermore, the composition of culture media should be explored in order to select suitable media, from various serum-free culture media and supplements, so that the expression of humanized antibodies by the host cell can be optimized.
Based on the efficiency and the final yield, the humanized antibodies produced by the host cell can be purified from the culture supernatant using various methods well known in the art, including affinity chromatography, ion-exchange chromatography, hydrophobic interaction chromatography, and the like.
The present invention provides a pharmaceutical composition comprising the humanized antibody or an antigen-binding fragment thereof, described above, that immunospecifically recognizes the RGD sequence. The pharmaceutical composition comprising the humanized antibody of the present invention as an active ingredient can be used as an agent for preventing and/or treating a disorder or disease that is associated with RGD proteins, including, but not limited to, cancer, e.g., the growth or metastasis of cancer cells, and an inflammatory disease, e.g., rheumatoid arthritis, osteoarthritis, hepatitis, bronchial asthma, fibrosis, diabetes mellitus, arteriosclerosis, multiple sclerosis, granuloma, an inflammatory bowel disease (ulcerative colitis and Crohn's disease), an autoimmune disease, and the like.
The pharmaceutical composition comprising the humanized antibody of the present invention can also be used to treat chronic rejection after organ transplantation, and an autoimmune disease such as systemic autoimmune disease, erythematosus, uveitis, Behcet's disease, polymyositis, glomerular proliferative nephritis, sarcoidosis, and the like.
The preventive and/or therapeutic agent for preventing or treating the disorders or diseases described above, comprising the humanized antibody of the present invention, has low toxicity and can be administered to humans orally or parenterally, directly as a liquid preparation by mixing in a suitable solvent, or as a pharmaceutical composition in an appropriate dosage form.
The pharmaceutical composition used for the administration described above contains the aforesaid antibody or salts thereof and pharmaceutically acceptable carriers, diluents or excipients. Such a composition is provided in a dosage form suitable for oral or parenteral administration.
The dose may vary depending upon the age and the size of a subject to be administered, target disease, conditions, route of administration, and the like. When the antibody is used for preventing and/or treating, for example, rheumatoid arthritis in an adult patient, it is advantageous to intravenously administer the antibody of the present invention normally at a single dose of about 0.01 to about 20 mg/kg body weight, preferably about 0.1 to about 10 mg/kg body weight, and more preferably about 0.1 to about 5 mg/kg body weight, approximately 1 to 5 times per day, preferably approximately 1 to 3 times per day. In other parenteral administration and oral administration, the antibody can be administered in a dose corresponding to the dose given above. When the condition is especially severe, the dose may be increased according to the condition.
Various delivery systems are known and can be used to administer the pharmaceutical composition of the invention, e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the mutant viruses, receptor mediated endocytosis (see, e.g., Wu and Wu, 1987, J. Biol. Chem. 262:4429 4432). Methods of introduction include but are not limited to intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes. The compounds may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local. Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent.
In a specific embodiment, it may be desirable to administer the pharmaceutical compositions of the invention locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, e.g., in conjunction with a wound dressing after surgery, by injection, by means of a catheter, by means of a suppository, by means of nasal spray, or by means of an implant, said implant being of a porous, non porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers. In one embodiment, administration can be by direct injection at the site (or former site) infected tissues.
In another embodiment, the pharmaceutical composition can be delivered in a vesicle, in particular a liposome (see Langer, 1990, Science 249:1527-1533; Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid.).
In yet another embodiment, the pharmaceutical composition can be delivered in a controlled release system. In one embodiment, a pump may be used (see Langer, supra; Sefton, 1987, CRC Crit. Ref. Biomed. Eng. 14:201; Buchwald et al., 1980, Surgery 88:507; and Saudek et al., 1989, N. Engl. J. Med. 321:574). In another embodiment, polymeric materials can be used (see Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Fla. (1974); Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.), Wiley, New York (1984); Ranger and Peppas, J. Macromol. Sci. Rev. Macromol. Chem. 23:61 (1983); see also Levy et al., 1985, Science 228:190; During et al., 1989, Ann. Neurol. 25:351; Howard et al., 1989, J. Neurosurg. 71:105). In yet another embodiment, a controlled release system can be placed in proximity of the composition's target, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138 (1984)). Other controlled release systems are discussed in the review by Langer (Science 249:1527-1533 (1990)).
Examples of the composition for oral administration include solid or liquid dosage forms, specifically, tablets (including dragees and film-coated tablets), pills, granules, powdery preparations, capsules (including soft capsules), syrup, emulsions, suspensions, etc. Such a composition is manufactured by publicly known methods and contains a vehicle, a diluent or an excipient conventionally used in the field of pharmaceutical preparations. Examples of the vehicle or excipient for tablets are lactose, starch, sucrose, magnesium stearate, and the like.
