Patent Application
20250059273
A Sequence Listing is provided herewith as an xml file, “2294888.xml” created on Dec. 15, 2022 and having a size of 58,555 bytes. The content of the xml file is incorporated by reference herein in its entirety.
Traumatic blunt force injuries can directly injure and sensitize the trigeminal nerve innervating the head, dura, and tooth sockets, or other nerves such as the sciatic nerve in the leg. A serious consequence of nerve injury pain or “neuropathic pain” injuries is that some can transition from acute to chronic pain. The persisting nerve injury can generate additional mechanisms centrally in the nervous system, creating nerve overactivation and molecular alterations along the brain's pain circuitry, referred to as “central sensitization”. Chronic pain is comorbid in 70% of patients with Traumatic Brain Injury (TBI) in part due to direct peripheral nerve damage. Likewise, 22% of non-battle blunt force trauma nerve injuries sustained to head, face, and neck are most often due to motor vehicle accidents.
The disclosure provides a humanized non-opioid antibody, e.g., a small antibody, therapy for, for example, chronic pain, e.g., induced by inflammatory and/or nerve injury. A panel of small murine single-chain variable fragment (scFv) antibodies recognizing an extracellular peptide of P2X4 (P2X4 is a subtype of ionotropic ATP receptors; also referred to as P2X4R) were generated with cell-free ribosome display technology. The scFv antibodies feature binding activity similar to monoclonal antibodies but with stronger affinity and increased tissue penetrability due to their smaller size.
Based on the success of the murine parent scFv95, a panel of nine humanized scFv (humansCFv) against an extracellular fragment of human P2X4 (based on scFv95) was generated using E. coli/CHO transient production and His-Tag protein/Protein L purification. Affinity measurement by ELISA indicates binding affinity in the nanomolar range. In vivo validation in nerve injury and inflammatory models found reversal of pain related behaviors within two weeks after a single dose (4 mg/kg, intraperitoneal). This constitutes a method whereby reversal of nerve injury can be accomplished by providing treatment with a humanized scFv, e.g., to reverse the effect of injury on the ion channel P2X4 that promotes a cascade of events culminating in chronic pain. In addition, the humanized hP2X4R scFv prevented the development of anxiety- and depression-like behaviors typical in week 8 in the untreated mice with persisting pain-like behaviors in the chronic pain model. Likewise, inflammatory mediators remaining in the chronic pain model in week 10 (IL-6, CD54) were decreased in animals treated with the hP2X4R scFv.
In one embodiment, the scFVs, which bind to, e.g., inhibit or block, the P2X4 receptor (P2X4R), can relieve pain- or anxiety-related behavior, and/or return neuronal firing to baseline while reducing inflammatory mediators, e.g., in chronic pain mouse models, and so can be employed to prevent, inhibit or treat neuropathic pain, nerve injury, e.g., of the trigeminal or sciatic nerve, hypersensitivity, allodynia, anxiety, or depression in a mammal.
In one embodiment, a composition comprising an anti-human P2X4R antibody, or an antigen binding fragment thereof, or a polypeptide, that prevents or inhibits human P2X4 activity is provided, where the antibody, the antigen binding fragment thereof, or the polypeptide has a variable immunoglobulin (Ig) region comprising at least one of GFTFTDYY (SEQ ID NO:1), IRNKANGYTT (SEQ ID NO:2), ARWEGDLLYAMDY (SEQ ID NO:3), QGISNY (SEQ ID NO: 4), YTS or QQYSKLPWT (SEQ ID NO:6), or any combination thereof. In one embodiment, antibody is a scFv. In one embodiment, antibody is a single domain antibody, e.g., a nanobody, such as one having only the variable region of a heavy chain of an antibody including one that is humanized. A humanized antibody or fragment thereof may be formed of human variable region sequences excluding one of more of the CDRs (DRs), where one or more of the CDRs are a consensus sequence or from a non-human mammal.
In one embodiment, an isolated cell comprising an expression cassette comprising a heterologous promoter operably linked to nucleic acid sequences encoding an anti-human P2X4 antibody, or an antigen binding fragment thereof, or a polypeptide, that prevents or inhibits human P2X4 activity is provided, where the antibody, the antigen binding fragment thereof, or the polypeptide has an amino acid sequence comprising at least one of GFTFTDYY (SEQ ID NO:1), IRNKANGYTT (SEQ ID NO:2), ARWEGDLLYAMDY (SEQ ID NO:3), QGISNY (SEQ ID NO:4), YTS or QQYSKLPWT (SEQ ID NO:6), or any combination thereof. In one embodiment, the cell is a mammalian cell, e.g., a primate cell such as a human cell. In one embodiment, the cell is a plant cell. In one embodiment, the cell is an insect cell.
In one embodiment, an isolated nucleic acid comprising a promoter operably linked to a nucleotide sequence which encodes at least the variable region of a heavy or light Ig chain that binds human P2X4, is provided wherein the chain comprises at least one of GFTFTDYY (SEQ ID NO:1), IRNKANGYTT (SEQ ID NO:2), ARWEGDLLYAMDY (SEQ ID NO:3), QGISNY (SEQ ID NO:4), YTS or QQYSKLPWT (SEQ ID NO:6), or any combination thereof. In one embodiment, a scFv is administered.
Further provided is a method to prevent, inhibit or treat depression or anxiety in a mammal, comprising: administering to a mammal a composition comprising an effective amount of a nucleotide sequence which encodes at least the variable region of a heavy or light chain that binds human P2X4, wherein the chain comprises at least one of GFTFTDYY (SEQ ID NO:1), IRNKANGYTT (SEQ ID NO:2), ARWEGDLLYAMDY (SEQ ID NO:3), QGISNY (SEQ ID NO:4), YTS or QQYSKLPWT (SEQ ID NO:6), or any combination thereof. In one embodiment, the mammal is a human. In one embodiment, the composition is systemically administered. In one embodiment, the composition is injected. In one embodiment, the nucleotide sequence is in a viral vector. In one embodiment, the composition is locally administered.
Also provided is a method to prevent, inhibit or treat pain in a mammal, comprising: administering to a mammal a composition comprising an effective amount of a nucleotide sequence which encodes at least the variable region of a heavy or light chain that binds human P2X4R, wherein the chain comprises at least one of GFTFTDYY (SEQ ID NO:1), IRNKANGYTT (SEQ ID NO:2), ARWEGDLLYAMDY (SEQ ID NO:3), QGISNY (SEQ ID NO:4), YTS or QQYSKLPWT (SEQ ID NO:6), or any combination thereof. In one embodiment, the mammal has acute pain. In one embodiment, the mammal has chronic pain. In one embodiment, the mammal has neuropathic pain. In one embodiment, the mammal was exposed to blunt force trauma. In one embodiment, the mammal has traumatic brain injury. In one embodiment, the mammal is a human. In one embodiment, the composition is systemically administered. In one embodiment, the composition is injected. In one embodiment, the nucleotide sequence is in a viral vector. In one embodiment, the composition is locally administered.
A “vector” refers to a macromolecule or association of macromolecules that comprises or associates with a polynucleotide, and which can be used to mediate delivery of the polynucleotide to a cell, either in vitro or in vivo. Illustrative vectors include, for example, plasmids, viral vectors, liposomes and other gene delivery vehicles. The polynucleotide to be delivered, sometimes referred to as a “target polynucleotide” or “transgene,” may comprise a coding sequence of interest in gene therapy (such as a gene encoding a protein of therapeutic interest), a coding sequence of interest in vaccine development (such as a polynucleotide expressing a protein, polypeptide or peptide suitable for eliciting an immune response in a mammal), and/or a selectable or detectable marker.
“Transduction,” “transfection,” “transformation” or “transducing” as used herein, are terms referring to a process for the introduction of an exogenous polynucleotide into a host cell leading to expression of the polynucleotide, e.g., the transgene in the cell, and includes the use of recombinant virus to introduce the exogenous polynucleotide to the host cell. Transduction, transfection or transformation of a polynucleotide in a cell may be determined by methods well known to the art including, but not limited to, protein expression (including steady state levels), e.g., by ELISA, flow cytometry and Western blot, measurement of DNA and RNA by hybridization assays, e.g., Northern blots, Southern blots and gel shift mobility assays. Methods used for the introduction of the exogenous polynucleotide include well-known techniques such as viral infection or transfection, lipofection, transformation and electroporation, as well as other non-viral gene delivery techniques. The introduced polynucleotide may be stably or transiently maintained in the host cell.
“Gene delivery” refers to the introduction of an exogenous polynucleotide into a cell for gene transfer, and may encompass targeting, binding, uptake, transport, localization, replicon integration and expression.
“Gene transfer” refers to the introduction of an exogenous polynucleotide into a cell which may encompass targeting, binding, uptake, transport, localization and replicon integration, but is distinct from and does not imply subsequent expression of the gene.
“Gene expression” or “expression” refers to the process of gene transcription, translation, and post-translational modification.
The term “polynucleotide” refers to a polymeric form of nucleotides of any length, including deoxyribonucleotides or ribonucleotides, or analogs thereof. A polynucleotide may comprise modified nucleotides, such as methylated or capped nucleotides and nucleotide analogs, and may be interrupted by non-nucleotide components. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer. The term polynucleotide, as used herein, refers interchangeably to double- and single-stranded molecules. Unless otherwise specified or required, any embodiment of the disclosure described herein that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.
“Nucleic acid sequence” is intended to encompass a polymer of DNA or RNA, i.e., a polynucleotide, which can be single-stranded or double-stranded and which can contain non-natural or altered nucleotides. The terms “nucleic acid” and “polynucleotide” as used herein refer to a polymeric form of nucleotides of any length, either ribonucleotides (RNA) or deoxyribonucleotides (DNA). These terms refer to the primary structure of the molecule, and thus include double- and single-stranded DNA, and double- and single-stranded RNA. The terms include, as equivalents, analogs of either RNA or DNA made from nucleotide analogs and modified polynucleotides such as, though not limited to, methylated and/or capped polynucleotides.
