The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Jan. 27, 2020, is named 130667-00302_SL.txt and is 122,224 bytes in size.
Clostridium perfringens Type A is a Gram-positive, spore-forming, anaerobe that is traditionally controlled by the addition of antibiotics in the feed for livestock and poultry as growth promoters, Antimicrobial Growth Promoters (AGP). However, development of antibiotic resistance has led to a decline in the use of antibiotics as AGP, and there is considerable effort by the government and the poultry industry to cease the use of AGP. Consequentially, there has been an increase in necrotic enteritis incidence in poultry.
C. perfringens-associated necrotic enteritis (NE) is a widespread disease in broilers. Afflicted poultry exhibit diarrhea, high morbidity with poor feed conversion, weight loss, and 10-40% mortality. NE affects the mucosa and causes epithelial degeneration, necrosis, inflammatory leukocytes in lamina propria, enterocyte sloughing, villi fusion and shortening. NE affects the chicken throughout its life cycle, and is on the rise with elimination/reduction of antibiotic use. In addition, severe NE is often associated with infections by Eimeria species, causing coccidiosis to result in mortality of broilers sometimes reaching as high as 50%.
Each year, Cp infection and NE cause great economic loss to the poultry industry and poses a significant threat to public health. There are currently no necrotic enteritis vaccines available for use in poultry. Accordingly, there is a need for a safe, effective vaccine to prevent NE in poultry.
The instant disclosure provides vaccines for protecting poultry and other animals from necrotic enteritis (NE) due to Cp infection. Surprisingly, the instant invention provides for the delivery of protective antigens, Cbh and/or CpeC, alone or in combination with Fba, PlcC, and/or GST-NetB. The disclosed protective antigens and combinations of protective antigens provide improved Salmonella vaccines which exhibit significantly improved protection against C. perfringens-induced necrotic enteritis in animals, such as broiler chickens and other poultry.
When delivered in a recombinant bacterium, the PlcC and GST-NetB antigens induce antibodies to counteract and prevent the toxicities caused by the Cp alpha toxin and the NetB toxin that damage the intestinal mucosa of a host, e.g., poultry, to cause it to thicken and be less able to absorb nutrients. This damage and thickening reduces the ability of the host to convert food to muscle, e.g., meat, in broilers, or to eggs in laying hens. Overall, this reduces performance and is an economic loss to poultry producers.
However, immune response against toxins would not contribute to diminishing levels of Cp colonization in poultry. In Listeria, production of bile hydrolase is attenuating, most likely due to reduced ability to colonize the intestinal tract. The inventors of the disclosure thus postulated that, if Cp produced a bile hydrolase, its loss might also diminish the ability to of Cp to colonize the gastrointestinal (GI) tract. The instant inventors, therefore, performed a bioinformatic search and identified a DNA sequence encoding a protein Cbh from C. perfringens. They next postulated that antibodies against Cbh would block its enzymatic activity and, thus, reduce the ability of Cp to colonize the GI tract.
The Cp enterotoxin CpeC is also a surface-localized protein that is responsible for disease in some animals, such as dogs and horses, but is the primary cause of food poisoning in humans if Cp gets into food, for example, potato salad. Cp is likely transmitted through the food chain from Cp colonizing poultry, similar to how Salmonella is transmitted through the food chain from poultry to humans. The inventors thus reasoned that induction of antibodies to CpeC would also reduce ability of Cp strains to colonize poultry.
These surprising ideas led the inventors to design codon-optimized sequences encoding synthesis of Cbh, the non-toxic C-terminal portion of the enterotoxin gene CpeC and Fba as antigens to induce immune responses that would be effective in reducing NE by reducing the ability of Cp to colonize the GI tract of poultry. Cp has a 28.6% GC content of DNA very different than the 52% GC of Salmonella. Thus, the redesign of coding sequences to fit Salmonella and permit synthesis of the antigens by the RASVs disclosed herein was surprising in terms of their success and is disclosed in more detail herein.
Recently, it has been found that the Fba antigen of C. perfringens also decreases colonization of C. perfringens in the intestinal tract of chickens (see, for example, U.S. Pat. No. 9,040,059, the entire contents of which are described herein). Therefore, the instant inventors also cloned the gene encoding Fba into plasmids encoding two other antigens encoding non-toxic derivatives of two C. perfringens toxins, alpha toxin and netB toxin, responsible for the tissue damage caused by C. perfringens to contribute the pathologies associated with NE in poultry. Thus, the combination of the genes encoding synthesis of Cbh, CpeC and Fba in a vaccine to prevent C. perfringens colonization have a maximal effect in reducing C. perfringens caused NE when delivered with a vaccine encoding synthesis of PlcC and a GST-NetB fusion to induce antibodies to neutralize the effects of the two C. perfringens toxins.
In one aspect, disclosed herein is a recombinant bacterium comprising a nucleic acid comprising: a sequence encoding a choloylglycine hydrolase (Cbh) antigen, or fragment thereof. In another aspect, disclosed herein is a recombinant bacterium comprising a nucleic acid comprising a sequence encoding a Clostridium perfringens enterotoxin (CpeC) antigen, or fragment thereof.
In one aspect, disclosed herein is a recombinant bacterium comprising a nucleic acid comprising a sequence encoding a choloylglycine hydrolase (Cbh) antigen, or fragment thereof, and a sequence encoding a Clostridium perfringens enterotoxin (CpeC) antigen, or fragment thereof. In one embodiment, the sequence encoding the Cbh antigen, or fragment thereof, and the sequence encoding the CpeC antigen, or fragment thereof, are operably linked. In one embodiment, the sequence encoding the Cbh antigen, or fragment thereof, and the sequence encoding the CpeC antigen, or fragment thereof, are operably linked to a repressor-regulatable promoter. In one embodiment, the sequence encoding the Cbh antigen, or fragment thereof, and the sequence encoding the CpeC antigen, or fragment thereof, are not operably linked. In one embodiment, the sequence encoding the Cbh antigen, or fragment thereof, is linked to a first repressor-regulatable promoter, and wherein the sequence encoding the CpeC antigen, or fragment thereof, is linked to a second repressor-regulatable promoter. In one embodiment, the repressor-regulatable promoter is selected from the group consisting of Ptrc, Plac, PT7lac, Ptac, PompA lacO, and Plpp lacO.
In one embodiment, wherein the Cbh antigen, or fragment thereof, is a fusion protein. In one embodiment, the CpeC antigen, or fragment thereof, is a fusion protein. In one embodiment, both the Cbh antigen, or fragment thereof, and the CpeC antigen, or fragment thereof, are fusion proteins.
In one embodiment, the Cbh antigen, or fragment thereof, comprises a signal sequence. In one embodiment, the CpeC antigen, or fragment thereof, comprises a signal sequence. In one embodiment, both the Cbh antigen, or fragment thereof, and the CpeC antigen, or fragment thereof, comprise a signal sequence. In one embodiment, the signal sequences are the same signal sequence. In one embodiment, the signal sequences are different signal sequences.
In one embodiment, the sequence encoding the Cbh antigen is codon-optimized for expression in the bacterium. In one embodiment, the sequence encoding the CpeC antigen is codon-optimized for expression in the bacterium. In one embodiment, both the sequence encoding the Cbh antigen, or fragment thereof, and the sequence encoding the CpeC antigen, or fragment thereof, are codon-optimized for expression in the bacterium. In one embodiment, the CpeC antigen is encoded by a cpeC-max sequence.
In one embodiment, the recombinant bacterium further comprises a sequence encoding a C-terminal domain of C. perfringens alpha toxin (PlcC) antigen, or fragment thereof. In one embodiment, the PlcC antigen, or fragment thereof, is a fusion protein. In one embodiment, the sequence encoding the PlcC antigen, or fragment thereof, is codon optimized for expression in the bacterium. In one embodiment, the sequence encoding the PlcC antigen, or fragment thereof, is operably linked to the sequence encoding the Cbh antigen. In one embodiment, the sequence encoding the PlcC antigen, or fragment thereof, is operably linked to the sequence encoding the CpeC antigen. In one embodiment, the sequence encoding the PlcC antigen, or fragment thereof, is operably linked to both the sequence encoding the Cbh antigen and the sequence encoding the CpeC antigen.
In one embodiment, the recombinant bacterium further comprises a sequence encoding a non-toxic necrotic enteritis B-like toxin (NetB) antigen, or fragment thereof. In one embodiment, the NetB antigen, or fragment thereof, is a fusion protein. In one embodiment, the fusion protein is a GST-NetB fusion protein. In one embodiment, the sequence encoding the NetB antigen, or fragment thereof, is codon optimized for expression in the bacterium. In one embodiment, the sequence encoding the NetB antigen, or fragment thereof, is operably linked to the sequence encoding the Cbh antigen, or fragment thereof. In one embodiment, the sequence encoding the NetB antigen, or fragment thereof, is operably linked to the sequence encoding the CpeC antigen, or fragment thereof. In one embodiment, the sequence encoding the NetB antigen, or fragment thereof is operably linked to both the sequence encoding the Cbh antigen, or fragment thereof and the sequence encoding the CpeC antigen, or fragment thereof. In one embodiment, the sequence encoding the NetB antigen, or fragment thereof, is operably linked to the sequence encoding the PlcC antigen, or fragment thereof. In one embodiment, the sequence encoding the NetB antigen, or fragment thereof, is operably linked to both the sequence encoding the Cbh antigen, or fragment thereof, and the sequence encoding the PlcC antigen, or fragment thereof. In one embodiment, the sequence encoding the NetB antigen, or fragment thereof, is operably linked to both the sequence encoding the CpeC antigen, or fragment thereof, and the sequence encoding the PlcC antigen, or fragment thereof. In one embodiment, the sequence encoding the NetB antigen, or fragment thereof, is operably linked to or all three of the sequences encoding the Cbh antigen, or fragment thereof, the CpeC antigen, or fragment thereof, and the PlcC antigen, or fragment thereof.
In one embodiment, the recombinant bacterium further comprises a sequence encoding a Fba antigen, or a fragment thereof. In one embodiment, the sequence encoding the Fba antigen, or fragment thereof, is codon optimized for expression in the bacterium. In one embodiment, the sequence encoding the Fba antigen, or fragment thereof, is operably linked to the sequence encoding the Cbh antigen, or fragment thereof. In one embodiment, the sequence encoding the Fba antigen, or fragment thereof, is operably linked to the sequence encoding the CpeC antigen, or fragment thereof. In one embodiment, the sequence encoding the Fba antigen, or fragment thereof, is operably linked to both the sequence encoding the Cbh antigen, or fragment thereof and the sequence encoding the CpeC antigen, or fragment thereof. In one embodiment, the sequence encoding the Fba antigen, or fragment thereof, is operably linked to the sequence encoding the PlcC antigen, or fragment thereof. In one embodiment, the sequence encoding the Fba antigen, or fragment thereof, is operably linked to both the sequence encoding the Cbh antigen, or fragment thereof, and the sequence encoding the PlcC antigen, or fragment thereof. In one embodiment, the sequence encoding the Fba antigen, or fragment thereof, is operably linked to both the sequence encoding the CpeC antigen, or fragment thereof, and the sequence encoding the PlcC antigen, or fragment thereof. In one embodiment, the sequence encoding the Fba antigen, or fragment thereof, is operably linked to all three of the sequences encoding the Cbh antigen, or fragment thereof, the CpeC antigen, or fragment thereof, and the PlcC antigen, or fragment thereof. In one embodiment, the sequence encoding the Fba antigen, or fragment thereof, is operably linked to the sequence encoding the NetB antigen, or fragment thereof. In one embodiment, the sequence encoding the Fba antigen, or fragment thereof, is operably linked to both the sequence encoding the CpeC antigen, or fragment thereof, and the sequence encoding the NetB antigen. In one embodiment, the sequence encoding the Fba antigen, or fragment thereof, is operably linked to both the sequence encoding the Cbh antigen, or fragment thereof, and the sequence encoding the NetB antigen. In one embodiment, the sequence encoding the Fba antigen, or fragment thereof, is operably linked to all three of the sequences encoding the Cbh antigen, or fragment thereof, the sequence encoding the CpeC antigen, or fragment thereof, and the sequence encoding the Fba antigen, or fragment thereof. In one embodiment, the sequence encoding the Fba antigen, or fragment thereof, is operably linked to all four of the sequences encoding the Cbh antigen, or fragment thereof, the sequence encoding the CpeC antigen, or fragment thereof, the sequence encoding the PlcC antigen, or fragment thereof, and the sequence encoding the Fba antigen, or fragment thereof.