The injectable preparations may include dosage forms for intravenous, subcutaneous, intracutaneous and intramuscular injections, drip infusions, etc. These injectable preparations may be prepared by methods publicly known. The injectable preparations may be prepared, e.g., by dissolving, suspending or emulsifying the antibody or its salt described above in a sterile aqueous medium or an oily medium conventionally used for injections. As the aqueous medium for injections, there are, for example, physiological saline, an isotonic solution containing glucose and other auxiliary agents, etc., which may be used in combination with an appropriate solubilizing agent such as an alcohol (e.g., ethanol), a polyalcohol (e.g., propylene glycol, polyethylene glycol), a nonionic surfactant [e.g., polysorbate 80, HCO-50 (polyoxyethylene (50 mol) adduct of hydrogenated castor oil)], etc. As the oily medium, there are employed, e.g., sesame oil, soybean oil, etc., which may be used in combination with a solubilizing agent such as benzyl benzoate, benzyl alcohol, etc. The injection thus prepared is preferably filled in an appropriate ampoule. The suppository used for rectal administration may be prepared by blending the aforesaid antibody or its salt with conventional bases for suppositories.
Advantageously, the pharmaceutical compositions for oral or parenteral use described above are prepared into dosage forms in a unit dose suited to fit a dose of the active ingredients. Such dosage forms in a unit dose include, for example, tablets, pills, capsules, injections (ampoules), suppositories, etc. The amount of the aforesaid antibody contained is generally about 5 to 500 mg per dosage form in a unit dose; especially in the form of injection, it is preferred that the aforesaid antibody is contained in about 5 to 100 mg and in about 10 to 250 mg for the other dosage forms.
Each composition described above may further contain other active components unless formulation causes any adverse interaction with the antibodies described above.
The present invention also relates to an inhibitor and/or promoter for cell and/or tissue remodeling, which comprises an RGD sequence-binding functional molecule (e.g., integrins, etc.) as an active ingredient; and a method for inhibiting and/or promoting cell and/or tissue remodeling, which comprises contacting the RGD protein expressing cell and/or tissue (e.g., a tumor cell, neutrophil, smooth muscle, etc.) with the RGD protein binding functional molecule. The dose, method for administration, pharmaceutical preparation, etc. of the active ingredient in such a therapeutic agent can be appropriately determined by referring to the foregoing description of medicaments comprising the humanized antibodies of the present invention.
As described above, the present invention further provides a method for preventing or treating a disorder or disease that is associated with or involves RGD proteins, said method comprising administering an effective amount of at least one of the humanized antibodies of the present invention to a subject in need thereof.
The pharmaceutical composition comprising the humanized antibody of the present invention can be used as a diagnostic agent for cancer, (e.g., the growth or metastasis of cancer cells) and/or an inflammatory disease (e.g., rheumatoid arthritis, osteoarthritis, hepatitis, bronchial asthma, fibrosis, diabetes mellitus, arteriosclerosis, multiple sclerosis, granuloma, etc.), or as a diagnostic agent for chronic rejection after organ transplantation, an autoimmune disease such as systemic autoimmune disease, erythematosus, uveitis, Behcet's disease, polymyositis, glomerular proliferative nephritis, sarcoidosis, and so forth. The humanized antibodies of the present invention are capable of specifically recognizing the RGD sequence and hence can be used to quantify the RGD proteins in a test fluid, especially for quantification by the sandwich immunoassay, competitive assay, immunometry, nephrometry, etc., immunostaining, or the like. In applying these immunological methods to the assay methods of the present invention, it is not required to set forth any particular conditions, procedures, etc. It is sufficient to construct assay systems by adding ordinary technical consideration in the art to conventional conditions and procedures. For details of these general technical means, reference can be made to reviews, texts or the like.
As described above, the RGD proteins may be quantified with high sensitivity by using the antibodies of the present invention. The humanized antibodies of the present inventions are particularly useful for diagnosing various diseases associated with the RGD proteins by applying the method for quantifying the RGD proteins in vivo. For instance, where an increase or decrease in the expression level of the RGD proteins is detected, it can be diagnosed that it is highly likely that one now suffers from diseases associated with the RGD protein, e.g., cancer or an inflammatory disease, or it is highly likely that one will suffer from these diseases in the future. Thus, the present invention also provides a method for diagnosing a disorder or disease associated with or involve the RGD proteins in a subject, said method comprising administering an effective amount of at least one of the humanized antibodies of the present invention or both to a subject in need thereof. Required dosages for such an in vivo diagnosis may be less than those required for therapeutic uses and can be determined by one skilled in the art according to routine procedures.
The humanized antibodies of the present invention can also be used for specifically detecting the RGD proteins present in a test fluid such as a body fluid, a tissue, etc. The humanized antibodies can also be used for preparation of antibody columns for purification of the RGD proteins, for detection of the RGD proteins contained in each fraction upon purification or for analysis of behaviors of the RGD proteins in cells to be tested.
The following examples illustrate preparation of monoclonal antibodies that immunospecifically recognize the RGD sequence, sequencing of the V-regions of the monoclonal antibodies, epitope mapping and other characterization of the antibodies and chimerization and the humanization of such antibodies, as well as the characterization of the resulting chimeric and humanized antibodies. These examples should not be construed as limiting the scope of the invention.