An “isolated” polynucleotide, e.g., plasmid, virus, polypeptide or other substance refers to a preparation of the substance devoid of at least some of the other components that may also be present where the substance or a similar substance naturally occurs or is initially prepared from. Thus, for example, an isolated substance may be prepared by using a purification technique to enrich it from a source mixture. Isolated nucleic acid, peptide or polypeptide is present in a form or setting that is different from that in which it is found in nature. For example, a given DNA sequence (e.g., a gene) is found on the host cell chromosome in proximity to neighboring genes; RNA sequences, such as a specific mRNA sequence encoding a specific protein, are found in the cell as a mixture with numerous other mRNAs that encode a multitude of proteins. The isolated nucleic acid molecule may be present in single-stranded or double-stranded form. When an isolated nucleic acid molecule is to be utilized to express a protein, the molecule will contain at a minimum the sense or coding strand (i.e., the molecule may single-stranded), but may contain both the sense and anti-sense strands (i.e., the molecule may be double-stranded). Enrichment can be measured on an absolute basis, such as weight per volume of solution, or it can be measured in relation to a second, potentially interfering substance present in the source mixture. Increasing enrichments of the embodiments of this disclosure are envisioned. Thus, for example, a 2-fold enrichment, 10-fold enrichment, 100-fold enrichment, or a 1000-fold enrichment.
A “transcriptional regulatory sequence” refers to a genomic region that controls the transcription of a gene or coding sequence to which it is operably linked. Transcriptional regulatory sequences of use in the present disclosure generally include at least one transcriptional promoter and may also include one or more enhancers and/or terminators of transcription.
“Operably linked” refers to an arrangement of two or more components, wherein the components so described are in a relationship permitting them to function in a coordinated manner. By way of illustration, a transcriptional regulatory sequence or a promoter is operably linked to a coding sequence if the TRS or promoter promotes transcription of the coding sequence. An operably linked TRS is generally joined in cis with the coding sequence, but it is not necessarily directly adjacent to it.
“Heterologous” means derived from a genotypically distinct entity from the entity to which it is compared. For example, a polynucleotide introduced by genetic engineering techniques into a different cell type is a heterologous polynucleotide (and, when expressed, can encode a heterologous polypeptide). Similarly, a transcriptional regulatory element such as a promoter that is removed from its native coding sequence and operably linked to a different coding sequence is a heterologous transcriptional regulatory element.
A “terminator” refers to a polynucleotide sequence that tends to diminish or prevent read-through transcription (i.e., it diminishes or prevent transcription originating on one side of the terminator from continuing through to the other side of the terminator). The degree to which transcription is disrupted is typically a function of the base sequence and/or the length of the terminator sequence. In particular, as is well known in numerous molecular biological systems, particular DNA sequences, generally referred to as “transcriptional termination sequences” are specific sequences that tend to disrupt read-through transcription by RNA polymerase, presumably by causing the RNA polymerase molecule to stop and/or disengage from the DNA being transcribed. Typical example of such sequence-specific terminators include polyadenylation (“polyA”) sequences, e.g., SV40 polyA. In addition to or in place of such sequence-specific terminators, insertions of relatively long DNA sequences between a promoter and a coding region also tend to disrupt transcription of the coding region, generally in proportion to the length of the intervening sequence. This effect presumably arises because there is always some tendency for an RNA polymerase molecule to become disengaged from the DNA being transcribed, and increasing the length of the sequence to be traversed before reaching the coding region would generally increase the likelihood that disengagement would occur before transcription of the coding region was completed or possibly even initiated. Terminators may thus prevent transcription from only one direction (“uni-directional” terminators) or from both directions (“bi-directional” terminators), and may be comprised of sequence-specific termination sequences or sequence-non-specific terminators or both. A variety of such terminator sequences are known in the art; and illustrative uses of such sequences within the context of the present disclosure are provided below.
“Host cells,” “cell lines,” “cell cultures,” “packaging cell line” and other such terms denote higher eukaryotic cells, such as mammalian cells including human cells, useful in the present disclosure, e.g., to produce recombinant virus or recombinant fusion polypeptide. These cells include the progeny of the original cell that was transduced. It is understood that the progeny of a single cell may not necessarily be completely identical (in morphology or in genomic complement) to the original parent cell.
“Recombinant,” as applied to a polynucleotide means that the polynucleotide is the product of various combinations of cloning, restriction and/or ligation steps, and other procedures that result in a construct that is distinct from a polynucleotide found in nature. A recombinant virus is a viral particle comprising a recombinant polynucleotide. The terms respectively include replicates of the original polynucleotide construct and progeny of the original virus construct.
A “control element” or “control sequence” is a nucleotide sequence involved in an interaction of molecules that contributes to the functional regulation of a polynucleotide, including replication, duplication, transcription, splicing, translation, or degradation of the polynucleotide. The regulation may affect the frequency, speed, or specificity of the process, and may be enhancing or inhibitory in nature. Control elements known in the art include, for example, transcriptional regulatory sequences such as promoters and enhancers. A promoter is a DNA region capable under certain conditions of binding RNA polymerase and initiating transcription of a coding region usually located downstream (in the 3′ direction) from the promoter. Promoters include AAV promoters, e.g., P5, P19, P40 and AAV ITR promoters, as well as heterologous promoters.
An “expression vector” is a vector comprising a region which encodes a gene product of interest, and is used for effecting the expression of the gene product in an intended target cell. An expression vector also comprises control elements operatively linked to the encoding region to facilitate expression of the protein in the target. The combination of control elements and a gene or genes to which they are operably linked for expression is sometimes referred to as an “expression cassette,” a large number of which are known and available in the art or can be readily constructed from components that are available in the art.
The terms “polypeptide” and “protein” are used interchangeably herein to refer to polymers of amino acids of any length. The terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, acetylation, phosphorylation, lipidation, or conjugation with a labeling component.
The term “exogenous,” when used in relation to a protein, gene, nucleic acid, or polynucleotide in a cell or organism refers to a protein, gene, nucleic acid, or polynucleotide which has been introduced into the cell or organism by artificial or natural means. An exogenous nucleic acid may be from a different organism or cell, or it may be one or more additional copies of a nucleic acid which occurs naturally within the organism or cell. By way of a non-limiting example, an exogenous nucleic acid is in a chromosomal location different from that of natural cells, or is otherwise flanked by a different nucleic acid sequence than that found in nature, e.g., an expression cassette which links a promoter from one gene to an open reading frame for a gene product from a different gene.
“Transformed” or “transgenic” is used herein to include any host cell or cell line, which has been altered or augmented by the presence of at least one recombinant DNA sequence. The host cells of the present disclosure are typically produced by transfection with a DNA sequence in a plasmid expression vector, as an isolated linear DNA sequence, or infection with a recombinant viral vector.
The term “sequence homology” means the proportion of base matches between two nucleic acid sequences or the proportion amino acid matches between two amino acid sequences. When sequence homology is expressed as a percentage, e.g., 50%, the percentage denotes the proportion of matches over the length of a selected sequence that is compared to some other sequence. Gaps (in either of the two sequences) are permitted to maximize matching; gap lengths of 15 bases or less are usually used, 6 bases or less are preferred with 2 bases or less more preferred. When using oligonucleotides as probes or treatments, the sequence homology between the target nucleic acid and the oligonucleotide sequence is generally not less than 17 target base matches out of 20 possible oligonucleotide base pair matches (85%); not less than 9 matches out of 10 possible base pair matches (90%), or not less than 19 matches out of 20 possible base pair matches (95%).
Two amino acid sequences are homologous if there is a partial or complete identity between their sequences. For example, 85% homology means that 85% of the amino acids are identical when the two sequences are aligned for maximum matching. Gaps (in either of the two sequences being matched) are allowed in maximizing matching; gap lengths of 5 or less are preferred with 2 or less being more preferred. Alternatively, two protein sequences (or polypeptide sequences derived from them of at least 30 amino acids in length) are homologous, as this term is used herein, if they have an alignment score of at more than 5 (in standard deviation units) using the program ALIGN with the mutation data matrix and a gap penalty of 6 or greater. The two sequences or parts thereof are more homologous if their amino acids are greater than or equal to 50% identical when optimally aligned using the ALIGN program.
The term “corresponds to” is used herein to mean that a polynucleotide sequence is structurally related to all or a portion of a reference polynucleotide sequence, or that a polypeptide sequence is structurally related to all or a portion of a reference polypeptide sequence, e.g., they have at least 80%, 85%, 90%, 95% or more, e.g., 99% or 100%, sequence identity. In contradistinction, the term “complementary to” is used herein to mean that the complementary sequence is homologous to all or a portion of a reference polynucleotide sequence. For illustration, the nucleotide sequence “TATAC” corresponds to a reference sequence “TATAC” and is complementary to a reference sequence “GTATA”.
The term “sequence identity” means that two polynucleotide sequences are identical (i.e., on a nucleotide-by-nucleotide basis) over the window of comparison. The term “percentage of sequence identity” means that two polynucleotide sequences are identical (i.e., on a nucleotide-by-nucleotide basis) over the window of comparison. The term “percentage of sequence identity” is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U, or I) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. The terms “substantial identity” as used herein denote a characteristic of a polynucleotide sequence, wherein the polynucleotide comprises a sequence that has at least 85 percent sequence identity, preferably at least 90 to 95 percent sequence identity, more usually at least 99 percent sequence identity as compared to a reference sequence over a comparison window of at least 20 nucleotide positions, frequently over a window of at least 20-50 nucleotides, wherein the percentage of sequence identity is calculated by comparing the reference sequence to the polynucleotide sequence which may include deletions or additions which total 20 percent or less of the reference sequence over the window of comparison.