In one embodiment, the nucleic acid is present in a plasmid in the bacterium, or in the chromosome of the bacterium.
For any of the antigens, or fragments thereof, disclosed herein, the antigen or fragment thereof may further comprise a signal sequence. In one embodiment, the signal sequence is a bla signal sequence. In one embodiment, the signal sequence is a bla-opt signal sequence. In one embodiment, the signal sequence is a dsbA signal sequence. In one embodiment, the signal sequence is an ompA signal sequence.
In one embodiment, the recombinant bacterium further comprises a deletion in gene encoding an aspartate-semialdehyde dehydrogenase. In one embodiment, the aspartate-semialdehyde dehydrogenase comprises an asd gene. In one embodiment, the gene encoding the aspartate-semialdehyde dehydrogenase comprises an asdA gene.
In one embodiment, the recombinant bacterium further comprises a deletion in a sifA gene.
In one embodiment, the recombinant bacterium comprises a balanced-lethal vector-host system.
In one embodiment, the bacterium is a Gram-negative bacterium. In one embodiment, the bacterium belongs to the family Enterobacteriaceae. In one embodiment, the bacterium is of the genus Salmonella. In one embodiment, the bacterium is a Salmonella enterica bacterium. In one embodiment, the bacterium is a Salmonella enterica subsp. enterica serovar Paratyphi A bacterium, a Salmonella enterica subsp. enterica serovar Enteritidis bacterium, a Salmonella enterica subsp. enterica serovar Typhi bacterium, a Salmonella enterica subsp. enterica serovar Typhimurium bacterium, Salmonella enterica subsp. enterica serovar Dublin, Salmonella Pullorum, Salmonella Gallinarum, or Salmonella enterica subsp. enterica serovar Choleraesuis.
In one embodiment, the bacterium is an attenuated derivative of a pathogenic bacterium.
In one aspect, disclosed herein is a pharmaceutical composition comprising a recombinant bacterium disclosed herein, and a pharmaceutically acceptable carrier.
In one aspect, disclosed herein is a pharmaceutical composition comprising at least a first recombinant bacterium disclosed herein, and at least a second recombinant bacterium disclosed herein, wherein the first recombinant bacterium and the second recombinant bacterium express different antigen(s), or fragments thereof, or different combinations of antigens, or fragments thereof. For example, in one embodiment, a composition may comprise a first recombinant bacterium comprising a nucleic acid encoding Cbh, or a fragment thereof, and a second recombinant bacterium comprising a nucleic acid encoding CpeC, or a fragment thereof. In one embodiment, the composition may further comprise a third recombinant bacterium which comprises a nucleic acid encoding PlcC. In one embodiment, the composition may further comprise a third recombinant bacterium which comprises a nucleic acid encoding NetB. In one embodiment, the composition may further comprise a third recombinant bacterium which comprises a nucleic acid encoding Fba. In one embodiment, the composition may further comprise a third recombinant bacterium which comprises a nucleic acid encoding PlcC and NetB. In one embodiment, the composition may further comprise a third recombinant bacterium which comprises a nucleic acid encoding PlcC and Fba. In one embodiment, the composition may further comprise a third recombinant bacterium which comprises a nucleic acid encoding NetB and Fba. In one embodiment, the composition may further comprise a third recombinant bacterium which comprises a nucleic acid encoding PlcC, NetB and Fba.
In one embodiment, a composition may comprise a first recombinant bacterium comprising a nucleic acid encoding Cbh, or a fragment thereof, and CpeC, or a fragment thereof, and at least a second recombinant bacterium comprising a nucleic acid encoding either PlcC; NetB; Fba; PlcC and NetB; PlcC and Fba; NetB and Fba; or PlcC, NetB and Fba. Any combination of the five antigens CpeC, Cbh, PlcC, NetB, and Fba in two or more recombinant bacterium, e.g., three recombinant bacterium, four recombinant bacterium, five recombinant bacterium, etc., in a composition, e.g., pharmaceutical composition, are contemplated herein.
In one aspect, disclosed herein is a vaccine comprising the recombinant bacterium disclosed herein or a composition, or pharmaceutical composition, disclosed herein.
In one aspect, disclosed herein is a method for eliciting an immune response against an antigen, or fragment thereof, in a subject, the method comprising administering to the subject an effective amount of the composition, or pharmaceutical composition disclosed herein, or the vaccine disclosed herein. In one embodiment, the subject is a chicken, turkey, goose, or duck.
Other aspects and iterations of the invention are described more thoroughly below.
In order that the disclosure may be more readily understood, certain terms are first defined. These definitions should be read in light of the remainder of the disclosure and as understood by a person of ordinary skill in the art. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by a person of ordinary skill in the art. Additional definitions are set forth throughout the detailed description.
As used herein, the term “recombinant bacterium” refers to a bacterial cell that has been genetically modified from its native state. For instance, a recombinant bacterium may comprise one or more nucleotide insertions, nucleotide deletions, nucleotide rearrangements, and nucleotide modifications. These genetic modifications may be introduced into the chromosome of the bacterium, or alternatively be present on an extrachromosomal nucleic acid (e.g., a plasmid). Recombinant bacteria of the disclosure may comprise a nucleic acid located on a plasmid. Alternatively, the recombinant bacteria may comprise a nucleic acid located in the bacterial chromosome (e.g., stably incorporated therein). In some embodiments, the recombinant bacterium is avirulent. In some embodiments the recombinant bacterium exhibits reduced virulence. In some embodiments, the recombinant bacterium is non-virulent. In some embodiments, the recombinant bacterium is pathogenic. In some embodiments, the recombinant bacterium is attenuated. In another embodiment, the recombinant bacterium is a recombinant derivative of a pathogenic bacterium.
As used herein, the term “gene” refers to a nucleic acid fragment that encodes a protein or a fragment thereof, or a functional or structural RNA molecule, and may optionally include a regulatory sequence preceding (5′ non-coding sequences) and following (3′ non-coding sequences) the coding sequence of the nucleic acid. In some embodiments, a “gene” does not include regulatory sequences preceding and following the coding sequence.
In one embodiment, the gene is a heterologous gene. In another embodiment, the nucleic acid is a heterologous nucleic acid. As used herein, the terms “heterologous gene” or “heterologous nucleic acid” refer to a gene or a nucleic acid sequence present in a recombinant cell, e.g., bacterium, that is not normally found in the wild-type cell, e.g., bacterium, in nature. In some embodiments, the heterologous gene or heterologous nucleic acid is exogenously introduced into a given cell. In some embodiments, a heterologous gene may include a gene, or fragment thereof, introduced into a non-native host cell. In some embodiments, the term “heterologous gene” includes a second copy of a native gene, or fragment thereof, that has been introduced into the host cell in addition to the corresponding native gene. A heterologous nucleic acid may also include, in some embodiments, a gene sequence that is naturally-found in a given cell but which has been modified, e.g., by regulation by a different promoter sequence, to expresses an unnatural amount of the nucleic acid and/or the polypeptide which it encodes; and/or two or more nucleic acid sequences that are not found in the same relationship to each other in nature.
As used herein, the term “endogenous gene” refers to a native gene that is present in its natural location in the genome of an organism (e.g., a bacterial chromosome).
A “promoter” as used herein, refers to a nucleic acid sequence that is capable of controlling the expression of a coding sequence or gene. A promoter may comprise one or more specific transcriptional regulatory sequences to further enhance expression and/or to alter the spatial expression and/or temporal expression of a nucleic acid. For example, a promoter may include one or more nucleic acids that are specifically recognized by a transcriptional activator protein (e.g., an enhancer element), a transcriptional repressor protein, a polymerase, and the like. The term “operably linked,” as used herein, means that expression of a nucleic acid sequence is under the control of a promoter with which it is spatially connected. A promoter may be positioned 5′ (upstream) of the nucleic acid sequence under its control. The distance between the promoter and a nucleic acid sequence to be expressed may be approximately the same as the distance between that promoter and the native nucleic acid sequence it controls. As is known in the art, variation in this distance may be accommodated without loss of promoter function. The nucleic acid sequences of the promoters described herein are known in the art, and methods of operably-linking these promoters to a gene (e.g., a gene encoding a repressor) are known in the art.
In some embodiments, the promoter for use as described herein may be regulated directly or indirectly by a sugar. For example, in some embodiments, the promoter is responsive to the level of arabinose, otherwise referred to herein as an “arabinose-regulatable promoter”. Generally speaking, arabinose may be present during the in vitro growth of a bacterium, while typically absent from host tissue. In one embodiment, the promoter is derived from an araC-ParaBAD system from Escherichia coli. The araC ParaBAD system is a tightly regulated expression system, which has been shown to work as a strong promoter induced by the addition of low levels of arabinose. The araC-araBAD promoter is a bidirectional promoter controlling expression of the araBAD nucleic acid sequences in one direction, and the araC nucleic acid sequence in the other direction.
For convenience, the portion of the araC-araBAD promoter that mediates expression of the araBAD nucleic acid sequences, and which is controlled by the araC nucleic acid sequence product, is referred to herein as ParaBAD. For use as described herein, a cassette with the araC nucleic acid sequence and the araC-araBAD promoter may be used. This cassette is referred to herein as araC ParaBAD. The AraC protein is both a positive and negative regulator of ParaBAD. In the presence of arabinose, the AraC protein is a positive regulatory element that allows expression from ParaBAD. In the absence of arabinose, the AraC protein represses expression from PParaBAD. Other enteric bacteria contain arabinose regulatory systems homologous to the araC-araBAD system from E. coli, including, for example, S. Typhimurium. For example, the E. coli AraC protein only activates E. coli ParaBAD (in the presence of arabinose) and not S. Typhimurium ParaBAD. Thus, an arabinose regulated promoter may be used in a recombinant bacterium that possesses a similar arabinose operon, without substantial interference between the two, if the promoter and the operon are derived from two different species of bacteria. Generally speaking, the concentration of arabinose necessary to induce expression is typically less than about 2% (w/w) in a culture media. In some embodiments, the concentration is less than about 1.5%, 1%, 0.5%, 0.2%, 0.1%, or 0.05% (w/w) in a culture media. In other embodiments, the concentration is 0.05% or below, e.g. about 0.04%, 0.03%, 0.02%, or 0.01% (w/w). In an exemplary embodiment, the concentration is about 0.05% (w/w) in a culture media.
In other embodiments, the promoter may be responsive to the level of maltose in the environment, otherwise referred to herein as a “maltose-regulatable promoter”. In some embodiments, the recombinant bacteria described herein are cultured in a medium comprising maltose. The malT gene encodes MalT, a positive regulator of four maltose-responsive promoters (PPQ, PEFG, PKBM, and PS). The combination of malT and a mal promoter creates a tightly regulated expression system that has been shown to work as a strong promoter induced in the presence of maltose. Unlike the araC-ParaBAD system, malT expression is regulated by a promoter (i.e., PT) that is functionally unrelated to the other mal promoters. PT is not regulated by MalT. The malEFG-malKBM promoter is a bidirectional promoter that controls expression of the malKBM nucleic acid sequences in one direction, and the malEFG nucleic acid sequences in the other direction. For convenience, the portion of the malEFG-malKBM promoter that mediates expression of the malKBM nucleic acid sequence, and which is controlled by MalT, is referred to herein as PKBM, and the portion of the malEFG-malKBM promoter that mediates expression of the malEFG nucleic acid sequence, and which is controlled by MalT, is referred to herein as PEFG. Full induction of PKBM requires the presence of the MalT binding sites of PEFG. For use in the vectors and systems described herein, a gene cassette comprising a nucleic acid sequence encoding MalT and a mal promoter may be used. This gene cassette is referred to herein as malT-Pmal. In the presence of maltose, the MalT is a positive regulatory element that allows for expression mediated by Pmal. Generally speaking, the concentration of maltose necessary to induce expression is typically less than about 1% (w/w) in a culture media. In some embodiments, the concentration is less than about 1.0%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%, 0.3% 0.2%, 0.1%, or 0.05% (w/w) in a culture media. In other embodiments, the concentration is 0.05% or below, e.g. about 0.04%, 0.03%, 0.02%, or 0.01% (w/w). In an exemplary embodiment, the concentration is about 0.2% to about 0.4% (w/w) in a culture media.