Mouse monoclonal antibodies against the RGD sequence were prepared according to the subtractive immunization method (by Williams C. V., et al., 1992, Biotechniques 12:842-847). Antigen was prepared as a synthetic peptide of an amino acid sequence CVDVPNGRGDSLAYGLR (SEQ ID NO:71) which includes the RGD sequence and an amino acid sequence SLAYGLR (SEQ ID NO:72) which are cell adhesive sequence of ECM protein. The antigen peptide was coupled to thyroglobulin via EMCS (Dojin), which was immunized to mice as antigen with adjuvant. Hybridomas were prepared by the methods well known in the art (see, for example, Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling, et al., in: Monoclonal Antibodies and T-Cell Hybridomas, pp. 563-681 (Elsevier, N.Y., 1981). After 4 times immunization, splenic cells were collected and fused with myeloma cell X63-Ag8-653. Then hybridoma clones producing monoclonal antibodies that were immunospecifically reactive with RGD sequence were selected by using HAT medium and by screening of culture supernatant with ELISA (antigen peptide solid phase). Eight hybridoma clones 4P11, 11M6, 25H15, 29R5, 30C17, 33E10, 35B6 and 38I8 were established as hybridoma clones producing monoclonal antibodies immunospecifically recognizing RGD sequence were isolated. Antibodies were purified form supernatant of the hybridoma by using antigen peptide column prepared by using thiol sepharose beads (Amasham Bioscience).
Peptides of amino acid sequence of CLPVKTDSGSSEEKLY (mOPN1) (SEQ ID NO:73), CVDVPNGRGDSLAYGLR (mOPN5) (SEQ ID NO:71), CVDVPNGRGDS (SEQ ID NO:74), CPNGRGD (SEQ ID NO:75), CGRGDSLAYGLR (SEQ ID NO: 76) CGDSLAYG (SEQ ID NO: 77), CGDSLAUGLR (SEQ ID NO:78) and CSLAYGLR (SEQ ID NO:72) which include murine OPN derived partial peptide, a peptide of amino acid sequence CVDTYDGRGDSVVYGLRS (SEQ ID NO:79) and CSVVYGLR (SEQ ID NO:80) which include human OPN derived partial peptide, and a peptide of amino acid sequence CGRGDS (SEQ ID NO:81) which include common peptide sequence of human OPN and murine OPN were coupled to BSA (Sigma corporation) via EMCS (Dojin) and used for ELISA.
A 96 well plate was immobilized with peptides (10 μg/ml) or proteins (5 μg/ml) by cultivating at 37° C. for an hour, blocked with 0.1% BSA/PBS/0.05% NaN3 solution, and then reacted with various concentrations of antibodies at 37° C. for an hour. Next, the plate was reacted with HRP labeled anti-murine IgG antibody (Jackson ImmunoResearch Laboratories, Inc.) as secondary antibody at 37° C. for 30 minutes, added OPD as chromogen, added 1N H2SO4 to stop the reaction, and then detected absorbance at 490 nm.
As shown in
The amino acid sequences of CDRs of monoclonal antibodies 33E10 and 35B6 were determined by following procedures. RNAs were extracted using RNeasy Mini kit (Qiagen) from the corresponding hybridomas and cDNAs were prepared using First-strand cDNA synthesis kit. H-chain cDNA of the antibody was extended by PCR using Heavy primer amplification kit (Amasham Bioscience), cloned into pCRII-TOPO vector (invitrogen), and then the cDNA sequence and the amino acid sequence were determined. The CDR was determined by ABG: Directory of 3D structures of antibodies (http://www.ibt.unam.mx/vir/structure/structures.html). The CDRs of V-chain and L-chain are as follows (also shown in
In the present example, CDRs were determined by ABG. However, it is well known in the art that other programs may be used for determining the CDRs and may result in different sequences to some extent.
Each of a human OPN (hOPN) or a murine OPN (mOPN) was purified from culture supernatant of CHO-K1 cells introduced hOPN gene or mOPN gene respectively by using anti-OPN antibody column. A human vitronectin (hereinafter abbreviated as “VN”) was obtained by AGC TECHNO GLASS Co., Ltd. A human fibronectin (hereinafter abbreviated as “FN”), human thrombospondin and murine laminin were obtained from Sigma Corporation.
Binding ability of the monoclonal antibodies 33E10 and 35B6 to ECM proteins was detected by ELISA using 96 well plate immobilized with hOPN, mOPN, FN, VN or laminin obtained above. A 96 well plate was immobilized with peptides (10 μg/ml) or proteins (5 μg/ml) by cultivating at 37° C. for an hour, blocked with 0.1% BSA/PBS/0.05% NaN3 solution, and then reacted with various concentrations of antibodies at 37° C. for an hour. Next, the plate was reacted with HRP labeled anti-murine IgG antibody (Jackson ImmunoResearch Laboratories, Inc.) as secondary antibody at 37° C. for 30 minutes, added OPD as chromogen, added 1N H2SO4 to stop the reaction, and then detected absorbance at 490 nm.