“Conservative” amino acid substitutions are, for example, aspartic-glutamic as polar acidic amino acids; lysine/arginine/histidine as polar basic amino acids; leucine/isoleucine/methionine/valine/alanine/glycine/proline as non-polar or hydrophobic amino acids; serine/threonine as polar or uncharged hydrophilic amino acids. Conservative amino acid substitution also includes groupings based on side chains. For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains is cysteine and methionine. For example, it is reasonable to expect that replacement of a leucine with an isoleucine or valine, an aspartate with a glutamate, a threonine with a serine, or a similar replacement of an amino acid with a structurally related amino acid will not have a major effect on the properties of the resulting polypeptide. Whether an amino acid change results in a functional polypeptide can readily be determined by assaying the specific activity of the polypeptide. Naturally occurring residues are divided into groups based on common side-chain properties: (1) hydrophobic: norleucine, met, ala, val, leu, ile; (2) neutral hydrophilic: cys, ser, thr; (3) acidic: asp, glu; (4) basic: asn, gln, his, lys, arg; (5) residues that influence chain orientation: gly, pro; and (6) aromatic; trp, tyr, phe.
The disclosure also envisions polypeptides with non-conservative substitutions. Non-conservative substitutions entail exchanging a member of one of the classes described above for another.
The term “antibody,” as used herein, may refer to a full-length immunoglobulin molecule or an immunologically-active fragment of an immunoglobulin molecule such as the Fab or F(ab′)2 fragment generated by, for example, cleavage of the antibody with an enzyme such as pepsin or co-expression of an antibody light chain and an antibody heavy chain in, for example, a mammalian cell, or ScFv. The antibody can also be an IgG, IgD, IgA, IgE or IgM antibody. Full-length immunoglobulin “light chains” (about 25 kD or 214 amino acids) are encoded by a variable region gene at the amino-terminus (about 110 amino acids) and a kappa or lambda constant region gene at the carboxy-terminus. Full-length immunoglobulin “heavy chains” (about 50 kD or 446 amino acids), are similarly encoded by a variable region gene (about 116 amino acids) and one of the other aforementioned constant region genes, e.g., gamma (encoding about 330 amino acids). Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively. An exemplary immunoglobulin (antibody) structural unit comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light” (about 25 kD) and one “heavy” chain (about 50-70 kD). The N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The terms variable light chain (VL) and variable heavy chain (VH) refer to these light and heavy chains respectively. In each pair of the tetramer, the light and heavy chain variable regions are together responsible for binding to an antigen, and the constant regions are responsible for the antibody effector functions. In addition to naturally occurring antibodies, immunoglobulins may exist in a variety of other forms including, for example, Fv, ScFv, Fab, and F(ab′)2, as well as bifunctional hybrid antibodies (e.g., Lanzavecchia et al. (1987)) and in single chains (e.g., Huston et al. (1988) and Bird et al. (1988), which are incorporated herein by reference). (See, generally, Hood et al., “Immunology”, Benjamin, N. Y., 2nd ed. (1984), and Hunkapiller and Hood (1986), which are incorporated herein by reference). Thus, the term “antibody” includes antigen binding antibody fragments, as are known in the art, including Fab, Fab2, single chain antibodies (scFv for example), chimeric antibodies, etc., either produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies.
An immunoglobulin light or heavy chain variable region consists of a “framework” region interrupted by three hypervariable regions, also called CDR's. The extent of the framework region and CDR's have been precisely defined (see, “Sequences of Proteins of Immunological Interest,” E. Kabat et al., U.S. Department of Health and Human Services, (1983); which is incorporated herein by reference). The sequences of the framework regions of different light or heavy chains are relatively conserved within a species. As used herein, a “human framework region” is a framework region that is substantially identical (about 85% or more, usually 90 to 95% or more) to the framework region of a naturally occurring human immunoglobulin. The framework region of an antibody, that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDR's. The CDR's are primarily responsible for binding to an epitope of an antigen.
Chimeric antibodies are antibodies whose light and heavy chain genes have been constructed, typically by genetic engineering, from immunoglobulin variable and constant region genes belonging to different species. For example, the variable segments of the genes from a mouse monoclonal antibody may be joined to human constant segments, such as gamma 1 and gamma 3. One example of a chimeric antibody is one composed of the variable or antigen-binding domain from a mouse antibody and the constant or effector domain from a human antibody, although other mammalian species may be used.
As used herein, the term “humanized” immunoglobulin refers to an immunoglobulin having a human framework region and one or more CDR's from a non-human (usually a mouse or rat) immunoglobulin. The non-human immunoglobulin providing the CDR's is called the “donor” and the human immunoglobulin providing the framework is called the “acceptor.” Constant regions need not be present, but if they are, they are generally substantially identical to human immunoglobulin constant regions, i.e., at least about 85-90%, or about 95% or more identical. Hence, all parts of a humanized immunoglobulin, except possibly the CDR's, are substantially identical to corresponding parts of natural human immunoglobulin sequences. A “humanized antibody” is an antibody comprising a humanized light chain and a humanized heavy chain immunoglobulin. One says that the donor antibody has been “humanized”, by the process of “humanization”, because the resultant humanized antibody is expected to bind to the same antigen as the donor antibody that provides the CDR's.
Thus, humanized forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab′, F(ab′)2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin. Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, the humanized antibody has substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will include at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al. (1986); Riechmann et al. (1988); and Presta (1992)).
It is understood that the humanized antibodies may have additional conservative amino acid substitutions which have substantially no effect on antigen binding or other immunoglobulin functions. By conservative substitutions are intended combinations such as gly, ala; val, ile, leu; asp, glu; asn, gln; ser, thr; lys, arg; and phe, tyr.
Humanized immunoglobulins, including humanized antibodies, have been constructed by means of genetic engineering. Methods for humanizing non-human antibodies are well known in the art. Generally, a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as “import” residues, which are typically taken from an “import” variable domain. Humanization can be essentially performed following the method of Winter and co-workers (Jones et al., Nature, 321:522 (1986); Riechmann et al., Nature, 332:323 (1988); Verhoeyen et al., Science, 239:1534 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such “humanized” antibodies are chimeric antibodies that have substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some CDR residues and possibly some framework residues are substituted by residues from analogous sites in rodent antibodies.
Human antibodies can also be produced using various techniques known in the art, including phage display libraries (Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991)). The techniques of Cole et al. and Boerner et al. are also available for the preparation of human monoclonal antibodies (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985) and Boerner et al., J. Immunol., 147:86 (1991)). Similarly, human antibodies can be made by introducing of human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in the following scientific publications: Marks et al., Bio/Technology 10:779 (1992); Lonberg et al., Nature, 368:856 (1994); Morrison, Nature, 368:812 (1994); Fishwild et al., Nature Biotechnology, 14:845 (1996); Neuberger, Nature Biotechnology, 14:826 (1996); Lonberg and Huszar, Intern. Rev. Immunol., 13:65 (1995). Most humanized immunoglobulins that have been previously described have a framework that is identical to the framework of a particular human immunoglobulin chain and three CDR's from a non-human donor immunoglobulin chain.
A framework may be one from a particular human immunoglobulin that is unusually homologous to the donor immunoglobulin to be humanized, or a consensus framework derived from many human antibodies. For example, comparison of the sequence of a mouse heavy (or light) chain variable region against human heavy (or light) variable regions in a data bank (for example, the National Biomedical Research Foundation Protein Identification Resource) shows that the extent of homology to different human regions varies greatly, typically from about 40% to about 60-70%. By choosing one of the human heavy (respectively light) chain variable regions that is most homologous to the heavy (respectively light) chain variable region of the other immunoglobulin, fewer amino acids will be changed in going from the one immunoglobulin to the humanized immunoglobulin. The precise overall shape of a humanized antibody having the humanized immunoglobulin chain may more closely resemble the shape of the donor antibody, also reducing the chance of distorting the CDR's.
Typically, one of the 3-5 most homologous heavy chain variable region sequences in a representative collection of at least about 10 to 20 distinct human heavy chains is chosen as acceptor to provide the heavy chain framework, and similarly for the light chain. One of the 1 to 3 most homologous variable regions may be used. The selected acceptor immunoglobulin chain may have at least about 65% homology in the framework region to the donor immunoglobulin.
In many cases, it may be considered desirable to use light and heavy chains from the same human antibody as acceptor sequences, to be sure the humanized light and heavy chains will make favorable contacts with each other. Regardless of how the acceptor immunoglobulin is chosen, higher affinity may be achieved by selecting a small number of amino acids in the framework of the humanized immunoglobulin chain to be the same as the amino acids at those positions in the donor rather than in the acceptor.
Humanized antibodies generally have advantages over mouse or in some cases chimeric antibodies for use in human therapy: because the effector portion is human, it may interact better with the other parts of the human immune system (e.g., destroy the target cells more efficiently by complement-dependent cytotoxicity (CDC) or antibody-dependent cellular cytotoxicity (ADCC)); the human immune system should not recognize the framework or constant region of the humanized antibody as foreign, and therefore the antibody response against such an antibody should be less than against a totally foreign mouse antibody or a partially foreign chimeric antibody.
DNA segments having immunoglobulin sequences typically further include an expression control DNA sequence operably linked to the humanized immunoglobulin coding sequences, including naturally-associated or heterologous promoter regions. Generally, the expression control sequences will be eukaryotic promoter systems in vectors capable of transforming or transfecting eukaryotic host cells, but control sequences for prokaryotic hosts may also be used. Once the vector has been incorporated into the appropriate host, the host is maintained under conditions suitable for high level expression of the nucleotide sequences, and, as desired, the collection and purification of the humanized light chains, heavy chains, light/heavy chain dimers or intact antibodies, binding fragments or other immunoglobulin forms may follow (see, S. Beychok, Cells of Immunoglobulin Synthesis, Academic Press, New York, (1979), which is incorporated herein by reference).
Other “substantially homologous” modified immunoglobulins to the native sequences can be readily designed and manufactured utilizing various recombinant DNA techniques well known to those skilled in the art. For example, the framework regions can vary at the primary structure level by several amino acid substitutions, terminal and intermediate additions and deletions, and the like. Moreover, a variety of different human framework regions may be used singly or in combination as a basis for the humanized immunoglobulins of the present disclosure. In general, modifications of the genes may be readily accomplished by a variety of well-known techniques, such as site-directed mutagenesis (see, Gillman and Smith, Gene, 8:81 (1979) and Roberts et al., Nature, 328:731 (1987), both of which are incorporated herein by reference). Substantially homologous immunoglobulin sequences are those which exhibit at least about 85% homology, usually at least about 90%, or at least about 95% homology with a reference immunoglobulin protein.