In still other embodiments, the promoter used herein is responsive to the level of rhamnose in the environment, otherwise referred to herein as a “rhamnose-regulatable promoter”. Analogous to the araC-ParaBAD system described above, the rhaRS-PrhaBAD activator-promoter system is tightly regulated by rhamnose. Expression from the rhamnose promoter (PrhaBAD) is induced to high levels in the presence of rhamnose. In some embodiments, the bacteria are cultured in the presence of rhamnose. Rhamnose is commonly found in bacteria but rarely found in human subjects. The rhaBAD operon is controlled by the PrhaBAD promoter. This promoter is regulated by two activators, RhaS and RhaR, and the corresponding nucleic acid sequences belong to one transcription unit that is located in the opposite direction of the rhaBAD nucleic acid sequences. In the presence of L-rhamnose, RhaR binds to the PrhaRS promoter and activates the production of RhaR and RhaS RhaS together with L-rhamnose, in turn, bind to the PrhaBAD and the PrhaT promoters and activates the transcription of the structural nucleic acid sequences. Full induction of the arabinose, maltose and rhamonse regulated promoters described herein requires binding of the Crp-cAMP complex, which is a key regulator of catabolite repression.
Although both L-arabinose and L-rhamnose act directly as inducers of the expression of regulons that mediate their catabolism, important differences exist in regard to the regulatory mechanisms. L-Arabinose acts as an inducer with the activator AraC in the positive control of the arabinose regulon. However, the L-rhamnose regulon is subject to a regulatory cascade, and is therefore subject to even tighter control than the araC-ParaBAD system. L-Rhamnose acts as an inducer with the activator RhaR for synthesis of RhaS, which in turn acts as an activator in the positive control of the rhamnose regulon. In the present disclosure, rhamnose may be used to interact with the RhaR protein and then the RhaS protein may activate transcription of a nucleic acid sequence operably-linked to the PrhaBAD promoter.
In still other embodiments, the promoter may be responsive to the level of xylose in the environment, referred to herein as a “xylose-regulatable promoter”. Generally, xylose concentrations of between 0.0002% to 0.63% (w/w) in the environment activate the expression of a xylose inducible promoter described herein (see, e.g., Bhaysar et al. (2001) App. Environ. Microbiol. 67(1): 403-10 (34)). The xylR-PxylA system is another well-established inducible activator-promoter system. Xylose induces xylose-specific operons (e.g., xylE, xylFGHR, and xylAB) that are regulated by XylR and the cyclic AMP-Crp system. The XylR protein serves as a positive regulator by binding to two distinct regions of the xyl nucleic acid sequence promoters. As with the araC-ParaBAD system described above, the xylR-PxylAB and/or xylR-PxylFGH regulatory systems may be used. In these embodiments, xylose interacting with the XylR protein activates transcription of nucleic acid sequences operably-linked to either of the two Pxyl promoters.
As used herein, the term “exogenous” refers to a substance (e.g., a nucleic acid or polypeptide) present in a cell other than its native source. The term exogenous can refer to a nucleic acid or a protein that has been introduced by a process involving the hand of man into a biological system such as a cell or organism in which it is not normally found or in which it is found in undetectable amounts. A substance can be considered exogenous if it is introduced into a cell or an ancestor of the cell that inherits the substance. In contrast, the term “endogenous” refers to a substance that is native to the biological system or cell.
A “pharmaceutical composition,” as used herein, refers to a composition comprising an active ingredient (e.g., a recombinant bacterium described herein) with other components such as a physiologically suitable carrier and/or excipient.
As used herein, the term “pharmaceutically acceptable carrier” or a “pharmaceutically acceptable excipient” refers to a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, manufacturing aid (e.g., lubricant, talc magnesium, calcium or zinc stearate, or steric acid), or solvent encapsulating material, involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body. Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient. Some examples of materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, methylcellulose, ethyl cellulose, microcrystalline cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) lubricating agents, such as magnesium stearate, sodium lauryl sulfate and talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol (PEG); (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (15) alginic acid; (16) pyrogen-free water; (17) isotonic saline (e.g., phosphate-buffered saline (PBS)); (18) Ringer's solution; (19) ethyl alcohol; (20) pH buffered solutions; (21) polyesters, polycarbonates and/or polyanhydrides; (22) bulking agents, such as polypeptides and amino acids (23) serum component, such as serum albumin, HDL and LDL; (24) C2-C12 alcohols, such as ethanol; and (25) other non-toxic compatible substances employed in pharmaceutical formulations. Wetting agents, coloring agents, release agents, coating agents, disintegrating agents, binders, sweetening agents, flavoring agents, perfuming agents, protease inhibitors, plasticizers, emulsifiers, stabilizing agents, viscosity increasing agents, film forming agents, solubilizing agents, surfactants, preservative and antioxidants can also be present in the formulation. The terms such as “excipient”, “carrier”, “pharmaceutically acceptable excipient” or the like are used interchangeably herein.
A “plasmid” or “vector” includes a nucleic acid construct designed for delivery to a host cell or transfer between different host cells. The nucleic acid incorporated into the plasmid can be operatively linked to an expression control sequence when the expression control sequence controls and regulates the transcription and translation of that polynucleotide sequence.
As used herein, the terms “protein” and “polypeptide” are used interchangeably herein to designate a series of amino acid residues, connected to each other by peptide bonds between the alpha-amino and carboxy groups of adjacent residues. The terms “protein”, and “polypeptide” refer to a polymer of amino acids, including modified amino acids (e.g., phosphorylated, glycated, glycosylated, etc.) and amino acid analogs, regardless of its size or function. The terms “protein” and “polypeptide” as used herein refer to both large polypeptides and small peptides. The terms “protein” and “polypeptide” are used interchangeably herein when referring to a gene product and fragments thereof. Thus, exemplary polypeptides or proteins include gene products, naturally occurring proteins, homologs, orthologs, paralogs, fragments and other equivalents, variants, fragments, and analogs of the foregoing.
A “nucleic acid” or “nucleic acid sequence” may be any molecule, preferably a polymeric molecule, incorporating units of ribonucleic acid, deoxyribonucleic acid or an analog thereof. The nucleic acid can be either single-stranded or double-stranded. A single-stranded nucleic acid can be one nucleic acid strand of a denatured double-stranded DNA. Alternatively, it can be a single-stranded nucleic acid not derived from any double-stranded DNA. In one aspect, the nucleic acid can be DNA. In another aspect, the nucleic acid can be RNA. Suitable nucleic acid molecules are DNA, including genomic DNA or cDNA. Other suitable nucleic acid molecules are RNA, including mRNA, rRNA, and tRNA.
Alterations of the native amino acid sequence can be accomplished by any of a number of techniques known to one of skill in the art. Mutations can be introduced, for example, at particular loci by synthesizing oligonucleotides containing a mutant sequence, flanked by restriction sites enabling ligation to fragments of the native sequence. Following ligation, the resulting reconstructed sequence encodes an analog having the desired amino acid insertion, substitution, or deletion. Alternatively, oligonucleotide-directed site-specific mutagenesis procedures can be employed to provide an altered nucleotide sequence having particular codons altered according to the substitution, deletion, or insertion required. Techniques for making such alterations are very well established and include, for example, those disclosed by Walder et al. (35); Bauer et al. (36); Craik (37); Smith et al. (38); and U.S. Pat. Nos. 4,518,584 and 4,737,462, which are herein incorporated by reference in their entireties. Any cysteine residue not involved in maintaining the proper conformation of the polypeptide also can be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking. Conversely, cysteine bond(s) can be added to the polypeptide to improve its stability or facilitate oligomerization.
The term “statistically significant” or “significantly” refers to statistical significance and generally means a two standard deviation (2SD) or greater difference.
As used herein, the term “host cell” refers to a cell in an organism to which the recombinant bacterium is being administered in order to, for example, induce an immune response. In one embodiment, a host is a bird, equine, or human and a host cell refers, respectively, to a bird cell, an equine cell, or a human cell.
Other than in the operating examples, or where otherwise indicated, all numbers expressing quantities of ingredients or reaction conditions used herein should be understood as modified in all instances by the term “about.” The term “about” when used in connection with percentages can mean ±1%.
The articles “a” and “an,” as used herein, should be understood to mean “at least one,” unless clearly indicated to the contrary.
The phrase “and/or,” when used between elements in a list, is intended to mean either (1) that only a single listed element is present, or (2) that more than one element of the list is present. For example, “A, B, and/or C” indicates that the selection may be A alone; B alone; C alone; A and B; A and C; B and C; or A, B, and C. The phrase “and/or” may be used interchangeably with “at least one of” or “one or more of” the elements in a list.
Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
I. Recombinant Bacteria
The present disclosure provides, in some embodiments, a recombinant bacterium capable of regulated expression of at least one nucleic acid sequence encoding an antigen of interest, e.g., CpeC, and/or Cbh, alone or in combination with Fba, PlcC, and/or GST-NetB. The recombinant bacterium described herein is particularly effective in eliciting an immune response (e.g., protective immunity) against the antigen(s) of interest because the bacterium comprise multiple recombinant regulatory systems that permit the bacterium to replicate upon administration and to colonize lymphoid tissues in a subject in order to elicit potent immune responses. However, after multiple replication cycles in vivo, the bacterium ultimately exhibits an attenuated phenotype which allows for safe administration to a subject, for example as a vaccine composition. Thus, using the phenotype of the recombinant bacteria described herein can be altered upon administration to a subject.
In some embodiments, the recombinant bacterium described herein can be regulated for delayed attenuation in vivo. In some embodiments, the recombinant bacterium described herein is capable of regulated delayed expression of a nucleic acid encoding an antigen of interest. In some embodiments, the recombinant bacterium described herein is capable of both regulated expression of at least one nucleic acid encoding at least one antigen of interest and regulated attenuation. In some embodiments, each of these properties is directly or indirectly regulated by the abundance of at least one sugar (e.g., arabinose, rhamnose, mannose, xylose, maltose, and galactose).
In some embodiments, the bacterium described herein is a Gram negative bacterium. In some embodiments, the bacterium is a pathogenic bacterium. In some embodiments, the bacterium is an avirulent bacterium. In some embodiments, the bacterium belongs to the Enterobaceteriaceae. In some embodiments, the bacterium belongs to a genus selected from: Alterococcus, Aquamonas, Aranicola, Arsenophonus, Brenneria, Budvicia, Buttiauxella, Candidatus Phlomobacter, Cedeceae, Citrobacter, Edwardsiella, Enterobacter, Erwinia, Escherichia, Ewingella, Hafnia, Klebsiella, Kluyvera, Leclercia, Leminorella, Moellerella Morganella, Obesumbacterium, Pantoea, Pectobacterium, Photorhabdus, Plesiomonas, Pragia, Proteus, Providencia, Rahnella, Raoultella, Salmonella, Samsonia, Serratia, Shigella, Sodalis, Tatumella, Trabulsiella, Wigglesworthia, Xenorhbdus, or Yersinia, Yokenella. In some embodiments, the bacterium is a pathogenic species of Enterobaceteriaceae. In some embodiments, the bacterium is selected from the group consisting of Escherichia coli, Shigella, Edwardsiella, Salmonella, Citrobacter, Klebsiella, Enterobacter, Serratia, Proteus, Morganella, Providencia and Yersinia. In some embodiments, the bacterium is of the genus Salmonella. In some embodiments, the bacterium is of the genus Yersinia. In some embodiments, the bacterium is of the genus Edwardsiella. In some embodiments, the bacterium is of a genus, species, or strain commonly used as a live or attenuated vaccine.
Some embodiments of the instant disclosure comprise a species or subspecies of the Salmonella genera (e.g., S. enterica or S. bongori). For instance, the recombinant bacterium may be a Salmonella enterica serovar, including, for example, Paratyphi A, Enteritidis, Typhi, and Typhimurium. In some embodiments, the recombinant bacterium is of the serovar S. Typhimurium, S. Typhi, S. Paratyphi, S. Gallinarum, S. Enteritidis, S. Choleraesius, S. Arizonae, S. Newport, S. Heidelberg, S. Infantis, S. Cholerasiuis, S. Pullorum, or S. Dublin
A recombinant bacterium derived from Salmonella may be particularly suited to use as a vaccine. For example, oral infection of a host with a Salmonella strain typically leads to colonization of the gut-associated lymphoid tissue (GALT) or Peyer's patches, which leads to the induction of a generalized mucosal immune response to the recombinant bacterium. Further penetration of the bacterium into the mesenteric lymph nodes, liver and spleen may augment the induction of systemic and cellular immune responses directed against the bacterium. Thus, the use of recombinant Salmonella for oral immunization stimulates all three branches of the immune system, which is particularly important for immunizing against infectious disease agents that colonize on and/or invade through mucosal surfaces. In some embodiments, the recombinant bacterium described herein is used to induce an immune response in poultry (e.g., as a vaccine). When used in poultry, the recombinant bacterium may be administered by course spray and thereby inoculate the conjunctiva-associated lymphoid tissue (CALT) via eye exposure, the nasal-associated lymphoid tissue (NALT) and bronchus-associated lymphoid tissue (BALT) via respiratory exposure and the GALT via oral exposure. In some embodiments, the recombinant bacterium described herein is administered to newly-hatched chicks.