The result was shown in
Since it is known that cell adhesion involves the binding of the RGD peptide to its ligands, i.e., integrins and the like, the isolated anti-RGD antibodies were examined for their cell adhesion inhibitory activity. Each of a human OPN (hOPN) or a murine OPN (mOPN) was purified from culture supernatant of CHO-K1 cells introduced hOPN gene or mOPN gene respectively by using anti-OPN antibody column. N-half of mOPN was purified as a Glutathione S-transferase (GST) fusion protein with N-terminal portion of thrombin cleaved mOPN by isolating from Escherichia coli. A human FN and a human VN were obtained from Sigma Corporation.
50 μl of the proteins was added to each well of 96-well plate, incubated at 37° C. for 1 hour and immobilized onto the plate. After blocking the plate with a blocking solution (0.5% BSA/PBS) and washing with PBS once, the NIH3T3 cells suspended in 0.25% BSA-Minimum Essential Media (MEM) and the isolated monoclonal antibodies were mixed at final concentration of 1.0×105 cells/ml, and added to the plate at 200 μl/well and incubated at 37° C. for 1 hour under 5% CO2. Non-adherent cells were rinsed off with PBS and adherent cells were fixed and stained with 0.5% Crystal Violet (by WAKO, Osaka, Japan)/20% methanol. The stained cells were allowed to stand at room temperature for 30 minutes. The plate was washed with distilled water and 20% acetic acid solution was added thereto to effect dissolution. The adhesion activity was quantified by measuring OD at 590 nm.
A mixture of NIH3T3 cells and monoclonal antibody 33E10 or 35B6 was added to 96-well plates immobilized mOPN N-half and examined the effect of antibody on binding of NIH3T3 cells to mOPN N-half. A mixture of NIH3T3 cells and monoclonal antibody 33E10 was added to 96-well plates each immobilized mOPN N-half, FN or VN, and examined the effect of antibody on binding of NIH3T3 cells to each protein.
As shown
Therapeutic effects of anti-RGD antibodies were examined in a mouse system. The anti-RGD monoclonal antibodies (4P11, 11M6, 29R5, 30C7, 38I8, 33E10 and 35B6) were prepared substantially in the same manner as described for anti-RGD antibodies (see Section 6.1, supra).
6.6.1. Therapeutic Effect on Hepatitis
WO 02/081522 discloses that hepatitis can be treated by inhibiting the OPN functions. Accordingly, therapeutic effects of anti-RGD antibodies were studied in a mouse hepatitis model using mouse anti-RGD antibodies (4P11, 11M6, 29R5, 30C7, 38I8, 33E10 and 35B6). The blood AST and ALT levels in the mice (5 mice per group) were measured using GPT/ALT-PIII and GOT/AST-PIII (Fuji Film) 12 hours after an intravenous injection of 200 μg of concanavalin A (Con A) (Vector). Three hours before the Con A injection, 200 μg of the antibody were administered. A murine IgG was used as a control antibody.
As shown in
6.6.2. Effect of Anti-RGD Antibodies on Metastasis of Mouse Cancer Cell Line
Effect of anti-RGD antibodies on metastasis was studied in mouse experimental model and spontaneous model of pulmonary metastasis.
In the experimental model, murine melanoma cell line B16-Luc cells (1×105 cells/mouse) mixed with 400 μg/mouse of monoclonal antibodies were injected in tail vein of C57BL/6 mice, and 14 days after injection, number of pulmonary metastasis was counted. Antibodies of the same class (mIgG1) were used as controls.
In the spontaneous model, murine melanoma cell line B16-BL6 cells (4×105 cells/mouse) were subcutaneously injected into the left footpad of C57BL/6 mice. 19 days after injection, original tumor was surgically resected, and 14 days after resection (33 days after injection of B16-BL6 cells), number of tumor colonies in lung from sacrificed mice were counted. 200 μg/mouse of monoclonal antibodies were intraperitoneally administered 8 times at 3, 5, 7, 9, 11, 13, 15 and 17 days after injection of tumor cells. Size of original tumor was measured until surgical resection. 14 days after the surgical resection, number of tumor colonies in lung was counted. Antibodies of the same class (mIgG1) were used as controls.
The result of the mouse experimental model is shown in
6.6.3. Therapeutic Effect of Anti-RGD Antibody in Mouse Rheumatoid Arthritis Model
Rheumatoid arthritis was induced to mice using cocktail of type II collagen-specific monoclonal antibody (IBL, Japan) according to the supplier's protocol. Namely, mice (Balb/c) were injected cocktail of type II collagen-specific monoclonal antibody, after 3 days of injection LPS was injected to develop rheumatoid arthritis. Anti-RGD monoclonal antibodies or normal hamster IgG (NHG) were administered intraperitoneally total of 8 times at 200 μg/mouse/day from one day before the collagen antibody injection until 6 days after the of the collagen antibody injection. The mice were observed everyday from the day of the collagen antibody injection and the levels of arthritis were scored by grading each paw from 0-4 based on erythema and swelling of the joint (0=no erythma or swelling; 1=erythma or swelling of one small joint such as toe; 2=erythema or swelling of two or more of small joint or erythema or swelling of larger joint such as wrist or ankle; 3=erythma or swelling of the entire paw; 4=complete erythma or swelling of the entire paw; maximum score of one mouse (4 paws) is 16).