Alternatively, polypeptide fragments comprising only a portion of the primary antibody structure may be produced, which fragments possess one or more immunoglobulin activities (e.g., antigen binding). These polypeptide fragments may be produced by proteolytic cleavage of intact antibodies by methods well known in the art, or by inserting stop codons at the desired locations in vectors known to those skilled in the art, using site-directed mutagenesis.
The disclosure also provides a gene transfer vector comprising a nucleic acid sequence which encodes an antibody, an antigen binding fragment thereof, or a polypeptide, directed against P2X4R (also referred to as P2X4). In one embodiment, the gene transfer vector is a virus. The disclosure further provides a method of using the gene transfer vector or encoded gene product against P2X4 in a mammal, which method comprises administering to the mammal the above-described gene transfer vector or the encoded gene product. Various aspects of the gene transfer vector, antibody or antigen binding fragment thereof, and methods are discussed below. Although each parameter is discussed separately, the gene transfer vector, antibody or antigen binding fragment thereof, or polypeptide, and method, may comprise combinations of the parameters set forth below. Accordingly, any combination of parameters can be used according to the gene transfer vector, antibody or antigen binding fragment thereof, the polypeptide, and the method.
A “gene transfer vector” is any molecule or composition that has the ability to carry and deliver a heterologous nucleic acid sequence into a suitable host cell where synthesis of the encoded protein takes place. Typically, a gene transfer vector is a nucleic acid molecule that has been engineered, using recombinant DNA techniques that are known in the art, to incorporate the heterologous nucleic acid sequence. Desirably, the gene transfer vector is comprised of DNA. Examples of suitable DNA-based gene transfer vectors include plasmids and viral vectors. However, gene transfer vectors that are not based on nucleic acids, such as liposomes, are also known and used in the art. The gene transfer vector can be based on a single type of nucleic acid (e.g., a plasmid) or non-nucleic acid molecule (e.g., a lipid or a polymer). The gene transfer vector can be integrated into the host cell genome, or can be present in the host cell in the form of an episome.
In one embodiment, the gene transfer vector is a viral vector. Suitable viral vectors include, for example, retroviral vectors, lentiviral vectors, herpes simplex virus (HSV)-based vectors, parvovirus-based vectors, e.g., adeno-associated virus (AAV)-based vectors, AAV-adenoviral chimeric vectors, and adenovirus-based vectors. These viral vectors can be prepared using standard recombinant DNA techniques described in, for example, Sambrook et al., Molecular Cloning, a Laboratory Manual, 3rd edition, Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (2001), and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, New York, N.Y. (1994).
Any viral vector may be employed to deliver antibody encoding sequences to cells including mammalian cells, or to mammals, include but are not limited to adeno-associated virus, adenovirus, herpesvirus, retrovirus, or lentivirus vectors.
In addition to the nucleic acid sequence encoding an antibody against P2X4R, or an antigen-binding fragment thereof, the viral vector may comprise expression control sequences, such as promoters, enhancers, polyadenylation signals, transcription terminators, internal ribosome entry sites (IRES), and the like, that provide for the expression of the nucleic acid sequence in a host cell. Exemplary expression control sequences are known in the art and described in, for example, Goeddel, Gene Expression Technology: Methods in Enzymology, Vol. 185, Academic Press, San Diego, CA. (1990).
A large number of promoters, including constitutive, inducible, and repressible promoters, from a variety of different sources are well known in the art. Representative sources of promoters include for example, virus, mammal, insect, plant, yeast, and bacteria, and suitable promoters from these sources are readily available, or can be made synthetically, based on sequences publicly available, for example, from depositories such as the ATCC as well as other commercial or individual sources. Promoters can be unidirectional (i.e., initiate transcription in one direction) or bi-directional (i.e., initiate transcription in either a 3′ or 5′ direction). Non-limiting examples of promoters include, for example, the T7 bacterial expression system, pBAD (araA) bacterial expression system, the cytomegalovirus (CMV) promoter, the SV40 promoter, and the RSV promoter. Inducible promoters include, for example, the Tet system (U.S. Pat. Nos. 5,464,758 and 5,814,618), the Ecdysone inducible system (No et al., Proc. Natl. Acad. Sci., 93:3346 (1996)), the T-REX™ system (Invitrogen, Carlsbad, CA), LACSWITCH™ System (Stratagene, San Diego, CA), and the Cre-ERT tamoxifen inducible recombinase system (Indra et al., Nuc. Acid. Res., 27:4324 (1999); Nuc. Acid. Res., 28: e99 (2000); U.S. Pat. No. 7,112,715; and Kramer & Fussenegger, Methods Mol. Biol., 308:123 (2005)).
The term “enhancer” as used herein, refers to a DNA sequence that increases transcription of, for example, a nucleic acid sequence to which it is operably linked. Enhancers can be located many kilobases away from the coding region of the nucleic acid sequence and can mediate the binding of regulatory factors, patterns of DNA methylation, or changes in DNA structure. A large number of enhancers from a variety of different sources are well known in the art and are available as or within cloned polynucleotides (from, e.g., depositories such as the ATCC as well as other commercial or individual sources). A number of polynucleotides comprising promoters (such as the commonly-used CMV promoter) also comprise enhancer sequences. Enhancers can be located upstream, within, or downstream of coding sequences. In one embodiment, the nucleic acid sequence encoding an antibody against P2X4R, or an antigen-binding fragment thereof, is operably linked to a CMV enhancer/chicken beta-actin promoter (also referred to as a “CAG promoter”) (see, e.g., Niwa et al., Gene, 108:193 (1991); Daly et al., Proc. Natl. Acad. Sci. U.S.A., 96:2296 (1999); and Sondhi et al., Mol. Ther., 15:481 (2007)).
Typically, AAV vectors are produced using well characterized plasmids. For example, human embryonic kidney 293T cells are transfected with one of the transgene specific plasmids and another plasmid containing the adenovirus helper and AAV rep and cap genes (specific to AAVrh.10, 8 or 9 as required). After 72 hours, the cells are harvested and the vector is released from the cells by five freeze/thaw cycles. Subsequent centrifugation and benzonase treatment removes cellular debris and unencapsidated DNA. Iodixanol gradients and ion exchange columns may be used to further purify each AAV vector. Next, the purified vector is concentrated by a size exclusion centrifuge spin column to the required concentration. Finally, the buffer is exchanged to create the final vector products formulated (for example) in 1× phosphate buffered saline. The viral titers may be measured by TaqMan® real-time PCR and the viral purity may be assessed by SDS-PAGE.
The antibodies or fragments thereof, or polypeptides, that bind to or inhibit P2X4, e.g., bind to the extracellular portion thereof, may bind to a polypeptide having
or a polypeptide with at least 80%, 82%, 85%, 87%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98% or 99% amino acid sequence identity thereto.
The disclosure provides for an antibody, antigen binding fragment thereof, or a polypeptide, directed against and/or binds to P2X4. In one embodiment, the antibody, fragment thereof, or polypeptide binds human P2X4.
One of ordinary skill in the art will appreciate that an antibody consists of four polypeptides: two identical copies of a heavy (H) chain polypeptide and two copies of a light (L) chain polypeptide. Each of the heavy chains contains one N-terminal variable (VH) region and three C-terminal constant (CH1, CH2 and CH3) regions, and each light chain contains one N-terminal variable (VL) region and one C-terminal constant (CL) region. The variable regions of each pair of light and heavy chains form the antigen binding site of an antibody. The nucleic acid sequence which encodes an antibody directed against human P2X4 can comprise one or more nucleic acid sequences, each of which encodes one or more of the heavy and/or light chain polypeptides of an anti-human P2X4 antibody. In this respect, the nucleic acid sequence which encodes an antibody directed against human P2X4 can comprise a single nucleic acid sequence that encodes the heavy chain polypeptide and the light chain polypeptide of an anti-P2X4 antibody. Alternatively, the nucleic acid sequence which encodes an antibody directed against human P2X4 can comprise a first nucleic acid sequence that encodes the heavy chain polypeptide of an anti-human P2X4 antibody, and a second nucleic acid sequence that encodes the light chain polypeptide of an anti-human P2X4 antibody. In yet another embodiment, the nucleic acid sequence which encodes a fragment of an antibody directed against human P2X4 can comprise a nucleic acid sequence encoding a heavy chain variable region polypeptide of an anti-human P2X4 antibody, a nucleic acid sequence encoding a light chain variable region polypeptide of an anti-human P2X4 antibody, or a nucleic acid sequence encoding a heavy chain variable region and a light chain variable region polypeptide of an anti-human P2X4 antibody.
In another embodiment, the nucleic acid sequence which encodes an antibody directed against human P2X4 encodes an antigen-binding fragment (also referred to as an “antibody fragment”) of an anti-human P2X4 antibody. The term “antigen-binding fragment” refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., P2X4) (see, generally, Holliger and Hudson 2005). Examples of antigen-binding fragments include but are not limited to (i) a Fab fragment, which is a monovalent fragment consisting of the VL, VH, CL, and CH1 domains; (ii) a F(ab′)2 fragment, which is a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; and (iii) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody. In one embodiment, the nucleic acid sequence which encodes an antibody directed against human P2X4 can comprise a nucleic acid sequence encoding a Fab fragment of an anti-human P2X4 antibody. In one embodiment, the nucleic acid sequence which encodes an antibody or fragment thereof directed against human P2X4 can comprise a nucleic acid sequence encoding a heavy chain variable region that binds human P2X4. In one embodiment, the nucleic acid sequence which encodes an antibody or fragment thereof directed against human P2X4 can comprise a nucleic acid sequence encoding a light chain variable region that binds human P2X4. In one embodiment, the nucleic acid sequence which encodes an antibody directed against human P2X4 can comprise a nucleic acid sequence encoding one, two or three CDRs, e.g., of a heavy chain variable region, that bind(s) human P2X4. In one embodiment, the nucleic acid sequence which encodes an antibody directed against P2X4 can comprise a nucleic acid sequence encoding one, two or three CDRs, e.g., of a light chain variable region, that bind(s) human P2X4. The antibody fragment may be a scFv antibody or a nanobody (VHH antibodies having a single variable domain in a heavy chain), Fab or F(ab′)2.