A. Antigens
The recombinant bacterium disclosed herein comprises a nucleic acid encoding at least one antigen of interest, e.g., two antigens of interest, three antigens of interest, four antigens of interest, or five antigens of interest.
In another aspect, disclosed herein are compositions comprising more than one recombinant bacterium, each recombinant bacterium comprising a nucleic acid encoding at least one antigen of interest, e.g., two antigens of interest, three antigens of interest, four antigens of interest, or five antigens of interest. For example, in one embodiment, a composition may comprise a first recombinant bacterium comprising a nucleic acid encoding Cbh, or a fragment thereof, and a second recombinant bacterium comprising a nucleic acid encoding CpeC, or a fragment thereof. In one embodiment, the composition may further comprise a third recombinant bacterium which comprises a nucleic acid encoding either PlcC; NetB; Fba; PlcC and NetB; PlcC and Fba; NetB and Fba; or PlcC, NetB and Fba. In one embodiment, a composition may comprise a first recombinant bacterium comprising a nucleic acid encoding Cbh, or a fragment thereof, and CpeC, or a fragment thereof, and a second recombinant bacterium comprising a nucleic acid encoding either PlcC; NetB; Fba; PlcC and NetB; PlcC and Fba; NetB and Fba; or PlcC, NetB and Fba. Any combination of the five antigens CpeC, Cbh, PlcC, NetB, and Fba in two or more recombinant bacterium, e.g., three recombinant bacterium, four recombinant bacterium, five recombinant bacterium, etc., in a composition are contemplated herein.
As used herein, “antigen” refers to a biomolecule capable of eliciting an immune response in a host. In some embodiments, the antigen of interest is derived from C. perfringens. In some embodiments, an antigen may be a protein, or fragment of a protein, e.g., an antigenic fragment of a protein.
In one embodiment, the antigen of interest is Cbh. In one embodiment, the antigen of interest is CpeC. In one embodiment, the antigens of interest are Cbh and CpeC. In one embodiment, the antigens of interest are Cbh and Fba. In one embodiment, the antigens of interest are CpeC and Fba. In one embodiment, the antigens of interest are Cbh, CpeC, and Fba. In one embodiment, the antigens of interest are Cbh and PlcC. In one embodiment, the antigens of interest are CpeC and PlcC. In one embodiment, the antigens of interest of interest are Cbh, CpeC, and PlcC. In one embodiment, the antigens of interest are Cbh, CpeC, PlcC, and Fba. In one embodiment, the antigens of interest are Cbh and NetB. In one embodiment, the antigens of interest are CpeC and NetB. In one embodiment, the antigens of interest are Cbh, CpeC, and NetB. In one embodiment, the antigens of interest are Cbh, CpeC, NetB, and Fba. In one embodiment, the antigens of interest are Cbh, CpeC, NetB, Fba, and PlcC.
In one embodiment, the antigen(s) of interest are expressed in a recombinant bacterium disclosed herein. In another embodiment, the antigen(s) of interest, or combinations of the antigen(s) of interest are expressed in a first recombinant bacterium disclosed herein and at least a second recombinant bacterium disclosed herein.
In some embodiments, the nucleic acid comprises a plc gene, or fragment thereof, e.g., C-terminal fragment thereof (also known as PlcC). Plc is a member of a class of membrane-associated enzymes that cleave phospholipids just before the phosphate group. plc is present in Clostridium perfringens, Bacillus cereus, Staphylococcus aureus, Bacillus thuringiensis, Listeria monocytogenes, and Pseudomonas aeruginosa. See, for example, U.S. Pat. No. 9,040,059, the entire contents of which are expressly incorporated herein by reference in their entirety.
The nucleic acid sequence of the gene encoding the C-terminal fragment of PlcC from C. perfringens is provided below:
The amino acid sequence of the C. perfringens PlcC protein encoded by the nucleic acid of SEQ ID NO: 32 is provided below:
In some embodiments, the nucleic acid comprises a gene, wherein the gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the nucleic acid sequence of SEQ ID NO: 32. In some embodiments, the nucleic acid comprises a gene, wherein the gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the nucleic acid sequence of SEQ ID NO: 32.
In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a PlcC protein, wherein said PlcC protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 33. In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a PlcC protein, wherein said PlcC protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the amino acid sequence of SEQ ID NO: 33.
In some embodiments, the nucleic acid comprises a gene that is operably-linked to a regulatable promoter. In some embodiments, the regulatable promoter is Ptrc or another promoter regulated by LacI.
In some embodiments, the nucleic acid comprises a netB gene, e.g., a non-toxic netB fusion, e.g., a NetB-GST fusion (see, for example, Jiang et al., 2015). NetB is a pore-forming toxin produced by C. perfringens and plays a major role in the pathogenesis of avian necrotic enteritis.
The nucleic acid sequence of the C. perfringens GST-netB gene fusion is provided below, with the GST coding region underlined:
ATGGCCCCTATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCAC
TCGACTTCTTTTGGAATATCTTGAAGAAAAATATGAAGAGCATTTGTATG
AGCGCGATGAAGGTGATAAATGGCGAAACAAAAAGTTTGAATTGGGTTTG
GAGTTTCCCAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACA
GTCTATGGCCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTG
GTTGTCCAAAAGAGCGTGCAGAGATTTCAATGCTTGAAGGAGCGGTTTTG
GATATTAGATACGGTGTTTCGAGAATTGCATATAGTAAAGACTTTGAAAC
TCTCAAAGTTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCG
AAGATCGTTTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCAT
CCTGACTTCATGTTGTATGACGCTCTTGATGTTGTTTTATACATGGACCC
AATGTGCCTGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAACGTATTG
AAGCTATCCCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCA
TGGCCTTTGCAGGGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCC
AAAATCGGATCTGGTTCCGCGTGGATCCCCAGGAATTCCAAGCGAACTGA
The amino acid sequence of the C. perfringens GST-NetB fusion protein encoded by the nucleic acid of SEQ ID NO: 34 is provided below, with the GST portion underlined:
MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL
EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL
DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH
PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA
WPLQGWQATFGGGDHPPKSDLVPRGSPGIPSELNDINKIELKNLSGEIIK
In some embodiments, the nucleic acid comprises a netB gene fusion, wherein the netB gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the nucleic acid sequence of SEQ ID NO: 34. In some embodiments, the nucleic acid comprises a netB gene fusion, wherein the netB gene fusion comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the nucleic acid sequence of SEQ ID NO: 34.
In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a NetB fusion protein, wherein said NetB fusion protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 35. In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a NetB fusion protein, wherein said NetB fusion protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the amino acid sequence of SEQ ID NO: 35.
In some embodiments, the nucleic acid comprises a netB gene fusion that is operably-linked to a regulatable promoter. In some embodiments, the regulatable promoter is Ptrc or another promoter regulated by LacI.
In some embodiments, the nucleic acid comprises a cbh gene. Cbh is an enzyme belongs to a family of hydrolases, which act on carbon-nitrogen bonds other than peptide bonds, specifically in linear amides.
The nucleic acid sequence of the C. perfringens cbh gene is provided below:
The amino acid sequence of the C. perfringens Cbh protein encoded by the nucleic acid of SEQ ID NO: 36 is provided below:
In some embodiments, the nucleic acid comprises a cbh gene, wherein the cbh gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the nucleic acid sequence of SEQ ID NO: 36. In some embodiments, the nucleic acid comprises a cbh gene, wherein the cbh gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the nucleic acid sequence of SEQ ID NO: 36.
In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a Cbh protein, wherein said Cbh protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 37. In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a Cbh protein, wherein said Cbh protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the amino acid sequence of SEQ ID NO: 37.
In some embodiments, the nucleic acid comprises a cbh gene that is operably-linked to a regulatable promoter. In some embodiments, the regulatable promoter is Ptrc or another promoter regulated by LacI.
In some embodiments, the nucleic acid comprises a non-toxic cpe gene, or antigenic fragment thereof, such as the non-toxic receptor part of the toxin, also called CpeC. Cpe is an enzyme that binds to claudin family proteins, and alters the membrane permeability of cells. cpe is present in all of the species in the Clostridium genus.
The nucleic acid sequence encoding the non-toxic receptor part of the C. perfringens cpe gene, which has been 5% codon optimized and is also known as cpeC, is provided below:
The nucleic acid sequence encoding the non-toxic receptor part of the C. perfringens cpe gene, which has been codon optimized and is also known as cpeC-max, is provided below:
The amino acid sequence of the C. perfringens CpeC protein encoded by the nucleic acid of SEQ ID NOs: 38 and 39 is provided below:
In some embodiments, the nucleic acid comprises a gene, wherein the gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the nucleic acid sequence of SEQ ID NO: 38 or SEQ ID NO:39. In some embodiments, the nucleic acid comprises a gene, wherein the gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the nucleic acid sequence of SEQ ID NO: 38 or SEQ ID NO:39.
In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a CpeC protein, wherein said CpeC protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 40. In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a CpeC protein, wherein said CpeC protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the nucleic acid sequence of SEQ ID NO: 40.
In some embodiments, the nucleic acid comprises a cpeC gene that is operably-linked to a regulatable promoter. In some embodiments, the regulatable promoter is Ptrc or another promoter regulated by LacI.
In some embodiments, the nucleic acid comprises a C. perfringens fba gene, or a fragment thereof. The nucleic acid sequence of a codon-optimized C. perfringens fba gene is provided below:
The amino acid sequence of the C. perfringens Fba protein encoded by the nucleic acid of SEQ ID NO: 41 is provided below
In some embodiments, the nucleic acid comprises fba gene, wherein the fba gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the nucleic acid sequence of SEQ ID NO: 41. In some embodiments, the nucleic acid comprises a fba gene, wherein the fba gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the nucleic acid sequence of SEQ ID NO: 41.
In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a Fba protein, wherein said Fba protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 42. In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a Fba protein, wherein said Fba protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the amino acid sequence of SEQ ID NO: 42.
In some embodiments, the nucleic acid comprises fba gene that is operably-linked to a regulatable promoter. In some embodiments, the regulatable promoter is Ptrc.
In an exemplary embodiment, the antigen elicits a protective immune response in a subject. As used herein, “protective” means that the immune response contributes to the lessening of any symptoms associated with infection of a host with the pathogen the antigen was derived from or designed to elicit a response against. For example, a protective antigen from a pathogen, such as Clostridium, may induce an immune response that helps to ameliorate symptoms associated with Clostridium infection or reduce the morbidity and mortality associated with infection with the pathogen or may reduce the ability of Clostridium to infect and colonize the host. The use of the term “protective” in this disclosure does not necessarily require that the host is completely protected from the effects of the pathogen.
In one embodiment, protection can be achieved by reducing the ability of the pathogen to colonize or persist in an animal host, as would be the case of induced immune responses against Cbh and/or CpeC; or inhibit the virulence aspects of the pathogen by neutralizing toxins, such as the alpha toxin and NetB toxin that cause damage to the intestinal epithelium of the host.
Immunogenicity of the bacterium may be augmented and/or modulated by constructing strains that also express sequences for cytokines, adjuvants, and other immunomodulators.
In further embodiments, a nucleic acid sequence encoding an antigen may comprise a secretion signal. In one embodiment of the invention, a signal sequence can be a blaSS signal sequence or an optimized blaSS signal sequence, as described in more detail herein.