The result is shown in
6.6.4. Therapeutic Effect of Anti-RGD Antibody in Mouse Endometriosis Model
The symptom of endometriosis indicates the cyst formation, an inflammation in the surrounded stroma, smooth muscle metaplasia, neuropoiesis and angiogenesis by heterotopic growth of the endometrial epithelium. It was reported that osteopontin (OPN) is highly expressed in human endometriosis and rat endometriosis model, by the immuno-histochemical method. Therefore, the therapeutic effect on the animal model by anti-RGD antibody (33E10) was investigated as a new therapy to endometriosis.
C57BL/6J female mice (9 weeks) were used. Eighteen mice ware prepared the endometriosis model. The right uterus was removed, and auto-transplanted 2 pieces of 2 mm×2 mm square of the uterus to abdomen. The left uterus was not treated for reference. Mouse anti-RGD antibody (500 μg/head, ip) was given to 9 mice (Treated group), twice a week for 4 weeks (8 times administration, total administration amount: 4000 μg/head). Control group (9 mice) was not administrated with antibody. After administration, the number of the formed cyst was checked, and the pathological change was observed by histology.
The results were shown in TABLE 1. There were no differences in the weight in the two groups. The number of appeared endometriosis of the treated group was markedly reduced than of the control group. The weight of the formed cyst decreased clearly with about ⅓ by an average by treated group more than control group. It could be confirmed that the OPN expression in the endometrial epithelium was suppressed by antibody treatment by immuno-histochemical study. The thickness of the smooth muscle in the stroma of treated group decreased in ½ more than control group.
The therapeutic effect of the mice endometriosis model was indicated by the anti-RGD antibody administration.
1)p = 0.0437
2)p = 0.0144
3)p = 0.0787
6.7.1. Cloning and Sequencing of Mouse 33E10 Variable Region Genes
Mouse 33E10 hybridoma cells were grown in TIL Media I (Immuno-Biological Laboratories, Gunma, Japan) containing 10% fetal bovine serum (FBS; HyClone, Logan, Utah) at 37° C. in a 7.5% CO2 incubator. Total RNA was extracted from approximately 3×106 hybridoma cells using TRIzol reagent (Invitrogen, Carlsbad, Calif.) according to the supplier's protocol. Oligo dT-primed cDNA was synthesized using the GeneRacer Kit (Invitrogen) following the supplier's protocol. The variable region cDNAs for 35B6 heavy and light chains were amplified by polymerase chain reaction (PCR) with Phusion DNA polymerase (New England Biolabs, Beverly, Mass.) using 3′ primers that anneal respectively to the mouse gamma-1 and kappa chain constant regions, and a GeneRacer 5′ primer (5′-CGACTGGAGCACGAGGACACTGA-3′) (SEQ ID NO:84) provided in the GeneRacer Kit. For PCR amplification of VH, the 3′ primer has the sequence 5′-GCCAGTGGATAGACAGATGG-3′ (SEQ ID NO:85). For PCR amplification of VL, the 3′ primer has the sequence 5′-GATGGATACAGTTGGTGCAGC-3′ (SEQ ID NO:86). The amplified VH and VL cDNAs were cloned into the pCR4Blunt-TOPO vector (Invitrogen) for sequence determination. DNA sequencing of the variable regions was carried out at Tocore (Menlo Park, Calif.). Several heavy and light chain clones were sequenced and unique sequences homologous to typical mouse heavy and light chain variable regions were identified. The consensus cDNA sequences along with deduced amino acid sequences of 33E10 VH and VL are shown in
6.7.2. Construction of Chimeric 33E10 IgG1/κ Antibody
A gene encoding 33E10 VH was generated as an exon including a splice donor signal and appropriate flanking restriction enzyme sites by PCR using 33E10 VH cDNA as a template, 5′-GGGACTAGTACCACCATGAAGTTGTGGCTGAACTGGATT-3′ (SpeI site is underlined) (SEQ ID NO:87) as a 5′ primer, and 5′-GGGAAGCTTGAAGTTAGGACTCACCTGCAGAGACAGTGACCAGAGTCCC-3′ (HindIII site is underlined) (SEQ ID NO:88) as a 3′ primer (
6.7.3. Generation of Humanized 33E10 VH and VL Genes
Humanization of the 33E10 variable regions was carried out as outlined by Queen et al. (Proc. Natl. Acad. Sci. USA 86: 10029-10033, 1989). First, a molecular model of the 33E10 variable regions was constructed with the aid of computer programs. Next, based on a homology search against human variable region sequences, the human amino acid sequence of U03400 (GenBank accession number), which has a high homology to 33E10 VH, was chosen as an acceptor to provide the frameworks for humanized 33E10 VH. Likewise, the human amino acid sequence of X72452 (GenBank accession number) was chosen as an acceptor for humanization of 33E10 VL.