In an embodiment, the nucleic acid sequence which encodes an antibody against P2X4 recognizes human but not rodent P2X4.
An antibody, or antigen-binding fragment thereof, can be obtained by any means, including via in vitro sources (e.g., a hybridoma or a cell line producing an antibody recombinantly) and in vivo sources (e.g., rodents).
Methods for generating antibodies are known in the art and are described in, for example, Köhler and Milstein, Eur. J. Immunol., 5:511 (1976); Harlow and Lane (eds.), Antibodies: A Laboratory Manual, CSH Press (1988); and C. A. Janeway et al. (eds.), Immunobiology, 5th Ed., Garland Publishing, New York, NY (2001)). In certain embodiments, a human antibody or a chimeric antibody can be generated using a transgenic animal (e.g., a mouse) wherein one or more endogenous immunoglobulin genes are replaced with one or more human immunoglobulin genes. Examples of transgenic mice wherein endogenous antibody genes are effectively replaced with human antibody genes include, but are not limited to, VelocImmune mouse, Trianni® mouse, Kymab™ mouse, HUMAB-MOUSE™, the Kirin TC MOUSE™, and the KM-MOUSE™ (see, e.g., Lonberg, Nat. Biotechnol., 23 (9): 1117 (2005), and Lonberg, Handb. Exp. Pharmacol., 181:69 (2008)).
The nucleic acid sequence which encodes an antibody directed against human P2X4, an antigen-binding fragment thereof, or a polypeptide that binds human P2X4, can be generated using methods known in the art. For example, polypeptides, and proteins can be recombinantly produced using standard recombinant DNA methodology (see, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, 3rd ed., Cold Spring Harbor Press, Cold Spring Harbor, NY, 2001; and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, NY, 1994). Further, an antibody directed against human P2X4, or an antigen-binding fragment thereof, can be isolated and/or purified from a source, such as a bacterium, an insect, or a mammal, e.g., a rat, a human, etc., into which a synthetically produced nucleic acid sequences encoding such antibody or antigen-binding fragment was introduced. Methods of isolation and purification are well-known in the art. Alternatively, the nucleic acid sequences described herein can be commercially synthesized. In this respect, the nucleic acid sequence can be synthetic, recombinant, isolated, and/or purified.
The nucleic acid sequence which encodes an antibody directed against human P2X4 may be identified by extracting RNA from the available antibody producing hybridoma cells. cDNA is produced by reverse transcription and PCR amplification of the light and heavy chains and is carried out using a rapid amplification of cDNA ends (RACE) strategy in combination with specific primers for conserved regions in the constant domains.
The nucleic acid sequence which encodes an antibody directed against human P2X4 may also be fully or partly humanized by means known in the art. For example, an antibody chimera may be created by substituting DNA encoding the mouse Fc region of the antibody with that of cDNA encoding for human.
The Fab portion of the molecule may also be humanized by selectively altering the DNA of non-CDR portions of the Fab sequence that differ from those in humans by exchanging the sequences for the appropriate individual amino acids.
Alternatively, humanization may be achieved by insertion of the appropriate CDR coding segments into a human antibody “scaffold”.
Resulting antibody DNA sequences may be modified for high expression levels in mammalian cells through removal of RNA instability elements and/or codon optimization, as is known in the art.
In an embodiment, nucleic acid sequences which encode the heavy chain and light chain of an antibody directed against human P2X4, may be expressed under the control of a single promoter in a 1:1 ratio using a 2A sequence (a cis-acting hydrolase element) self-cleavable sequence. The 2A sequence self-cleaves during protein translation and leaves a short tail of amino acids in the C-terminus of the upstream protein. A Furin cleavage recognition site may be added between the 2A sequence and the upstream gene to assure removal of the remaining amino acids. Plasmids expressing the correct inserts may be identified by DNA sequencing and by antibody specific binding using western analysis and ELISA assays.
The disclosure provides a composition comprising, consisting essentially of, or consisting of the above-described antibody, antibody fragment, such as a single chain polypeptide, isolated polypeptide, or gene transfer vector and a pharmaceutically acceptable (e.g., physiologically acceptable) carrier, or an antibody or antigen binding fragment, polypeptide, or gene transfer vector thereof optionally with a pharmaceutically acceptable (e.g., physiologically acceptable) carrier. When the composition consists essentially of the antibody, antibody fragment, e.g., single chain polypeptide, isolated polypeptide, or gene transfer vector and a pharmaceutically acceptable carrier, additional components can be included that do not materially affect the composition (e.g., adjuvants, buffers, stabilizers, anti-inflammatory agents, solubilizers, preservatives, etc.). When the composition consists of the gene transfer vector and the pharmaceutically acceptable carrier, or the antibody, antigen binding fragment thereof or isolated polypeptide optionally with a pharmaceutically acceptable carrier, the composition does not comprise any additional components. Any suitable carrier can be used within the context of the disclosure, and such carriers are well known in the art. The choice of carrier will be determined, in part, by the particular site to which the composition may be administered and the particular method used to administer the composition. The composition optionally can be sterile with the exception of the gene transfer vector or an antibody or antigen binding fragment thereof or isolated polypeptide described herein. The composition can be frozen or lyophilized for storage and reconstituted in a suitable sterile carrier prior to use. The compositions can be generated in accordance with conventional techniques described in, e.g., Remington: The Science and Practice of Pharmacy, 21st Edition, Lippincott Williams & Wilkins, Philadelphia, PA (2001).
Suitable formulations for the composition include aqueous and non-aqueous solutions, isotonic sterile solutions, which can contain anti-oxidants, buffers, and bacteriostats, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. The formulations can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials, and can be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carrier, for example, water, immediately prior to use. Extemporaneous solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described. In one embodiment, the carrier is a buffered saline solution. In one embodiment, the gene transfer vector, antibody or antigen binding fragment thereof or isolated polypeptide is administered in a composition formulated to protect the gene transfer vector or antibody or antigen binding fragment thereof or isolated polypeptide from damage prior to administration. For example, the composition can be formulated to reduce loss of the gene transfer vector, antibody or fragment thereof or isolated polypeptide on devices used to prepare, store, or administer the gene transfer vector, such as glassware, syringes, or needles. The composition can be formulated to decrease the light sensitivity and/or temperature sensitivity of the gene transfer vector or an antibody or antigen binding fragment thereof or isolated polypeptide. To this end, the composition may comprise a pharmaceutically acceptable liquid carrier, such as, for example, those described above, and a stabilizing agent selected from the group consisting of polysorbate 80, L-arginine, polyvinylpyrrolidone, trehalose, and combinations thereof. Use of such a composition will extend the shelf life of, e.g., the gene transfer vector, facilitate administration, and increase the efficiency of the method. Formulations for gene transfer vector-containing compositions are further described in, for example, Wright et al., Curr. Opin. Drug Discov. Devel., 6 (2): 174-178 (2003) and Wright et al., Molecular Therapy, 12:171-178 (2005))
The composition also can be formulated to enhance transduction efficiency. In addition, one of ordinary skill in the art will appreciate that the gene transfer vector or antibody or antigen binding fragment thereof or polypeptide can be present in a composition with other therapeutic or biologically-active agents. For example, factors that control inflammation, such as ibuprofen or steroids, can be part of the composition to reduce swelling and inflammation associated with in vivo administration of the gene transfer vector or the antibody or antigen binding fragment thereof or polypeptide. Immune system stimulators or adjuvants, e.g., interleukins, lipopolysaccharide, and double-stranded RNA, can be administered to enhance or modify the anti-P2X4R immune response. Antibiotics, i.e., microbicides and fungicides, can be present to treat existing infection and/or reduce the risk of future infection, such as infection associated with gene transfer procedures.
Injectable depot forms are made by forming microencapsulated matrices of the subject compounds in biodegradable polymers such as polylactide-polyglycolide. Depending on the ratio of drug to polymer, and the nature of the particular polymer employed, the rate of drug release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are also prepared by entrapping the drug in liposomes or microemulsions which are compatible with body tissue.
In certain embodiments, a formulation of the present disclosure comprises a biocompatible polymer selected from the group consisting of polyamides, polycarbonates, polyalkylenes, polymers of acrylic and methacrylic esters, polyvinyl polymers, polyglycolides, polysiloxanes, polyurethanes and copolymers thereof, celluloses, polypropylene, polyethylenes, polystyrene, polymers of lactic acid and glycolic acid, polyanhydrides, poly(ortho)esters, poly(butic acid), poly(valeric acid), poly(lactide-co-caprolactone), polysaccharides, proteins, polyhyaluronic acids, polycyanoacrylates, and blends, mixtures, or copolymers thereof.
The composition can be administered in or on a device that allows controlled or sustained release, such as a sponge, biocompatible meshwork, mechanical reservoir, or mechanical implant. Implants (see, e.g., U.S. Pat. No. 5,443,505), devices (see, e.g., U.S. Pat. No. 4,863,457), such as an implantable device, e.g., a mechanical reservoir or an implant or a device comprised of a polymeric composition, are particularly useful for administration of the gene transfer vector, antibody or antigen binding fragment thereof. The composition also can be administered in the form of sustained-release formulations (see, e.g., U.S. Pat. No. 5,378,475) comprising, for example, gel foam, hyaluronic acid, gelatin, chondroitin sulfate, a polyphosphoester, such as bis-2-hydroxyethyl-terephthalate (BHET), and/or a polylactic-glycolic acid.