As stated above, the level of synthesis of an antigen of interest may be optimized by modifying the nucleic acid sequence encoding the repressor and/or promoter. As used herein, “modify” refers to an alteration of the nucleic acid sequence of the repressor and/or promoter that results in a change in the level of transcription of the nucleic acid sequence encoding the repressor, or that results in a change in the level of synthesis of the repressor. For instance, in one embodiment, modify may refer to altering the start codon of the nucleic acid sequence encoding the repressor. Generally speaking, a GTG or TTG start codon, as opposed to an ATG start codon, may decrease translation efficiency ten-fold. In another embodiment, modify may refer to altering the Shine-Dalgarno (SD) sequence of the nucleic acid sequence encoding the repressor. The SD sequence is a ribosomal binding site generally located 6-7 nucleotides upstream of the start codon. The SD consensus sequence is AGGAGG, and variations of the consensus sequence may alter translation efficiency. In yet another embodiment, modify may refer to altering the distance between the SD sequence and the start codon. In still another embodiment, modify may refer to altering the −35 sequence for RNA polymerase recognition. In a similar embodiment, modify may refer to altering the −10 sequence for RNA polymerase binding. In an additional embodiment, modify may refer to altering the number of nucleotides between the −35 and −10 sequences. In an alternative embodiment, modify may refer to optimizing the codons of the nucleic acid sequence encoding the repressor to alter the level of translation of the mRNA encoding the repressor. For instance, non-A rich codons initially after the start codon of the nucleic acid sequence encoding the repressor may not maximize translation of the mRNA encoding the repressor. Similarly, the codons of the nucleic acid sequence encoding any of the proteins described herein may be codon-optimized, i.e., altered so as to mimic the codons from highly synthesized proteins of a particular organism. In a further embodiment, modify may refer to altering the GC content of the nucleic acid sequence encoding the repressor to change the level of translation of the mRNA encoding the repressor. Methods of modifying a nucleic acid sequence are known in the art.
In some embodiments, more than one modification or type of modification may be performed to optimize the expression level of a nucleic acid described herein (e.g., a nucleic acid encoding a repressor or antigen of interest). For instance, at least one, two, three, four, five, six, seven, eight, or nine modifications, or types of modifications, may be performed to optimize the expression level of a nucleic acid described herein. By way of non-limiting example, when the repressor is LacI, then the nucleic acid sequence of LacI and the promoter may be altered so as to increase the level of LacI synthesis. In one embodiment, the start codon of the LacI repressor may be altered from GTG to ATG. In another embodiment, the SD sequence may be altered from AGGG to AGGA. In yet another embodiment, the codons of lacI may be optimized according to the codon usage for highly synthesized proteins of Salmonella. In a further embodiment, the start codon of lacI may be altered, the SD sequence may be altered, and the codons of lacI may be optimized.
In some embodiments, the recombinant bacterium comprises a nucleic acid that is located in a plasmid or vector. As used herein, “vector” refers to an autonomously replicating nucleic acid unit. The present disclosure can be practiced with any known type of vector, including viral, cosmid, phasmid, and plasmid vectors. The most preferred type of vector is a plasmid vector. In some embodiments, the plasmid or vector is a high copy plasmid. In some embodiments, the plasmid or vector is a low copy plasmid or vector.
As is well known in the art, plasmids and other vectors may possess a wide array of promoters, multiple cloning sequences, transcription terminators, etc., and vectors may be selected so as to control the level of expression of the nucleic acid sequence encoding an antigen by controlling the relative copy number of the vector. In some instances in which the vector might encode a surface localized adhesin as the antigen, or an antigen capable of stimulating T-cell immunity, it may be preferable to use a vector with a low copy number such as at least two, three, four, five, six, seven, eight, nine, or ten copies per bacterial cell. A non-limiting example of a low copy number vector may be a vector comprising the pSC101 ori.
In some embodiments, the plasmid comprises a nucleic acid sequence encoding an aspartate-semialdehyde dehydrogenase gene (e.g., asdA). These plasmids may be advantageously used to complement a bacterium that comprises an aspartate-semialdehyde dehydrogenase gene mutation (e.g., asdA). In some embodiments, the plasmid is selected from the group consisting of pYA3342, pYA3337, and pYA3332.
In other cases, an intermediate copy number vector might be optimal for inducing desired immune responses. For instance, an intermediate copy number vector may have at least 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 copies per bacterial cell. A non-limiting example of an intermediate copy number vector may be a vector comprising the p15A ori.
In still other cases, a high copy number vector might be optimal for the induction of maximal antibody responses. A high copy number vector may have at least 31, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 copies per bacterial cell. In some embodiments, a high copy number vector may have at least 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, or 400 copies per bacterial cell. Non-limiting examples of high copy number vectors may include a vector comprising the pBR ori or the pUC ori.
Additionally, vector copy number may be increased by selecting for mutations that increase plasmid copy number. These mutations may occur in the bacterial chromosome but are more likely to occur in the plasmid vector.
Preferably, vectors used herein do not comprise antibiotic resistance markers to select for maintenance of the vector.
Promoters for use in the embodiments described herein are known in the art. One of skill in the art would recognize that the selection of a repressor dictates, in part, the selection of the promoter to be used to regulate the expression of a nucleic acid described herein. For instance, if the repressor is LacI, then the promoter may be selected from the group consisting of LacI responsive promoters, such as Ptrc, Plac, PT7lac, Ptac, PompA lacO, and Plpp lacO. If the repressor is C2, then the promoter may be selected from the group consisting of C2 responsive promoters, such as P22 promoters PL and PR. If the repressor is C1, then the promoter may be selected from the group consisting of C1 responsive promoters, such as λ promoters PL and PR.
In each embodiment herein, the promoter regulates expression of a nucleic acid sequence. In some embodiments, the promoter comprises a regulatory sequence controlled by a repressor, such that expression of the nucleic acid sequence is repressed when the repressor is synthesized (e.g., during in vitro growth of the bacterium), but expression of the nucleic acid sequence encoding an antigen is high when the repressor is not synthesized (e.g., in vivo). Generally speaking, the concentration of the repressor will decrease with every cell division after expression of the gene encoding the repressor ceases. In some embodiments, the concentration of the repressor decreases such that high levels of expression of the nucleic acid sequence that is being regulated is achieved after about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 divisions of the bacterium. In an exemplary embodiment, the concentration of the repressor decreases enough to allow high-level expression of the nucleic acid sequence encoding an antigen after about 5 divisions of the bacterium in vivo.
In certain embodiments, the promoter may comprise other regulatory elements. For instance, the promoter may comprise lacO if the repressor is LacI. This is the case with the lipoprotein promoter Plpp lacO that is regulated by LacI since it possesses the LacI binding domain lacO. In one embodiment, the repressor is a LacI repressor and the promoter is Ptrc.
In some embodiments, the expression of the nucleic acid sequence regulated by a repressor is repressed in vivo. Expression may be “repressed” or “partially repressed” when it is about 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, 5%, 1%, or even less than 1% of the expression under non-repressed conditions. Thus although the level of expression under conditions of “complete repression” might be exceeding low, it is likely to be detectable using very sensitive methods since repression can never by absolute.
Conversely, the expression of the nucleic acid sequence encoding the antigen should be high when the expression of the repressor is repressed. For instance, if the repressor is not synthesized during growth of the recombinant bacterium in a host, the expression of the nucleic acid under the control of the repressor will be high. As used herein, “high level” expression refers to expression that is strong enough to elicit an immune response to the antigen. Consequently, the copy number correlating with high level expression can and will vary depending on the antigen and the type of immune response desired. Methods of determining whether an antigen elicits an immune response such as by measuring antibody levels or antigen-dependent T cell populations or antigen-dependent cytokine levels are known in the art, and methods of measuring levels of expression of antigen encoding sequences by measuring levels of mRNA transcribed or by quantitating the expression level of a protein are also known in the art.
In each of the above embodiments, a recombinant bacterium capable of regulated expression may also be attenuated. “Attenuated” refers to the state of the bacterium wherein the bacterium has been weakened from its wild-type fitness by some form of recombinant or physical manipulation. This includes altering the genotype of the bacterium to reduce its ability to cause disease. However, the bacterium's ability to colonize the gut (in the case of Salmonella) and induce immune responses is, preferably, not substantially compromised.
In an exemplary embodiment, a recombinant bacterium may be attenuated as described above. In which case, both regulated attenuation and regulated expression of an antigen encoding sequence may be dependent upon a sugar regulatable system. Consequently, the concentration of sugar (e.g., arabinose) needed for optimal expression of the regulated antigen encoding sequence may not be the same as the concentration for optimal expression of attenuation. In an exemplary embodiment, the concentration of arabinose for the optimization of both regulated attenuation and regulated expression of sequences encoding antigen will be substantially the same. Accordingly, the promoter and/or the nucleic acid sequence encoding an attenuation protein may be modified to optimize the system. Methods of modification are detailed above. Briefly, for example, the SD ribosome binding sequence may be altered, and/or the start codon may be altered from ATG to GTG for the nucleic acid sequences fur and phoPQ, so that the production levels of Fur and PhoPQ are optimal for both the regulated attenuation phenotype and the regulated expression when growing strains with a given concentration of arabinose. One of skill in the art will appreciate that other nucleic acid sequences, in addition to fur and phoPQ, may also be altered as described herein in combination with other well-known protocols. In addition, these attenuating nucleic acid sequences may be regulated by other systems using well-established protocols known to one of skill in the art. For example, they may be regulated using with promoters dependent on addition of maltose, rhamnose, or xylose rather than arabinose.
B. Attenuation
In some embodiments, the recombinant bacterium described herein is modified such that the expression of one or more genes, e.g., virulence genes, can be regulated in a sugar-responsive manner. In some embodiments, one or more endogenous genes, e.g., virulence genes, are deleted from the bacterial chromosome. In some embodiments, the deletion is a partial deletion of the endogenous gene. In some embodiments, the deletion is a full-length deletion of the endogenous gene. In some embodiments, the gene, e.g., virulence gene, is genetically-altered to prevent transcription and/or translation of the gene encoding the protein. In some embodiments, the endogenous gene is genetically altered to insert a transcriptional terminator in the open reading frame of the gene. In some embodiments, a regulatory region of the gene, e.g., virulence gene, is genetically-modified to alter (e.g., decrease) the expression of the gene. In some embodiments, the promoter of a gene, e.g., virulence gene, is altered to include one or more regulatory elements (e.g., a sugar-responsive promoter).
Triple-sugar regulated Salmonella vaccines are also disclosed in PCT/US18/14860, filed on Jan. 23, 2018 and published as WO18/136938, the entire contents of which are expressly incorporated herein by reference in their entirety.
In some embodiments, the recombinant bacterium described herein is modified to comprise a nucleic acid comprising a gene. In some embodiments, the recombinant bacterium is modified to comprise a nucleic acid comprising a gene, whereby an endogenous copy of the gene in the bacterial chromosome has been altered and/or deleted. In some embodiments, the nucleic acid comprises a gene that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to an endogenous gene in the bacterial chromosome that has been deleted and/or altered. In some embodiments, the nucleic acid comprises a gene that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to an endogenous gene in the bacterial chromosome that has been deleted and/or altered. In some embodiments, the nucleic acid comprises a gene from a bacterial species, subspecies, serovar, or strain that is different than the bacterial species of the recombinant bacterium.
In some embodiments, the nucleic acid comprises a gene from a bacterial species, subspecies, serovar, or strain that is the same as the bacterial species of the recombinant bacterium. In some embodiments, the nucleic acid comprises a gene that is operably-linked to a regulatable promoter (e.g., a sugar-regulatable promoter). In some embodiments, the nucleic acid comprises a gene that is operably-linked to a rhamnose-regulatable promoter, a xylose-regulatable promoter, a galactose-regulatable promoter, an arabinose-regulatable promoter, or a maltose-regulatable promoter. In some embodiments, the nucleic acid comprising the gene is located in a plasmid in the bacterium. In some embodiments, the nucleic acid comprising the gene is located in the bacterial chromosome. In some embodiments, the nucleic acid comprising the gene is located at the chromosomal locus corresponding to the locus of an endogenous gene that has been deleted or altered in the bacterial chromosome. In some embodiments, the nucleic acid is codon-optimized (e.g., to improve expression of the nucleic acid in the recombinant bacterium).