At framework positions where the computer model suggested significant contact with the CDRs, the amino acids from the mouse 33E10 variable regions were substituted for the human framework amino acids. This was done at positions 30 and 48 to generate humanized 33E10 (Hu33E10) VH (
A gene encoding each of Hu33E10 VH and VL was designed as an exon including a signal peptide, a splice donor signal, and appropriate restriction enzyme sites for subsequent cloning into a mammalian expression vector. The splice donor signals of the Hu33E10 VH and VL exons were derived from the human germline JH4 and Jκ1 sequences, respectively. The signal peptide sequence of the mouse 33E10 VL gene was indicated to be suboptimal for precise cleavage by the SIG-Pred signal peptide prediction software (http://bmbpcu36.leeds.ac.uk/prot_analysis/Signal.html). Therefore, the signal peptide of the VL gene of the mouse monoclonal antibody 35B6 (Gene Techno Science), which was predicted to be cleaved efficiently and precisely by the SIG-Pred software, was used in the Hu33E10 VL exon. The signal peptide sequence in the Hu33E10 VH exon was derived from the corresponding mouse 33E10 VH sequence. The SIG-Pred software indicated that the signal peptide of the Hu33E10 VH gene is cleaved efficiently and precisely.
The Hu33E10 VH and VL genes were constructed by extension and PCR amplification of several overlapping synthetic oligonucleotide primers (SEQ ID NOS:91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122 and 123) using Phusion DNA polymerase as outlined by He et al. (J. Immunol. 160: 1029-1035, 1998). The oligonucleotides used for construction of Hu33E10 VH and VL genes are listed in
6.7.4. Transient Expression of Chimeric and Humanized 33E10 IgG1/κ
Chimeric and humanized 33E10 IgG1/κ antibodies are transiently expressed by transfecting pCh35B6 and pHu35B6 plasmid DNA, respectively, to HEK293 cells using polyethylenimine according to Durocher et al. (Nucl. Acids Res. 30: e9, 2002). Transiently transfected HEK293 cells are maintained for two days in DMEM containing 10% FBS at 37° C. in a 7.5% CO2 incubator. The expression level of each of Ch33E10 and Hu33E10 IgG1/κ antibodies in culture supernatant is measured by sandwich ELISA. An ELISA plate is coated overnight at 4° C. with 100 μl/well of 1/2,000-diluted goat anti-human IgG Fcγ-chain-specific polyclonal antibody (SouthernBiotech, Birmingham, Ala.) in PBS, washed with Wash Buffer (PBS containing 0.05% Tween 20), and blocked for 1 hr at room temperature with 300 μl/well of Blocking Buffer (PBS containing 2% Skim Milk and 0.05% Tween 20). After washing with Wash Buffer, 100 μl/well of samples appropriately diluted in ELISA Buffer (PBS containing 1% Skim Milk and 0.025% Tween 20) are applied to the ELISA plate. Human IgG1/κ antibody purified from human myeloma serum (SouthernBiotech) is used as a standard. After incubating the ELISA plate for 2 hr at room temperature and washing with Wash Buffer, bound antibodies are detected using 100 μl/well of 1/2,000-diluted HRP-conjugated goat anti-human kappa chain polyclonal antibody (SouthernBiotech). After incubating for 1 hr at room temperature and washing with Wash Buffer, color development is performed by adding 100 μl/well of ABTS substrate (bioWORLD, Dublin, Ohio). Color development is stopped by adding 100 μl/well of 2% oxalic acid. Absorbance is read at 405 nm.
6.7.5. Characterization of Humanized 35B6
The affinity of humanized 35B6 IgG1/κ is compared to that of chimeric 33E10 IgG1/κ by ELISA. As an antigen, synthetic oligopeptide (Cys-Val-Asp-Thr-Tyr-Asp-Gly-Arg-Gly-Asp-Ser-Val-Val-Tyr-Gly-Leu-Arg-Ser) conjugated to bovine serum albumin (hOPN5-BSA) is used. In a typical experiment, an ELISA plate is coated with 100 μl/well of 1 μg/ml hOPN-BSA in PBS overnight at 4° C., washed with Wash Buffer, and blocked with 300 μl/well of Blocking Buffer for 1 hr at room temperature. After washing with Wash Buffer, 100 μl/well of samples appropriately diluted in ELISA Buffer are applied to the ELISA plate. After incubating the ELISA plate overnight at 4° C. and washing with Wash Buffer, bound antibodies are detected using 100 μl/well of 1/2,000-diluted HRP-conjugated goat anti-human γ chain polyclonal antibody (SouthernBiotech). After incubating for 1 hr at room temperature and washing with Wash Buffer, color development is performed by adding 100 μl/well of ABTS substrate and stopped with 100 μl/well of 2% oxalic acid. Absorbance is read at 405 nm.