Delivery of the compositions comprising the gene transfer vectors, antibody or antigen binding fragment thereof or isolated polypeptide, may be intracerebral (including but not limited to intraparenchymal, intraventricular, or intracisternal), intrathecal (including but not limited to lumbar or cisterna magna), or systemic, including but not limited to intravenous, oral, or any combination thereof, using devices known in the art. Local delivery, e.g., subcutaneous and intranasal, are also envisioned. Delivery may also be via surgical implantation of an implanted device.
The dose of the active agent in the composition administered to the mammal will depend on a number of factors, including the size (mass) of the mammal, the extent of any side-effects, the particular route of administration, and the like. In one embodiment, the method comprises administering a “therapeutically effective amount” of the composition comprising the gene transfer vector, antibody or antigen binding fragment thereof or polypeptide described herein. A “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result. The therapeutically effective amount may vary according to factors such as the extent of pathology, age, sex, and weight of the individual, and the ability of the gene transfer vector, antibody or antigen binding fragment thereof to elicit a desired response in the individual. The dose of gene transfer vector in the composition required to achieve a particular therapeutic effect typically is administered in units of vector genome copies per cell (gc/cell) or vector genome copies/per kilogram of body weight (gc/kg). One of ordinary skill in the art can readily determine an appropriate gene transfer vector dose range to treat a patient having a particular disease or disorder, based on these and other factors that are well known in the art. A therapeutically effective amount may be between 1×1010 genome copies to 1×1013 genome copies. A therapeutically effective amount may be between 1×1012 genome copies to 1×1015 genome copies (total). A therapeutically effective amount may be between 1×1012 genome copies/kg to 1×1015 genome copies/kg.
The dose of antibody or antigen binding fragment thereof or isolated polypeptide, or non-viral nucleic acid encoding the antibody, fragment or polypeptide, in the composition required to achieve a particular therapeutic effect typically is administered in units of antibody or antigen binding fragment or polypeptide or non-viral nucleic acid encoding the antibody, fragment or polypeptide, per kg (mg/kg) or total dose (mg). One of ordinary skill in the art can readily determine an appropriate dose range to treat a patient having a particular disease or disorder, based on these and other factors that are well known in the art. A therapeutically effective amount of antibody or antigen binding fragment or isolated polypeptide thereof, or non-viral nucleic acid encoding the antibody, fragment or polypeptide, may be between 1 to 50 mg, 1 to 25 mg, 5 to 30 mg, 10 to 35 mg, 25 to 200 mg, e.g., 50 to 100 mg, 25 to 50 mg, 50 to 75 mg, 100 to 150 mg, 150 to 200 mg, 200 mg to 300 mg, 300 mg to 400 mg, 400 mg to 500 mg, or 500 mg to 600 mg. A dose of antibody or antigen binding fragment or isolated polypeptide thereof, may include 1 to 50 μM, 1 to 40 μM, 5 to 30 μM, 10 to 35 μM, 25 to 200 μM, e.g., 50 to 100 μM, 25 to 50 μM, 50 to 75 μM, 100 to 150 μM, 150 to 200 μM, 200 μM to 300 μM, 300 μM to 400 μM, 400 μM to 500 μM, or 500 μM to 600 μM of the antibody or antigen binding fragment or isolated polypeptide thereof. A therapeutically effective amount of antibody or antigen binding fragment thereof or polypeptide or non-viral nucleic acid encoding the antibody, fragment or polypeptide, may be between 0.01 mg/kg to 0.1 mg/kg, 0.1 mg/kg to 1 mg/kg, 1 mg/kg to 20 mg/kg, e.g., 2 to 5 mg/kg, 5 to 7 mg/kg or 10 to 15 mg/kg.
In one embodiment, the composition is administered once to the mammal. It is believed that a single administration of the composition will result in persistent expression of the anti-human P2X4 antibody or fragment in the mammal with minimal side effects. However, in certain cases, it may be appropriate to administer the composition multiple times during a therapeutic period to ensure sufficient exposure of cells to the composition. For example, the composition may be administered to the mammal two or more times (e.g., 2, 3, 4, 5, 6, 6, 8, 9, or 10 or more times) during a therapeutic period.
The present disclosure provides pharmaceutically acceptable compositions which comprise a therapeutically-effective amount of gene transfer vector comprising a nucleic acid sequence which encodes an antibody directed against human P2X4, or a therapeutically effective amount of the antibody or antigen binding fragment thereof or polypeptide as described above.
The subject may be any animal, including a human and non-human animal. Non-human animals include all vertebrates, e.g., mammals and non-mammals, such as non-human primates, sheep, dogs, cats, cows, horses, chickens, amphibians, and reptiles, although mammals are envisioned as subjects, such as non-human primates, sheep, dogs, cats, cows and horses. The subject may also be livestock such as, cattle, swine, sheep, poultry, and horses, or pets, such as dogs and cats.
Exemplary subjects include human subjects suffering from or at risk for the medical diseases and conditions described herein. The subject is generally diagnosed with the condition of the subject disclosure by skilled artisans, such as a medical practitioner.
The methods of the disclosure described herein can be employed for subjects of any species, gender, age, ethnic population, or genotype. Accordingly, the term subject includes males and females, and it includes elderly, elderly-to-adult transition age subjects adults, adult-to-pre-adult transition age subjects, and pre-adults, including adolescents, children, and infants.
Examples of human ethnic populations include Caucasians, Asians, Hispanics, Africans, African Americans, Native Americans, Semites, and Pacific Islanders. The methods of the disclosure may be more appropriate for some ethnic populations such as Caucasians, especially northern European populations, as well as Asian populations.
The term subject also includes subjects of any genotype or phenotype as long as they are in need of the disclosure, as described above. In addition, the subject can have the genotype or phenotype for any hair color, eye color, skin color or any combination thereof. The term subject includes a subject of any body height, body weight, or any organ or body part size or shape.
The invention will be further described by the following non-limiting examples.
Extracted RNA from full-length antibody was isolated from mouse spleen after three immunizations with a 15 aa fragment of P2X4R (
PCR products were cloned into the pGEM-T Easy vector, transformed in Escherichia coli cells and about 100 clones of VH-VL transformants were later randomly selected for sequencing. Following sequencing, the anti-P2X4R recombinant scFvs were further cloned into the expression vector, pET32a. The scFvs were expressed and purified from E. coli cytoplasm as described previously for the generation of antibodies against the Zika virus and filovirus glycoproteins (Kunamneni et al. 2018; 2019), and CCK-B receptor (Kunamneni et al. 2019b; Westlund et al. 2021). Western blot of the cytoplasmic extracts showed specific detection of the soluble scFvs by the mouse anti-His tag antibody (
Any of HCDR1-3 and/or LCDR1-3, which are structurally related to SEQ ID Nos. 1-3 and 4-6, respectively, below (SEQ ID NOs: 57-59) may be employed in the antibodies or fragments thereof
SSV-SYMHWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISRMEAEDAATY
QSISDYLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVY
QGISNYLNWYQQKPDGTVKLLIYYTSSLHSGVPSRFSGSGSGTDYSLTISNLEPEDIATY
***: ***.*********************
Humanization of P2X4 Receptor scFv
Variable heavy (VH) and light (VL) regions of the mscFv95 parental were sequenced and compared using BLASTp (NCBI) to identify homology with known human VH and VL antibody sequences. The three most homologous candidates to the murine sequences were identified taking into account framework homology, maintenance of key framework residues, and canonical loop structure (based on a combined IMGT/Kabat CDR labelling approach). The three humanized VH domains and three humanized VL domains (designed 9 humanized variants (3VH×3VL)) were synthesized and cloned into the pET32a expression vector. Resultant recombinant chimeric antibodies were expressed, purified from E. coli Rosetta-gami cytoplasm and assessed by ELISA for kinetic interaction analyses. Yields of 3 to 5 mg/l of pure, soluble, active scFv fragments were obtained from shake flask cultures.
To determine whether the humanized scFvs could bind specifically to their corresponding rat and human P2X4 peptides, \ the soluble, purified scFv antibodies were assessed by ELISA assays. The humanized P2X4R scFv reacted only with rat and human P2X4 peptides, whereas the negative control anti-CCK-B scFv77-2 antibody did not react. All the humanized scFvs and mscFv95 parental demonstrated no cross-reactivity with Hu CCK-B receptor protein, indicating specificity for rat and human P2X4 peptides (
Amino acid sequences of humanized scFvs, HC1-LC1, HC2-LC1, HC2-LC3, HC3-LC3 and HC3-LC1 using Clustal Omega (SEQ ID NOs: 60-64). FRs and CDRs are determined by the IMGT information system. A normal 15 amino acid linker [(G4S) 3] joins the HC and LC chains. Alignments were color coded according to residue property groups.
TTEYSASVKGRFTISRDNSKNQFSLRLSSVTAADTAVYYCARWEGDLLYAMDYWGQGTTV
TTEYSASVKGRFTISRDNSKNQFSLRLSSVTAADTAVYYCARWEGDLLYAMDYWGQGTTV
TTEYSASVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARWEGDLLYAMDYWGQGTLV
TTEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARWEGDLLYAMDYWGQGTSV
TTEYSASVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARWEGDLLYAMDYWGQGTLV
Assessment of the Humanness of the Humanized scFv Variants by T20 Humanness Score
T20 Analyzer score of humanness ranged from 82-91 for the humanized full-length variable regions (HC and LC) and ranged from 88-97 for the humanized variable region frameworks. This exceeds the threshold of humanness (Table 1).
The humanness scores for the parental mouse and humanized antibodies are shown in the Table 1. Based on the disclosed method, a score of 84 or above is indicative of a human-like heavy chain framework, and a score of 90 or above is indicative of humanness for a kappa light chain framework. For full-length variable regions, cutoffs of 79 for the VH and 86 for the VK are recommended.
Mus
musculus
Homo
sapiens
Homo
sapiens
Homo
sapiens
Mus
musculus
Homo
sapiens
Homo
sapiens
Homo
sapiens
The humanness scores for the parental mouse and humanized antibodies are shown in the Table 1. Based on the disclosed method, a score of 84 or above is indicative of a human-like heavy chain framework, and a score of 90 or above is indicative of humanness for a kappa light chain framework. For full-length variable regions, cutoffs of 79 for the VH and 86 for the VK may be used.