1. O-Antigen Synthesis Genes
In some embodiments, the recombinant bacterium comprises a deletion in an endogenous O-antigen synthesis gene. In some embodiments, the recombinant bacterium comprises a deletion in an endogenous O-antigen ligase gene. In some embodiments, the deletion is a partial deletion of the endogenous O-antigen ligase gene. In some embodiments, the deletion is a full-length deletion of the endogenous O-antigen ligase gene. In some embodiments, the endogenous O-antigen ligase gene is genetically altered to insert a transcriptional terminator in the open reading frame of the gene. In some embodiments, a regulatory region of the endogenous O-antigen ligase gene is genetically-modified to alter (e.g., decrease) the expression of the gene. In some embodiments, the promoter of an endogenous O-antigen ligase gene is altered to include one or more regulatory elements (e.g., a sugar-responsive promoter). In some embodiments, the promoter of an endogenous O-antigen ligase gene is altered to increase the spacing between the Shine-Delgarno sequence and the start codon of the gene. In some embodiments, the promoter of an endogenous O-antigen ligase gene is altered to decrease the spacing between the Shine-Delgamo sequence and the start codon of the gene. In some embodiments, the Shine-Delgamo (SD) sequence, the start codon, the second codon and/or third codons of the O-antigen ligase gene is altered to increase the frequency of adenine nucleobases in order to enhance the translation efficiency of the gene. In some embodiments, the Shine-Delgamo (SD) sequence, the start codon, the second codon and/or third codons of the O-antigen ligase gene is altered to reduce the frequency of adenine nucleobases in order to decrease the translation efficiency of the gene. In some embodiments, the O-antigen ligase gene is waaL (also known as rfaL). The O-antigen ligase WaaL is necessary to ligate polysaccharide to the lipid A-LPS core moiety. Deletion of waaL results in an intact lipid A-LPS core with no O-antigen or individual sugars attached to it. In some embodiments, the O-antigen ligase gene is selected from the group consisting of waaG (also known as rfaG), waal (also known as rfaI), rfaH, waaJ (also known as rfaJ), wbaP (also known as rfbP), wzy (also known as rfc), waaP, waaQ, waaF, waaP, waaC, and waaA.
In some embodiments, the recombinant bacterium described herein is modified to comprise a nucleic acid comprising an O-antigen ligase gene. In some embodiments, the nucleic acid comprising an O-antigen ligase gene is located on a plasmid in the bacterium. In some embodiments, the nucleic acid comprising an O-antigen ligase gene is located on a chromosome of the bacterium. In some embodiments, the nucleic acid comprising an O-antigen ligase gene is located at the chromosomal locus corresponding to the locus of an endogenous O-antigen ligase gene that has been deleted or altered in the bacterial chromosome. In some embodiments, the recombinant bacterium is modified to comprise a nucleic acid comprising an O-antigen ligase gene, whereby an endogenous copy of the gene in the bacterial chromosome has been altered and/or deleted. In some embodiments, the nucleic acid comprises a Salmonella O-antigen ligase gene.
The nucleic acid sequence of an exemplary Salmonella waaL gene is provided below:
The amino acid sequence of the WaaL protein encoded by the nucleic acid of SEQ ID NO: 1 is provided below:
In some embodiments, the nucleic acid comprises a Salmonella waaL gene (provided as SEQ ID NO: 1). In some embodiments, the nucleic acid comprises a waaL gene, wherein the waaL gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the nucleic acid sequence of SEQ ID NO: 1. In some embodiments, the nucleic acid comprises a waaL gene, wherein the waaL gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the nucleic acid sequence of SEQ ID NO: 1.
In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding an O-antigen ligase, wherein said O-antigen ligase comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 2. In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding an O-antigen ligase, wherein said O-antigen ligase comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the nucleic acid sequence of SEQ ID NO: 2.
In some embodiments, the nucleic acid comprises an O-antigen ligase gene from a bacterial species, subspecies, serovar, or strain that is different than the bacterial species of the recombinant bacterium. In some embodiments, the nucleic acid comprises an O-antigen ligase gene from a bacterial species, subspecies, serovar, or strain that is the same as the bacterial species of the recombinant bacterium.
In some embodiments, the nucleic acid comprises an O-antigen ligase gene that is operably-linked to a regulatable promoter (e.g., a sugar-regulatable promoter). In some embodiments, the nucleic acid comprises an O-antigen ligase gene (e.g., waaL) that is operably-linked to a sugar-regulatable promoter. Advantageously, recombinant bacterial strains comprising a nucleic acid comprising an O-antigen ligase gene (e.g., waaL) that is operably linked to a sugar regulatable promoter will synthesize normal LPS in the presence of the sugar (e.g., rhamnose) in vitro, but will form rough LPS in vivo due to the absence of the sugar that activates the promoter and therefore, the expression of the O-antigen ligase. Without wishing to be bound by any particular theory, using this strategy, the bacterium will expose conserved LPS core oligosaccharide and have enhanced production of conserved outer membrane proteins (OMPs; e.g., porins) which may lead to improved immunogenicity and aid in the production of a cross-protective immune response against an antigen of interest synthesized in the bacterium in vivo. In some embodiments, the sugar regulatable promoter exhibits increased activity (e.g., increased transcription) in the presence of a specific sugar and decreased activity in the absence of a sugar. In some embodiments, the nucleic acid comprises an O-antigen ligase gene that is operably-linked to a rhamnose-regulatable promoter (e.g., a sugar-regulatable promoter). In some embodiments, the nucleic acid comprises an O-antigen ligase gene that is operably-linked to an arabinose-regulatable promoter (e.g., a sugar-regulatable promoter). In some embodiments, the use of a rhamnose-regulatable promoter (e.g., rhaSR PrhaBAD) may be preferable to an arabinose-regulatable promoter because a relatively higher concentration is required to activate an arabinose-regulatable promoter as compared to a rhamnose-regulatable promoter (see, e.g., Giacalone et al. (2006) BioTechniques 40(3): 355-366 (39), the entire contents of which are incorporated herein by reference). In some embodiments, the recombinant bacterium comprises the mutation ΔwaaL/ΔpagL:TT rhaSR PrhaBAD waaL.
2. Lipid A Deacylase Genes
In some embodiments, the recombinant bacterium comprises a deletion in an endogenous lipid A deacylase gene. In some embodiments, the deletion is a partial deletion of the endogenous lipid A deacylase gene. In some embodiments, the deletion is a full-length deletion of the endogenous lipid A deacylase gene. In some embodiments, the endogenous lipid A deacylase gene is genetically altered to insert a transcriptional terminator in the open reading frame of the gene. In some embodiments, a regulatory region of the endogenous lipid A deacylase gene is genetically-modified to alter (e.g., decrease) the expression of the gene. In some embodiments, the promoter of an endogenous lipid A deacylase gene is altered to include one or more regulatory elements (e.g., a sugar-responsive promoter). In some embodiments, the lipid A deacylase gene is pagL. Bacterial comprising a deletion of the lipid A deacylase gene pagL have been found to produced increased amounts of outer membrane vesicles (see, e.g., Elhenawy et al. (2016) mBio 7(4): e00940-16 (40)). Deletion of the pagL gene of Salmonella does not impair bacterial virulence (see, e.g., Man et al. Proc. Nat'l. Acad. Sci. USA 111: 7403-8 (41)). Without wishing to be bound by any particular theory, in some embodiments, the recombinant bacterium described herein comprise one or more genetic modifications which results in increased vesiculation (i.e., increased vesicle production) which may be particularly advantageous in inducing an immune response in the host against an antigen of interest that is expressed by the bacterium.
3. Phosphomannose Isomerase Genes
In some embodiments, the recombinant bacterium comprises a deletion in an endogenous phosphomannose isomerase gene. Phosphomannose isomerase, also known as mannose-6 phosphate isomerase, catalyzes the reversible interconversion of fructose 6-phosphate to mannose 6-phosphate. Mannose 6-phosphate is then converted to GDP-mannose and used for the synthesis of O-antigen side chains. Bacteria with deletions of the phosphomannose isomerase gene pmi are not mannose sensitive and are partially attenuated (see, e.g., Collins et al. (1991) Infect. Immun. 59(3): 1079-85 (42)). These pmi mutants synthesize wild-type levels of LPS O-antigen side chains when grown in media containing mannose, and are both attenuated but highly immunogenic (see, e.g., Curtiss et al. (2007) “Induction of host immune responses using Salmonella-vectored vaccines.” In: Brogden K A, Minion F C, Cornick N, Stanton T B, Zhang Q, Nolan L K, Wannemuehler M J, ed. Virulence Mechanisms of Bacterial Pathogens. 4th ed. Washington D.C.: ASM Press (43)). In some embodiments, the deletion of the endogenous phosphoisomerase gene is a partial deletion. In some embodiments, the deletion of the endogenous phosphomannose isomerase gene is a full-length deletion. In some embodiments, the endogenous phosphomannose isomerase gene is genetically altered to insert a transcriptional terminator in the open reading frame of the gene. In some embodiments, a regulatory region of the endogenous phosphomannose isomerase gene is genetically-modified to alter (e.g., decrease) the expression of the phosphomannose isomerase gene. In some embodiments, the promoter of an endogenous phosphomannose isomerase gene is altered to include one or more regulatory elements (e.g., a sugar-responsive promoter). In some embodiments, the phosphomannose isomerase gene is pmi.
In some embodiments, the bacterium comprises a deletion of a pmi gene. In some embodiments, the bacterium comprises a Δpmi-2426 mutation. A bacterium comprising a Δpmi-2426 mutation, grown in the presence of mannose, is capable of synthesizing a complete LPS O-antigen. Non-phosphorylated mannose, which is the form required for bacterial uptake, is unavailable in vivo. Hence, a bacterium comprising a Δpmi-2426 mutation loses the ability to synthesize LPS O-antigen serotype specific side chains in vivo and the number of O-antigen side chains attached to the LPS core decreases by about half after each cell division in vivo. The LPS that is synthesized comprises a core structure that is substantially similar across all Salmonella enterica serotypes except S. Arizona. This results in a bacterium that is capable of eliciting an immune response against at least two Salmonella serotypes without substantially inducing an immune response specific to the serotype of the bacterial vector. In some embodiments, the bacterium is capable of eliciting an immune response against all Salmonella serotypes without substantially inducing an immune response specific to the serotype of the bacterial vector.
A recombinant bacterium described herein that comprises a deletion in apmi mutation may also comprise other mutations that ensure that mannose available to the bacterium during in vitro growth is used for LPS O-antigen synthesis. For instance, a bacterium may comprise a Δ(gmd-fcl)-26 mutation. This mutation deletes two nucleic acid sequences that encode enzymes for conversion of GDP-mannose to GDP-fucose, ensuring that mannose available to the bacterium during in vitro growth is used for LPS O-antigen synthesis and not colanic acid production. Similarly, a bacterium may comprise the Δ(wcaM-wza)-8 mutation, which deletes all 20 nucleic acid sequences necessary for colanic acid production, and also precludes conversion of GDP-mannose to GDP-fucose.
4. UDP-Galactose Epimerase Genes
UDP-Gal is the precursor for the assembly of the LPS O-antigen side chains, the LPS outer core, for colanic acid and other polysaccharide polymers having galactose as a constituent (44). UDP-Gal is synthesized by conversion of glucose-1-P to UDP-Glu by the enzyme glucose-1-P uridylyltransferase encoded by the galU gene with UDP-Glu converted to UDP-Gal by the enzyme UDP-galactose epimerase encoded by the galE gene (45, 46). Strains grown in the presence of galactose can synthesize UDP-Gal by a different pathway in which galactose after uptake is converted to galactose-1-P by galactose kinase encoded by the galK gene which in tern is converted to UDP-Gal by the enzyme UDP-Gal transferase encoded by the galT gene (45). Strains with a galE mutation are unable to synthesize LPS outer core and LPS O-antigen unless galactose is supplied in the growth medium (47). Because of these facts and properties Salmonella strains with galE mutations can synthesize LPS when grown with galactose and are invasive to colonize lyphoid tissues, but loose this ability in vivo due to the unavailability of free galactose such that they gradualy loose LPS components as they multiply in the infected or immunized animal host. Just like pmi mutants, they gradually become attenuated due to increasing susceptibility to complement-mediated cytotoxicity and enhanced phagocytosis and killing my macrophages. However, the supply of galactose to such galE mutants can lead to cell death by lysis since the accummunlation of Gal-1-P and UDP-Gal is toxic (30, 48, 49). Because of this, growth of galE mutants in the presence of galactose selects for mutations in genes for galactose uptake or in the galK and galT genes so that toxic products are not synthesized. Unfortunately, such galactose-resistant mutants are no longer able to make LPS and are totally attenuated, non-invasive and non-immunogenic (30, 50). To circumvent these problems to enable use of galE mutations in Salmonella vaccine strains, we have devised a means to generate galE mutants with the potential for reversable synthesis of LPS dependent on the presence or absence of galactose that are resistant to galactose with no selection of mutants unable to synthesize UDP-Gal for LPS synthesis.