6.7.6. Cloning and Sequencing of Mouse 35B6 Variable Region Genes
Mouse 35B6 hybridoma cells were grown in TIL Media I (Immuno-Biological Laboratories, Gunma, Japan) containing 10% fetal bovine serum (FBS; HyClone, Logan, Utah) at 37° C. in a 7.5% CO2 incubator. Total RNA was extracted from approximately 3×106 hybridoma cells using TRIzol reagent (Invitrogen, Carlsbad, Calif.) according to the supplier's protocol. Oligo dT-primed cDNA was synthesized using the GeneRacer Kit (Invitrogen) following the supplier's protocol. The variable region cDNAs for 35B6 heavy and light chains were amplified by polymerase chain reaction (PCR) with Phusion DNA polymerase (New England Biolabs, Beverly, Mass.) using 3′ primers that anneal respectively to the mouse gamma-1 and kappa chain constant regions, and a GeneRacer 5′ primer (5′-CGACTGGAGCACGAGGACACTGA-3′) (SEQ ID NO:84) provided in the GeneRacer Kit. For PCR amplification of VH, the 3′ primer has the sequence 5′-GCCAGTGGATAGACAGATGG-3′ (SEQ ID NO:124). For PCR amplification of VL, the 3′ primer has the sequence 5′-GATGGATACAGTTGGTGCAGC-3′ (SEQ ID NO:125). The amplified VH and VL cDNAs were cloned into the pCR4Blunt-TOPO vector (Invitrogen) for sequence determination. DNA sequencing of the variable regions was carried out at Tocore (Menlo Park, Calif.). Several heavy and light chain clones were sequenced and unique sequences homologous to typical mouse heavy and light chain variable regions were identified. The consensus cDNA sequences along with deduced amino acid sequences of 35B6 VH and VL are shown in
6.7.7. Construction of Chimeric 35B6 IgG1/κ Antibody
A gene encoding 35B6 VH was generated as an exon including a splice donor signal and appropriate flanking restriction enzyme sites by PCR using 35B6 VH cDNA as a template, 5′-GGGACTAGTACCACCATGGGATGGAGCTGTATCCTC-3′ (SpeI site is underlined) (SEQ ID NO:126) as a 5′ primer, and 5′-GGGAAGCTTAAAAAAAGCCAGCTTACCTGAGGAGACGGTGACCGTGGTCCC-3′ (HindIII site is underlined) (SEQ ID NO:127) as a 3′ primer (
6.7.8. Generation of Humanized 35B6 VH and VL Genes
Humanization of the 35B6 variable regions was carried out as outlined by Queen et al. (Proc. Natl. Acad. Sci. USA 86: 10029-10033, 1989). First, a molecular model of the 35B6 variable regions was constructed with the aid of computer programs. Next, based on a homology search against human variable region sequences, the human amino acid sequence of Z47230 (GenBank accession number), which has a high homology to 35B6 VH, was chosen as an acceptor to provide the frameworks for humanized 35B6 VH. Likewise, the human amino acid sequence of X72479 (GenBank accession number) was chosen as an acceptor for humanization of 35B6 VL.
At framework positions where the computer model suggested significant contact with the CDRs, the amino acids from the mouse 35B6 variable regions were substituted for the human framework amino acids. This was done at positions 48, 66, 67, 68, 69 and 71 to generate humanized 35B6 (Hu35B6) VH (
A gene encoding each of Hu35B6 VH and VL was designed as an exon including a signal peptide, a splice donor signal, and appropriate restriction enzyme sites for subsequent cloning into a mammalian expression vector. The splice donor signals of the Hu35B6 VH and VL exons were derived from the human germline JH6 and Jκ1 sequences, respectively. The signal peptide sequence of the mouse 35B6 VH gene was indicated to be suboptimal for precise cleavage by the SIG-Pred signal peptide prediction software (http://bmbpcu36.leeds.ac.uk/prot_analysis/Signal.html). Therefore, the signal peptide of the VH gene of the mouse monoclonal antibody 33E10 (Gene Techno Science), which was predicted to be cleaved efficiently and precisely by the SIG-Pred software, was used in the Hu35B6 VH exon. The signal peptide sequence in the humanized Hu35B6 VL exon was derived from the corresponding mouse 35B6 VL sequence. The SIG-Pred software indicated that the signal peptide of the Hu35B6 VL gene is cleaved efficiently and precisely.
The Hu35B6 VH and VL genes were constructed by extension and PCR amplification of several overlapping synthetic oligonucleotide primers (SEQ ID NOS:91, 92, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 107, 108, 144, 145, 146, 147, 148, 149,150, 151, 152, 153, 154 and 155) using Phusion DNA polymerase as outlined by He et al. (J. Immunol. 160: 1029-1035, 1998). The oligonucleotides used for construction of Hu35B6 VH and VL genes are listed in
6.7.9. Transient Expression of Chimeric and Humanized 35B6 IgG1/κ
Chimeric and humanized 35B6 IgG1/κ antibodies were transiently expressed by transfecting pCh35B6 and pHu35B6 plasmid DNA, respectively, to HEK293 cells using polyethylenimine according to Durocher et al. (Nucl. Acids Res. 30: e9, 2002). Transiently transfected HEK293 cells were maintained for two days in DMEM containing 10% FBS at 37° C. in a 7.5% CO2 incubator. The expression level of each of Ch35B6 and Hu35B6 IgG1/κ antibodies in culture supernatant was measured by sandwich ELISA. An ELISA plate was coated overnight at 4° C. with 100 μl/well of 1/2,000-diluted goat anti-human IgG Fcγ-chain-specific polyclonal antibody (SouthernBiotech, Birmingham, Ala.) in PBS, washed with Wash Buffer (PBS containing 0.05% Tween 20), and blocked for 1 hr at room temperature with 300 μl/well of Blocking Buffer (PBS containing 2% Skim Milk and 0.05% Tween 20). After washing with Wash Buffer, 100 μl/well of samples appropriately diluted in ELISA Buffer (PBS containing 1% Skim Milk and 0.025% Tween 20) were applied to the ELISA plate. Human IgG1/κ antibody purified from human myeloma serum (SouthernBiotech) was used as a standard. After incubating the ELISA plate for 2 hr at room temperature and washing with Wash Buffer, bound antibodies were detected using 100 μl/well of 1/2,000-diluted HRP-conjugated goat anti-human kappa chain polyclonal antibody (SouthernBiotech). After incubating for 1 hr at room temperature and washing with Wash Buffer, color development was performed by adding 100 μl/well of ABTS substrate (bioWORLD, Dublin, Ohio). Color development was stopped by adding 100 μl/well of 2% oxalic acid. Absorbance was read at 405 nm.