Humanized P2X4R scFv Efficacy
Humanized P2X4R scFv (4 mg/kg, i.p.) was given to mice with FRICT-ION trigeminal nerve injury and the effect on mechanical hypersensitivity tested with von Frey filaments. The humanscFv was given in week 2 after model induction. Affinity matured humanized P2X4R receptor scFv antibody testing in a nerve neuropathic pain model demonstrated the product was highly efficacious for reduction the hypersensitivity pain measure (
Ribosome display is a powerful cell-free technology and this technology is widely used to select single-chain antibody fragments against the target of choice due to reduced self-immunogenicity as well as easy and inexpensive large-scale production. This rapid method was used to quickly develop repertoires of high-affinity antibodies targeting P2X4R for these studies. The scFvs developed with ribosome display have higher affinity, superior stability and solubility. Their small size has the potential for reduced self-immunogenicity. This may be the first ever demonstration of permanent reversal of chronic neuropathic pain related behaviors, e.g., by single dose administration of humanized P2X4R scFv.
Generation of Parental Murine P2X4R scFv Antibodies
Total RNA was isolated from spleens of five mice immunized with a custom extracellular peptide sequence (a.a. 301-313, C-RDLAGKEQRTLTK (SEQ ID NO: 54), MW 1516 g/mol) of rat P2X4R with an N-terminal biotin tag (GeneScript). The peptide has 11/13 a.a. residues identical to the human peptide and 12/13 identical to the mouse. cDNA libraries that encoded the immunoglobulin heavy and light chain variable regions (VH and VL) were constructed for ribosome display. Three rounds of panning of the ribosome-displayed scFv library against the P2X4R peptide were performed. PCR products cloned into pGEM-T vector were used to transform E. coli competent cells and about 100 clones of VH-VL transformants were later randomly selected for sequencing. Following sequencing, the recombinant anti-P2X4R scFvs were further cloned into the expression vector, pET32a. The scFvs were expressed and purified from E. coli cytoplasm as described previously for the generation of antibodies against the Zika virus and filovirus glycoproteins (Kunamneni et al. 2018; 2019a).
Detailed Method of the Generation of the Humanized scFv Antibodies Targeting P2X4 Receptor (P2X4R) Peptide Using Ribosome Display
Humanization and affinity maturation of P2X4R scFv followed from generation of a mouse parental. The parental scFv binds both the human and mouse forms of target P2X4 receptor extracellular peptide sequence corresponding to amino acid residues 301-313 (C-RDLAGKEQRTLTK (SEQ ID NO: 54), MW 1516 g/mol) of rat P2X4R. Also, it contains a kappa light chain and should bind Protein L. The goal is to identify humanized variants that bind both the human and mouse peptide targets with similar or improved affinity as compared to the parental mouse scFv, which is estimated to be 130-190 nM. The affinities of the humanized version of the scFv to the mouse and human peptides will first be determined during the humanization process, where biotinylated peptide are immobilized as ligand and the scFv will be tested as analytes.
P2X4R scFv Antibody Humanization and Affinity Maturation
The humanization process was used to design 3 VH×3 VL humanized variants for recombinant production, purification, and affinity measurement (for top 9) by Octet against human and rat forms of the target P2X4R peptide. The top humanized candidate(s) are selected for affinity maturation.
For the affinity maturation project, a ribosome display platform is used to obtain scFv variants. Randomization of the humanized scFv CDRs, as well as a pool of kappa light chain shuffled VL sequences, are employed to generate diverse libraries for affinity maturation. The variants are expressed in the bacterial cytoplasm and tested as cytoplasmic extracts (CPE's) to assess affinity for both the human and mouse peptides. The candidates may be screened utilizing the Carterra LSA platform, though alternate platforms for kinetics analysis, such as Octet, are available for screening. The candidates are selected for recombinant production to evaluate productivity and yield from a ProL/His Tag affinity purification. Kinetic analysis of the human and mouse peptides are performed. The scFv molecules are also assayed for purity and endotoxin requirement.
Variable heavy (VH) and light (VL) regions of the P2X4R murine antibody are sequenced, a mouse homology model of the fragment variable is created and compared using BLASTp (NCBI) to identify homology with known human VH and VL antibody sequences The three most homologous candidates to the murine sequences are identified taking into account framework homology, maintenance of key framework residues, and canonical loop structure (based on a combined IMGT/Kabat CDR labelling approach) using the Bioluminate software from Schrodinger. The five humanized VH domains and five humanized VL domains are synthesized, cloned into the pET32 expression vector and expressed in Rosetta-Gami competent cells. Resultant recombinant chimeric antibodies are purified and assessed by ELISA and Octet instrument for kinetic interaction analyses. A clone, with an equilibrium dissociation constant (KD) of <130 nM, is selected for affinity maturation.
Kunamneni et al. utilized a ribosome display platform to obtain scFv variants. Randomization of the humanized scFv CDRs, as well as a pool of kappa light chain shuffled VL sequences, are employed to generate diverse libraries for affinity maturation. The variants are expressed in the bacterial cytoplasm and tested as cytoplasmic extracts (CPE's) to assess affinity for both the human and mouse peptide. The candidates are screened utilizing the Carterra LSA platform, though alternate platforms for kinetics analysis, such as Octet for human and murine peptides, are available for screening. Top ten candidates are selected for recombinant production to evaluate productivity and yield from a ProL/Histag affinity purification. Kinetic analysis of the human and mouse peptides is performed. The scFv molecules are also assayed for purity and endotoxin requirements.
Identification of key positions supporting CDR loop structure and VH-VL interface.
Design humanized variants (3VH, 3VL) using the Bioluminate software.
The parental mouse scFv and selected humanized scFv are generated as ribosomal constructs as reference molecules for the campaign:
One library (CDR-focused and/or large size light chain combination library) is generated.
The panning strategy includes of one panning arm using biotinylated human Target P2X4R peptide on streptavidin beads. Stringency is increased during each successive round by decreasing antigen concentration on streptavidin beads, increasing the washes, and/or changing the duration of selections. The antibody variants are selected against reducing concentrations of target antigen through three consecutive selection rounds of ribosome display.
Panned outputs from library and round showing enrichment are moved forward for screening.
Following panning, 4×96-well output clones are prepared as master plates and stored for screening. Up to 384 bacterial cytoplasmic extracts (CPEs) of the output clones are assayed by ELISA for binding to human Target P2X4R peptide, incorporating the parental humanized and murine scFv as controls.
Up to 2×96 positive clones are sequenced and analyzed to identify sequence-unique clones. Sequence liability analysis is performed on top hits, including isoelectric point (pI) estimation, and identification of amino acid motifs that are sensitive to post-translational modifications (e.g. deamination, glycosylation, free cysteines).
Up to 96 target-binding, sequence-unique clones are re-arrayed. New CPE's are generated and confirmed by ELISA against:
Up to 10 scFv antibody fragments are cloned into an expression vector and recombinantly expressed using the 0.03 L CHO 14-day/Rosetta-Gami guaranteed low endotoxin process along with ProL resin/Histag affinity purification. Purified antibodies are analyzed by:
Computational modeling was done according to Tang & Cao (2021) using Schrödinger 2020-2 software (Schrödinger, Inc., New York, NY). An advanced computational protocol was used for determining interactions between scFv and rat P2X4R peptide involving several steps. I-TASSER analysis was used to produce three-dimensional structure model of protein molecules from amino acid sequences (Zhang, 2008; Yang et al., 2016). The predicted structural models were validated using high-resolution protein structure refinement (Zhu et al., 2014), ModRefiner (Xu & Zhang, Y, 2011), and fragment-guided molecular dynamics simulation (Zhang et al., 2011).
The refined models were docked according to the Fast Fourier Transform (FFT)-based program PIPER (Kozakov et al., 2006). Docking results were validated using LIGPLOT (Wallace et al., 1996). An interactive map identifies interactions such as hydrogen bonds, pi-pi interaction, side-chain bond, and backbone hydrogen bonds. Ligand-protein interaction maps also were used to predict the position and the interacting amino acids of the P2X4R scFv and the P2X4R protein.
The trigeminal nerve injury rodent models established in the literature for the study of trigeminal orofacial pain have been refined over the years and used by numerous labs in the field of pain research for study of the neuronal pathways and mechanisms causal in pain (Vos et al., 1994; Imamura et al., 1997; Anderson et al., 2003; Xu et al., 2008; Ma et al., 2012, Obuku et al., 2013; Ding et al., 2017). The latest refinement, development of the Foramen Rotundum Inflammatory Constriction of the Trigeminal InfraOrbital Nerve (FRICT-ION) model, is a minimally invasive variant and rapid method useful for both rats and mice (Montera and Westlund, 2020). BALB/c white mice were used since they remain cooperative through the 10 weeks of behavioral testing although C57b16 can also be used with specific KO animals. One lip of anesthetized mice is secured with cotton suture to expose the buccal-cheek crease where a tiny scalpel cut exposes trigeminal nerve roots innervating the teeth. A 3-mm section of chromic gut suture is slid along the infraorbital nerve into the foramen rotundum as it enters the skull. This rapid 5-10 min method produces hypersensitivity over the subsequent week that persists over the seven week experiment. Estimates are that in week 6, mice have experienced pain equivalent to 8 human years and can be considered chronic (Dutta & Sengupta, 2016), making it ideal for testing potential non-opioid therapeutics at chronic time points. Control mice (sham-operated) undergo the same surgical procedure without nerve manipulation (
Bioefficacy of High Affinity anti-P2X4R scFv Antibodies on Functional Phenotypes
Dose response (0.04, 0.4 mg/kg) was assessed in both male and female mice in blinded studies. The scFv antibody optimal dose or vehicle intraperitoneal (i.p.) injection was given to mice (control, sham, nerve injured). P2X4R scFv antibodies were administered in week 3 post FRICT-ION model induction, when anxiety- and depression-like behaviors were developing in mice with nerve injury.