5. Iron Acquisition Regulatory Genes
In some embodiments, the recombinant bacterium comprises a deletion in the endogenous promoter Pfur, which regulates the expression of the fur gene. Fur represses the transcription of genes involved in iron acquisition in the presence of free iron. When iron concentrations become low in the bacterium, Fur ceases to be synthesized which leads to the constitutive expression of genes encoding iron acquisition proteins (e.g., iron-regulated outer membrane proteins (IROMPs). In some embodiments, the deletion is a partial deletion of the endogenous Pfur promoter. In some embodiments, the deletion is a full-length deletion of the endogenous Pfur promoter. In some embodiments, the endogenous Pfur promoter is genetically-modified to alter (e.g., decrease) the expression of the fur gene. In some embodiments, the endogenous Pfur promoter is genetically altered to comprise a transcriptional terminator.
In some embodiments, the recombinant bacterium comprises a nucleic acid comprising a fur gene (e.g., a fur gene from the same bacterial species as the recombinant bacterium).
In some embodiments, the nucleic acid comprising afur gene is located on a plasmid in the bacterium. In some embodiments, the nucleic acid comprising a fur gene is located on a chromosome of the bacterium. In some embodiments, the nucleic acid comprising afur gene is located at the chromosomal locus corresponding to the locus of an endogenous fur gene that has been deleted or altered in the bacterial chromosome. In some embodiments, the recombinant bacterium is modified to comprise a nucleic acid comprising afur gene, whereby an endogenous copy of the fur gene in the bacterial chromosome has been altered and/or deleted.
The nucleic acid sequence of an exemplary Salmonella fur gene is provided below:
The amino acid sequence of the Fur protein encoded by the nucleic acid of SEQ ID NO: 3 is provided below:
In some embodiments, the nucleic acid comprises a Salmonella fur gene (provided as SEQ ID NO: 3). In some embodiments, the nucleic acid comprises a fur gene, wherein the fur gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the nucleic acid sequence of SEQ ID NO: 3. In some embodiments, the nucleic acid comprises a fur gene, wherein the fur gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the nucleic acid sequence of SEQ ID NO: 3.
In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a Fur protein, wherein said Fur protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 4. In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a Fur protein, wherein said Fur protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the amino acid sequence of SEQ ID NO: 4.
In some embodiments, the nucleic acid comprises a fur gene from a bacterial species, subspecies, serovar, or strain that is the same as the bacterial species of the recombinant bacterium.
In some embodiments, the nucleic acid comprises a fur gene that is operably-linked to a regulatable promoter (e.g., a sugar-regulatable promoter). In some embodiments, the nucleic acid comprises a fur gene that is operably-linked to a sugar-regulatable promoter. In some embodiments, the sugar regulatable promoter exhibits increased activity (e.g., increased transcription) in the presence of a specific sugar and decreased activity in the absence of a sugar. In some embodiments, the nucleic acid comprises a fur gene that is operably-linked to a rhamnose-regulatable promoter (e.g., a sugar-regulatable promoter). In some embodiments, the nucleic acid comprises a fur gene that is operably-linked to an arabinose-regulatable promoter (e.g., a sugar-regulatable promoter). In some embodiments, the arabinose-regulatable promoter is araCParaBAD. In some embodiments, the recombinant bacterium comprises the mutation ΔPfur::TT araC ParaBAD fur.
6. Endosomal Escape Genes
In some embodiments, the recombinant bacterium has been genetically-altered such that the bacterium is capable of escaping the endosomal compartment of a host cell. A recombinant bacterium may exhibit a temporal delay in escaping an endosome following invasion of the host cell. Methods of detecting escape from an endosomal compartment of a host cell are well known in the art, and include, for example, microscopic analysis.
In some embodiments, the recombinant bacterium comprises a deletion in an endogenous sifA gene. In some embodiments, the recombinant bacterium comprises a mutation that alters the function of SifA. SifA is an effector protein necessary for the formation of Salmonella-induced filaments and for the maintenance of the vacuolar membrane enclosing the bacterium. Bacteria comprising a deletion of sifA are capable of escaping the host cell endosome (also called the Salmonella-containing vesicle, or SCV) following cellular invasion. In some embodiments, the deletion of the endogenous sifA gene is a partial deletion. In some embodiments, the deletion of the endogenous sifA gene is a full-length deletion. In some embodiments, the endogenous sifA gene is genetically altered to insert a transcriptional terminator in the open reading frame of the gene. In some embodiments, a regulatory region of the endogenous sifA gene is genetically-modified to alter (e.g., decrease) the expression of the sifA gene. In some embodiments, the promoter of an endogenous sifA gene is altered to include one or more regulatory elements (e.g., a sugar-responsive promoter).
In some embodiments, the recombinant bacterium described herein is modified to comprise a nucleic acid comprising a sifA gene. In some embodiments, the nucleic acid comprising a sifA gene is located on a plasmid in the bacterium. In some embodiments, the nucleic acid comprising a sifA gene is located on a chromosome of the bacterium. In some embodiments, the nucleic acid comprising a sifA gene is located at the chromosomal locus corresponding to the locus of an endogenous a sifA that has been deleted or altered in the bacterial chromosome. In some embodiments, the recombinant bacterium is modified to comprise a nucleic acid comprising a sifA gene, whereby an endogenous copy of the sifA gene in the bacterial chromosome has been altered and/or deleted.
The nucleic acid sequence of an exemplary Salmonella sifA gene is provided below:
The amino acid sequence of the SifA protein encoded by the nucleic acid of SEQ ID NO: 7 is provided below:
In some embodiments, the nucleic acid comprises a Salmonella sifA gene (provided as SEQ ID NO: 7). In some embodiments, the nucleic acid comprises a sifA gene, wherein the sifA gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the nucleic acid sequence of SEQ ID NO: 7. In some embodiments, the nucleic acid comprises a sifA gene, wherein the sifA gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the nucleic acid sequence of SEQ ID NO: 7.
In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a SifA protein, wherein said SifA protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 8. In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a SifA protein, wherein said SifA protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the nucleic acid sequence of SEQ ID NO: 8.
In some embodiments, the nucleic acid comprises a sifA gene from a bacterial species, subspecies, serovar, or strain that is different than the bacterial species of the recombinant bacterium. In some embodiments, the nucleic acid comprises a sifA gene from a bacterial species, subspecies, serovar, or strain that is the same as the bacterial species of the recombinant bacterium.
In some embodiments, the nucleic acid comprises a sifA gene that is operably-linked to a regulatable promoter (e.g., a sugar-regulatable promoter). In some embodiments, the nucleic acid comprises a sifA gene that is operably-linked to a sugar-regulatable promoter. In some embodiments, the sugar regulatable promoter exhibits increased activity (e.g., increased transcription) in the presence of a specific sugar and decreased activity in the absence of a sugar. In some embodiments, the nucleic acid comprises a sifA gene that is operably-linked to a rhamnose-regulatable promoter (e.g., a sugar-regulatable promoter). In some embodiments, the nucleic acid comprises a sifA gene that is operably-linked to an arabinose-regulatable promoter. In some embodiments, the arabinose-regulatable promoter is PBAD. In some embodiments, the recombinant bacterium comprises the mutation ΔsifA::TT araC PBAD sifA. In some embodiments, the recombinant bacterium comprises the mutation ΔPsifA::TT araC ParaBAD sifA. When the expression of the nucleic acid comprising a sifA gene is under the control of an arabinose-regulated promoter, the bacterial escape from the host endosome can be delayed. Since arabinose is absent in host cells, arabinose cannot induce the expression of the sifA gene. Thus, if the recombinant bacterium is cultured in the presence of arabinose prior to administration to the subject, the expression of sifA will gradually decrease with each round of bacterial cell division thereby allowing escape of the bacterium from the host cell endosome during the initial cell division cycles. Similar delayed-escape mutations may be constructed using other regulatable promoters, such as from the xylose-regulatable or rhamnose-regulatable promoter systems.
7. GTP Pyrophosphokinase Genes
In some embodiments, the recombinant bacterium comprises a deletion in an endogenous relA gene, which encodes the GTP pyrophosphokinase RelA. The inclusion of a relA deletion in the recombinant bacterium uncouples the occurrence of growth-dependent lysis to the need for continued protein synthesis. In some embodiments, the deletion of the endogenous relA gene is a partial deletion. In some embodiments, the deletion of the endogenous relA gene is a full-length deletion.
8. Other Attenuation Methods
Other methods of attenuation are known in the art. For instance, attenuation may be accomplished by altering (e.g., deleting) native nucleic acid sequences found in the wild-type bacterium. For instance, if the bacterium is Salmonella, non-limiting examples of nucleic acid sequences which may be used for attenuation include: a pab nucleic acid sequence, a pur nucleic acid sequence, an aro nucleic acid sequence, asd, a dap nucleic acid sequence, nadA, pncB, galE, pmi, fur, rpsL, ompR, htrA, hemA, cdt, cya, crp, dam, phoP, phoQ, rfc, poxA, gal U, mviA, sodC, recA, ssrA, sirA, inv, hilA, rpoE, flgM, tonB, slyA, and any combination thereof. Exemplary attenuating mutations may be aroA, aroC, aroD, cdt, cya, crp, phoP, phoQ, ompR, galE, and htrA.
In certain embodiments, the above nucleic acid sequences may be placed under the control of a sugar regulated promoter wherein the sugar is present during in vitro growth of the recombinant bacterium, but substantially absent within an animal or human host. The cessation in transcription of the nucleic acid sequences listed above would then result in attenuation and the inability of the recombinant bacterium to induce disease symptoms.
C. Additional Mutations
In some embodiments, the recombinant bacterium comprises a deletion in an endogenous recF gene, which encodes the DNA replication and repair protein RecF. In some embodiments, the deletion of the endogenous recF gene is a partial deletion. In some embodiments, the deletion of the endogenous recF gene is a full-length deletion. In some embodiments, the endogenous recF gene is genetically altered to insert a transcriptional terminator in the open reading frame of the gene.
In some embodiments, the recombinant bacterium comprises a deletion in an endogenous recJ gene, which encodes the exonuclease RecJ. In some embodiments, the deletion of the endogenous recJ gene is a partial deletion. In some embodiments, the deletion of the endogenous recJ gene is a full-length deletion. In some embodiments, the endogenous recJ gene is genetically altered to insert a transcriptional terminator in the open reading frame of the gene.
The bacterium may also be modified to create a balanced-lethal host-vector system, although other types of systems may also be used (e.g., creating complementation heterozygotes). For the balanced-lethal host-vector system, the bacterium may be modified by manipulating its ability to synthesize various essential constituents needed for synthesis of the rigid peptidoglycan layer of its cell wall. In one example, the constituent is diaminopimelic acid (DAP). Various enzymes are involved in the eventual synthesis of DAP.
In some embodiments, the recombinant bacterium comprises a deletion in an endogenous asd gene. In some embodiments, the deletion of the endogenous asd gene is a partial deletion. In some embodiments, the deletion of the endogenous asd gene is a full-length deletion. In some embodiments, the endogenous asd gene is genetically altered to insert a transcriptional terminator in the open reading frame of the gene. In some embodiments, the promoter of an endogenous asd gene is altered to include one or more regulatory elements (e.g., a sugar-responsive promoter). In one example, the bacterium is modified by using a ΔasdA mutation to eliminate the bacterium's ability to produce β-aspartate semialdehyde dehydrogenase, an enzyme essential for the synthesis of DAP. Other mutations that result in the abolition of the synthesis of DAP include, but are not limited to, dapA, dapB, dapC, dapD, dapE, dapF, and asd (see, e.g., U.S. Pat. No. 6,872,547, incorporated herein by reference). Other modifications that may be employed include modifications to a bacterium's ability to synthesize D-alanine or to synthesize D-glutamic acid (e.g., ΔmurI mutations), which are both unique constituents of the peptidoglycan layer of the bacterial cell wall. Thus, the bacterium can be modified by manipuplating expression of genes involved in peptidoglycan biosynthesis such as genes encoding peptidoglycan biosynthetic enzymes. Peptidoglycan biosynthetic enzymes are known in the art. See, for example, Otten et al., Molecular Microbiology 107:142:63 (2018), the contents of which is incorporated by reference.
Similarly, various embodiments may comprise the araC ParaBAD c2 gene cassette inserted into the asd nucleic acid sequence that encodes aspartate semialdehyde dehydrogenase. Since the araC nucleic acid sequence is transcribed in a direction that could lead to interference in the expression of adjacent nucleic acid sequences and adversely affect vaccine strain performance, a transcription termination (TT) sequence is generally inserted 3′ to the araC nucleic acid sequence. The chromosomal asd nucleic acid sequence is typically inactivated to enable use of plasmid vectors encoding the wild-type asd nucleic acid sequence in the balanced lethal host-vector system. This allows for stable maintenance of plasmids in vivo in the absence of any drug resistance attributes that are not permissible in live bacterial vaccines. In some of these embodiments, the wild-type asd nucleic acid sequence may be encoded by the vector described herein. The vector enables the regulated expression of an antigen encoding sequence through the repressible promoter.