6.7.10. Characterization of Humanized 35B6
The affinity of humanized 35B6 IgG1/κ was compared to that of chimeric 35B6 IgG1/κ by ELISA. As an antigen, synthetic oligopeptide (Cys-Val-Asp-Thr-Tyr-Asp-Gly-Arg-Gly-Asp-Ser-Val-Val-Tyr-Gly-Leu-Arg-Ser) (SEQ ID NO:79) conjugated to bovine serum albumin (hOPN5-BSA) was used. In a typical experiment, an ELISA plate was coated with 100 μl/well of 1 μg/ml hOPN-BSA in PBS overnight at 4° C., washed with Wash Buffer, and blocked with 300 μl/well of Blocking Buffer for 1 hr at room temperature. After washing with Wash Buffer, 100 μl/well of samples appropriately diluted in ELISA Buffer were applied to the ELISA plate. After incubating the ELISA plate overnight at 4° C. and washing with Wash Buffer, bound antibodies were detected using 100 μl/well of 1/2,000-diluted HRP-conjugated goat anti-human γ chain polyclonal antibody (SouthernBiotech). After incubating for 1 hr at room temperature and washing with Wash Buffer, color development was performed by adding 100 μl/well of ABTS substrate and stopped with 100 μl/well of 2% oxalic acid. Absorbance was read at 405 nm. As shown in
The hybridomas designated herein as 33E10 and 35B6 producing mouse anti-RGD monoclonal antibodies were deposited on Oct. 27, 2005 with International Patent Organisms Depository, National Institute of Advanced Industrial Science and Technology, located at Central 6, 1-1-1 Higashi, Tsukuba, Ibaraki (postal code: 305-8566) in accordance with the Budapest Treaty on the Deposit of Microorganisms, and accorded Accession Nos. FERM BP-10440 and FERM BP-10441, respectively, all of which are incorporated herein by reference in their entirety.
The humanized monoclonal antibodies of the present invention inhibit the function of RGD proteins to exhibit therapeutic effects on cancer, e.g., the growth or metastasis of cancer cells, and an inflammatory disease, e.g., rheumatoid arthritis, osteoarthritis, hepatitis, bronchial asthma, fibrosis, diabetes mellitus, arteriosclerosis, multiple sclerosis, granuloma, an inflammatory bowel disease (ulcerative colitis and Crohn's disease), an autoimmune disease, and the like. The pharmaceutical composition comprising both the anti-RGD antibody and anti-integrin antibody of the present invention exerts more improved therapeutic effects on cancer and an inflammatory disease.
The sequences referenced throughout the specification are summarized below.
MKLWLNWIFLVTLLNGFQC
MRTPAQFLGILLLWFPGIKC
MKLWLNWIFLVTLLNGFQC
MRTPAQFLGILLLWFPGIKC
EVKLVESGGGLVQPGGSLSLSCAASGFTFTDYYMI
MKLWLNWIFLVTLLNGFQC
MKLPVRLLVLMFWIPASSS
TAACTTCAAGCTT
MKLWLNWIFLVTLLNGFQCEVKLVESGGGLVQPGG
MKLWLNWIFLVTLLNGFQC
AAGAATTC
MKLPVRLLVLMFWIPASSSDVLMTQTPLSLPVSLG
MKLPVRLLVLMFWIPASSS
ATGGGCTTTCCAAGCTTCCC
GGCTTTCCAAGCTT
AATTTAAAGAATTCCCC
TTAAAGAATTC
MGWSCIILFLVAAATGVHS
MRTPAQFLGILLLWFPGIKC
GCTTTTTTAAGCTT
MGWSCIILFLVAAATGVHSQVQLQQPGTELVKPGA
MGWSCIILFLVAAATGVHS
MRTPAQFLGILLLWFPGIKCDIKMTQSPSSMYASL
MRTPAQFLGILLLWFPGIKC
AATGGCCACTCAAGCTTCCC
GGCCACTCAAGCTT
CC
| Filing Document | Filing Date | Country | Kind | 371c Date |
|---|---|---|---|---|
| PCT/JP2009/058604 | 4/24/2009 | WO | 00 | 1/3/2011 |
| Number | Date | Country | |
|---|---|---|---|
| 61047604 | Apr 2008 | US |