A single injection of vehicle (phosphate buffered saline [PBS]), 0.04, 0.4, or 4.0 mg/kg anti-P2X4R receptor scFv95 (or scFv12 initial studies) was given intraperitoneally (i.p.) 3 weeks post model induction. Naïve mice received vehicle injection. The potential for effectiveness of the P2X4R scFvs was tested in both male and female mice with FRICT-ION since nerve injury induced chronic neuropathic pain can be followed long enough to upregulate P2X4Rs on immune cells. As indicated by abundant literature, female mice were resistant to the treatment and thus the data beyond mechanical threshold testing is not shown for most tests. Animals were maintained on normal mouse breeder chow, which is lower in soy protein content and known to reduce inflammation and alter pain responses (Seltzer et al., 1990; Tall & Raja, 2004).
Lead P2X4R scFv s were selected with the best binding affinity and tested for efficacy to reduce pain related measure in the FRICTION neuropathic pain model.
Reflexive Mechanical Response Threshold Measurement Using von Frey Filaments. Hypersensitivity persists indefinitely in the FRICTION model, thus the model is suitable for assessing pain-like responses equivalent to the timeframe of chronic clinical pain (Montera & Westlund, 2020). Mechanical hypersensitivity was tested on the whiskerpad, the innervation territory of the infraorbital nerve, with von Frey filament stimulation at baseline and weekly thereafter as we have reported previously (Ma et al., 2012; Lyons et al., 2015, 2018; Montera & Westlund, 2020; Vigil et al., 2020). Reflexive responses to mechanical stimuli applied with graded von Frey filaments was tested weekly. A single trial consisted of 5 applications of several selected mid-range von Frey filaments applied once every 3 to 4 seconds. If no positive response is evoked, the next stronger filament is applied (Chaplan et al., 1994). Responses to decreased gram force filaments indicated increased hypersensitivity (
Cognitive Dependent Anxiety- and Depression-Like Behaviors. Cognitive dependent behaviors are quantified once in week 8-10 after induction of the chronic model. Behaviors were video recorded for offline analysis.
Light dark place preference test. Collected variables in this two chamber test were (1) time spent in each chamber, (2) number of transitions between chambers, (3) number of rearing events, and 4) entry latency into the light chamber (File et al., 2005; Wiley et al., 2007; Yalcin et al., 2014; Lyons et al., 2018).
Sucrose splash test. Depression-like behavior was tested with the sucrose splash test where decreased grooming behavior was defined as a measure of depression-like behavior (David et al., 2009; Yalcin et al., 2011). Frequency, duration, and latency of grooming after spraying a 10% sucrose solution (˜250 μl) on the base of tail were measured during the following 10 min.
Single-chain Fragment variable antibodies (scFvs) are opening a new era of therapeutics, pharmacology, and pathophysiology research. These technologies have overcome previous challenges of providing therapeutic applications for G-protein-coupled receptors (GPCRs). More importantly, these small antibodies (˜27 kDa) are brain penetrant and praised as having promising biotherapeutic applications for the nervous and immune systems, now recognized as interactive in chronic pain. Using ribosome display, humanized scFvs directed to a unique thirteen amino acid (13-a.a.) extracellular peptide within the P2X4 receptor were engineered.
Humanized P2X4 receptor scFv (hP2X4R scFv) reverse mechanical and cold hypersensitivity in a rodent model of chronic neuropathic pain with weeks of continuing efficacy after only single intraperitoneal dose. Likewise, the single-chain Fragment variable (scFv) antibody totally prevents development of anxiety- and depression-like behaviors and cognitive deficits typical in chronic pain models.
The trigeminal nerve injury rodent models established in the literature for the study of trigeminal craniofacial pain have been refined over the years and used by numerous labs in the field of pain research for study of the neuronal pathways and mechanisms causal in pain. The latest refinement is development of the Foramen Rotundum Inflammatory Constriction of the Trigeminal InfraOrbital Nerve (FRICT-ION) model (Montera and Westlund, 2020). The model is a minimally invasive variant and rapidly induced method useful for both rats and mice producing a chronic craniofacial pain model. BALB/c white mice are used since they remain cooperative through the 10 weeks of behavioral testing, although C57b16 can also be used. One lip of anesthetized mice is secured with cotton suture to expose the buccal-cheek crease where a tiny scalpel cut exposes trigeminal nerve roots innervating the teeth. A 3-mm section of chromic gut suture is slid along the infraorbital nerve into the foramen rotundum as it enters the skull. This rapid 5-10 min method produces hypersensitivity over the subsequent week that persists over the seven week experiment. Estimates are that in week 6, mice have experienced pain equivalent to 8 human years and can be considered chronic, making it ideal for testing potential non-opioid therapeutics at chronic time points. Naïve mice remain untouched.
In the data presented here, FRICT-ION was induced in male BALB/c mice, then humanized scFv, HC3 LC3 hP2X4R scFv (4 mg/kg) was given intraperitoneally in week two or four post model induction. in this chronic pain model.
The emotion based symptoms that develop in mice with persisting chronic pain did not develop in mice treated with humanized hP2X4R H3 L3 scFv. Tests of anxiety- and depression-like behaviors were tested in week 8 after model induction in both treatment studies.
Anxiety tests in a two cubicle box with one side dark and the other side lighted. Mice with pain models prefer the dark cubicle.
Depression-like behavior is tested by spritzing 10% sucrose solution on the mouse rump. Mice with pain models do not show preference for the sweet treat. Naïve mice groom to retrieve the treat. The following may be measured: Number of Times Groomed, Total Groom Time or First Groom Latency.
The disclosed humanized scFv have a binding affinity 100-fold better than the murine parent scFv. The humanized scFv recognize a thirteen amino acid extracellular peptide fragment of human P2X4 receptor (P2X4R) with no sequence homology in database searches. The scFv were generated with cell-free ribosome display technology and recombinant antibody selection applied. In vivo validation in animal pain models with surgical induction of trigeminal nerve injury indicated that the humanized scFv is highly effective for reversing pain related behaviors to baseline within 2-3 weeks after a single administration (4 mg/kg, intraperitoneal). 9 humanized scFvs have nanomolar binding affinity. The humanized scFv restore behavioral, physiological, and affective responses in two neuropathic pain models (sciatic and trigeminal nerve injury) that mimic human neuropathic pain conditions. Subsequent study will determine it use for reduction of leg muscle and back inflammatory pain.
S
SLHSGVPSRFSGSGSGTDFTLTISSLQPEDFAYYYCQQYSKLPWTFGG
S
SLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYYCQQYSKLPWTFGG
Exemplary scFv having heavy or light chain variable regions wherein the CDRs disclosed above may include, for example, a polypeptide having:
CDRHC3]WGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVG
CDRHC3]WGQGTSVTVSSGGGGSGGGGSGGGGSDIQMTQTTSSLSASLG
CDRHC3]WGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQTTSSLSASLG
or a polypeptide with at least 80%, 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto in the non-CDR region(s), e.g., 1, 2, 3 4 or 5 substitutions, wherein CDRHC1-HC3 and CDRLC1-3 independently are a CDR from an antibody that binds P2X4.
Exemplary scFv having heavy or light chain variable regions, having the CDRs (DRs) disclosed above or other CDRs, may include, for example, a polypeptide having one of
or a polypeptide with at least 80%, 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto, e.g., 1, 2, 3 4 or 5 substitutions.
In one embodiment, an expression cassette is provided comprising nucleic acid sequences encoding an anti-P2X4 antibody or antigen binding fragment thereof, or a polypeptide, that inhibits human P2X4 activity, which sequence encodes at least one of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO: 4, YTS, or SEQ ID NO:6, or a polypeptide with at least, 80% 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto.
In one embodiment, an expression cassette is provided comprising nucleic acid sequences encoding an anti-P2X4 antibody or antigen binding fragment thereof, or a polypeptide, that inhibits human P2X4 activity, which sequence encodes a variable region having at least one of SEQ ID NO:17, SEQ ID NO: 18, SEQ ID NO:19, SEQ ID NO:20 or SEQ ID NO:21, or a polypeptide with at least 80%, 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto.
In one embodiment, an expression cassette is provided comprising nucleic acid sequences encoding an anti-P2X4 antibody or antigen binding fragment thereof, or a polypeptide, that inhibits human P2X4 activity, which sequence encodes a plurality of CDRs having at least one of SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, or SEQ ID NO:11, a polypeptide with at least 80%, 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto.
In one embodiment, an anti-P2X4 antibody or antigen binding fragment thereof, or a polypeptide, is provided that inhibits human P2X4 activity, which antibody or fragment thereof, or polypeptide, has at least one of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, YTS, or SEQ ID NO:6, or at least, 80% 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto.
In one embodiment, an anti-P2X4 antibody or antigen binding fragment thereof, or a polypeptide, that inhibits human P2X4 activity, is provided, which has a variable region having at least one of SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20 or SEQ ID NO:21, or at least 80%, 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto.
In one embodiment, an anti-P2X4 antibody or antigen binding fragment thereof, or a polypeptide, that inhibits human P2X4 activity, is provided which has a plurality of CDRs having at least one of SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, or SEQ ID NO:11, or at least 80%, 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto.
All publications, patents and patent applications are incorporated herein by reference. While in the foregoing specification, this invention has been described in relation to certain preferred embodiments thereof, and many details have been set forth for purposes of illustration, it will be apparent to those skilled in the art that the invention is susceptible to additional embodiments and that certain of the details herein may be varied considerably without departing from the basic principles of the invention.
This application claims the benefit of the filing date of U.S. application No. 63/290,414, filed on Dec. 16, 2021, the disclosure of which is incorporated by reference herein.
The invention was made with government support under VA grant BX002695 awarded by the Department of Veterans Affairs. The Government has certain rights in the invention.
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/US2022/081741 | 12/16/2022 | WO |
| Number | Date | Country | |
|---|---|---|---|
| 63290414 | Dec 2021 | US |