D. Repressor Regulatory Systems
In some embodiments, the recombinant bacterium comprises a nucleic acid (e.g., a gene) that is operably linked to a repressor-regulatable promoter to facilitate the regulatable expression of the gene. Thus, in some embodiments, the recombinant bacterium comprises a nucleic acid comprising a gene encoding a repressor. In some embodiments, the gene encoding the repressor is operably-linked to a regulatable promoter. Methods of chromosomally integrating a nucleic acid sequence encoding a repressor operably-linked to a regulatable promoter are known in the art and detailed in the examples. In some embodiments, the nucleic acid sequence encoding a repressor is not integrated into a chromosomal locus such that the ability of the bacterium to colonize a host cell is disrupted. In some embodiments, the recombinant bacterium comprises a nucleic acid encoding a repressor that is integrated into the relA locus of the bacterial chromosome. In some embodiments, the recombinant bacterium comprises a nucleic acid encoding a repressor that is integrated into the endA locus of the bacterial chromosome. In some embodiments, the recombinant bacterium comprises at least one nucleic acid sequence encoding a repressor. In some embodiments, the recombinant bacterium comprises at least two, at least three, at least four, at least five, at least six or more nucleic acids encoding a repressor. In some embodiments, the nucleic acid encoding the repressor is present on a plasmid in the bacterium. In some embodiments, the nucleic acid encoding the repressor is located in the bacterial chromosome. If there is more than one nucleic acid sequence encoding a repressor, each nucleic acid sequence encoding a repressor may be operably linked to a regulatable promoter, such that each promoter is regulated by the same compound or condition. Alternatively, each nucleic acid sequence encoding a repressor may be operably linked to a regulatable promoter, each of which is regulated by a different compound or condition.
As used herein, a “repressor” refers to a biomolecule that represses the transcriptional activity of a promoter. In some embodiments, the repressor is synthesized by the recombinant bacterium in high enough quantities during in vitro culture, such that the transcription of a nucleic acid that is operably linked to a repressor-regulatable promoter is repressed. This may be particularly advantageous if, for example, expression of the product encoded by said nucleic acid impedes the in vitro growth of the bacterium, and/or the ability of the bacterium to infect and/or colonize a subject. In some embodiments, the nucleic acid that is operably-linked to the repressor-regulatable promoter expresses an antigen of interest. In some embodiments, the concentration of the repressor within the cell gradually decreases with each cell division cycle after transcription of the gene encoding the repressor decreases or ceases (e.g., in vivo). The use of a particular repressor, as described herein, may depend, in part, on the species, subspecies, strain or serovar of the recombinant bacterium being used. In some embodiments, the repressor is derived from the same species (e.g., the same bacterial species or the same phage) from which the repressor-regulatable promoter is derived. In some embodiments the repressor is not derived from the same bacterial species as the bacterial species in which the repressor is expressed. For example, in some embodiments, the repressor is derived from E. coli if the recombinant bacterium is of the genus Salmonella. Other suitable repressors include repressors derived from a bacteriophage.
A nucleic acid sequence encoding a repressor and regulatable promoter detailed above may be modified so as to optimize the expression level of the nucleic acid sequence encoding the repressor. The optimal level of expression of the nucleic acid sequence encoding the repressor may be estimated, or may be determined by experimentation. Such a determination should take into consideration whether the repressor acts as a monomer, dimer, trimer, tetramer, or higher multiple, and should also take into consideration the copy number of the vector encoding the antigen of interest. In an exemplary embodiment, the level of expression is optimized so that the repressor is synthesized while in a permissive environment (i.e., in vitro growth) at a level that substantially inhibits the expression of the nucleic acid encoding an antigen of interest, and is substantially not synthesized in a non-permissive environment, thereby allowing expression of the nucleic acid encoding an antigen of interest.
In some embodiments, the recombinant bacterium described herein is modified to comprise a nucleic acid comprising a lacI gene, which encodes the LacI repressor protein. The expression of the lacI-encoded repressor in the recombinant bacterium described herein may be used to regulate the expression of a gene encoding an antigen of interest expressed by the bacterium. For example, in some embodiments, the expression of the lacI gene is regulated by a sugar-regulatable promoter (e.g., an arabinose-regulatable promoter). When cultured in the presence of arabinose, the recombinant bacterium will synthesize the LacI repressor protein, which in turn will repress the expression of a gene encoding an antigen of interest that is operably-linked to a LacI-responsive promoter (e.g., Ptrc, Plac, PT7lac and Pttac). Upon administration to the subject and in the absence of a source of arabinose, the synthesis of LacI repressor ceases, leading to de-repression of the LacI-responsive promoter and the subsequence causing expression of the antigen of interest. The concentration of LacI in the cell decreases by about half at each cell division in vivo, leading to a gradual decreased level of repression and gradual increased synthesis of the antigen of interest.
In some embodiments, the nucleic acid comprising a lacI gene is located on a plasmid in the bacterium. In some embodiments, the nucleic acid comprising a lacI gene is located on a chromosome of the bacterium. In some embodiments, the nucleic acid comprising a lacI gene is located at the chromosomal locus corresponding to the locus of an endogenous relA gene that has been deleted or altered in the bacterial chromosome. In some embodiments, the recombinant bacterium is modified to comprise a nucleic acid comprising a lacI gene, whereby an endogenous copy of the lacI gene in the bacterial chromosome has been altered and/or deleted.
In some embodiments, the nucleic acid comprises an Escherichia coli lacI gene. The nucleic acid sequence of the E. coli lacI gene is provided below:
The amino acid sequence of the E. coli LacI protein encoded by the nucleic acid of SEQ ID NO: 9 is provided below:
In some embodiments, the nucleic acid comprises a lacI gene, wherein the lacI gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the nucleic acid sequence of SEQ ID NO: 9. In some embodiments, the nucleic acid comprises a lacI gene, wherein the lacI gene comprises a nucleic acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the nucleic acid sequence of SEQ ID NO: 9.
In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a LacI protein, wherein said LacI protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 10. In some embodiments, the nucleic acid comprises a nucleic acid sequence encoding a LacI protein, wherein said LacI protein comprises an amino acid sequence that is at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the nucleic acid sequence of SEQ ID NO: 10.
In some embodiments, the nucleic acid comprises a lacI gene that is operably-linked to a regulatable promoter (e.g., a sugar-regulatable promoter). In some embodiments, the nucleic acid comprises a lacI gene that is operably-linked to a sugar-regulatable promoter. In some embodiments, the sugar regulatable promoter exhibits increased activity (e.g., increased transcription) in the presence of a specific sugar and decreased activity in the absence of a sugar. In some embodiments, the nucleic acid comprises a lacI gene that is operably-linked to a rhamnose-regulatable promoter (e.g., a sugar-regulatable promoter). In some embodiments, the nucleic acid comprises a lacI gene that is operably-linked to an arabinose-regulatable promoter. In some embodiments, the arabinose-regulatable promoter is ParaBAD. In some embodiments, the recombinant bacterium comprises the mutation ΔrelA::araC ParaBAD lacI TT.
II. Pharmaceutical Compositions
A recombinant bacterium may be administered to a host as a pharmaceutical composition. In some embodiments, the pharmaceutical composition may be used as a vaccine to elicit an immune response to the recombinant bacterium, including any antigens that may be synthesized and delivered by the bacterium. In an exemplary embodiment, the immune response is protective. Immune responses to antigens are well studied and widely reported.
In one embodiment, a pharmaceutical composition may comprise at least two strains of recombinant bacterium. For example, a pharmaceutical composition may comprise a first strain synthesizing at least a first antigen of interest, e.g., PlcC, Fba, and/or NetB, and a second strain synthesizing at least a second antigen of interest, e.g., Cbh, CpeC, or both Cbh and CpeC, etc. The pharmaceutical composition may comprise two or more recombinant bacterium, each expressing any subcombination of the antigens of interest described herein.
Pharmaceutical compositions may be administered to any host capable of mounting an immune response. Such hosts may include all vertebrates, for example, mammals, including domestic animals, agricultural animals, laboratory animals, and humans, and various species of birds, including domestic birds and birds of agricultural importance. Preferably, the host is a warm-blooded animal. In one embodiment, the host is a cow. In some embodiments, the host is an equine. In another embodiment, the host is an avian. In another embodiment, the host is a human. The pharmaceutical composition can be administered to the subject as a prophylactic or for treatment purposes.
In some embodiments, the recombinant bacterium is alive when administered to a host in a pharmaceutical composition described herein. Suitable vaccine composition formulations and methods of administration are detailed below.
A pharmaceutical composition comprising a recombinant bacterium may optionally comprise one or more possible additives, such as carriers, preservatives, stabilizers, adjuvants, and other substances.
In one embodiment, the pharmaceutical composition comprises an adjuvant. Adjuvants are optionally added to increase the ability of the vaccine to trigger, enhance, or prolong an immune response. In exemplary embodiments, the use of a live attenuated recombinant bacterium may act as a natural adjuvant. In some embodiments, the recombinant bacterium synthesizes and secretes an immune modulator. Additional materials, such as cytokines, chemokines, and bacterial nucleic acid sequences naturally found in bacteria, like CpG, are also potential vaccine adjuvants.
In some embodiments, the pharmaceutical composition comprises buffered saline (e.g., phosphate-buffered saline (PBS)).
In some embodiments, the pharmaceutical composition comprises a food product.
In another embodiment, the pharmaceutical may comprise a pharmaceutical carrier (or excipient). Such a carrier may be any solvent or solid material for encapsulation that is non-toxic to the inoculated host and compatible with the recombinant bacterium. A carrier may give form or consistency, or act as a diluent. Suitable pharmaceutical carriers may include liquid carriers, such as normal saline and other non-toxic salts at or near physiological concentrations, and solid carriers not used for humans, such as talc or sucrose, or animal feed. Carriers may also include stabilizing agents, wetting and emulsifying agents, salts for varying osmolarity, encapsulating agents, buffers, and skin penetration enhancers. Carriers and excipients as well as formulations for parenteral and nonparenteral drug delivery are set forth in Remington's Pharmaceutical Sciences 19th Ed. Mack Publishing (1995). When used for administering via the bronchial tubes, the pharmaceutical composition is preferably presented in the form of an aerosol.
In some embodiments, the pharmaceutical composition is delivered to a farm animal (e.g., poultry). In some embodiments, the pharmaceutical composition is delivered as a course spray (e.g., for use in hatcheries for delivery to poultry). In some embodiments, the pharmaceutical composition is delivered in the drinking water.
Care should be taken when using additives so that the live recombinant bacterium is not killed, or have its ability to effectively colonize lymphoid tissues such as the GALT, NALT and BALT compromised by the use of additives. Stabilizers, such as lactose or monosodium glutamate (MSG), may be added to stabilize the pharmaceutical composition against a variety of conditions, such as temperature variations or a freeze-drying process. The recombinant bacterium may also be co-administered with glutamate and/or arginine as described herein.
The dosages of a pharmaceutical composition can and will vary depending on the recombinant bacterium, the regulated antigen, and the intended host, as will be appreciated by one of skill in the art. Generally speaking, the dosage need only be sufficient to elicit a protective immune response in a majority of hosts. Routine experimentation may readily establish the required dosage. Typical initial dosages of vaccine for oral administration could be about 1×107 to 1×1010 CFU depending upon the age of the host to be immunized. Administering multiple dosages may also be used as needed to provide the desired level of protective immunity.
In order to stimulate a preferred response of the GALT, NALT or BALT cells, administration of the pharmaceutical composition directly into the gut, nasopharynx, or bronchus is preferred, such as by oral administration, intranasal administration, gastric intubation or in the form of aerosols, although other methods of administering the recombinant bacterium, such as intravenous, intramuscular, subcutaneous injection or intramammary, intrapenial, intrarectal, vaginal administration, or other parenteral routes, are possible, e.g., for anti-cancer applications.
In some embodiments, these compositions are formulated for administration by injection (e.g., intraperitoneally, intravenously, subcutaneously, intradermally, intramuscularly, etc.).
In another embodiment, the disclosure provides a method for eliciting an immune response against an antigen in a host. The method comprises administering to the host an effective amount of a pharmaceutical composition comprising a recombinant bacterium described herein.
In still another embodiment, a recombinant bacterium may be used in a method for eliciting an immune response against a pathogen in an individual in need thereof. The method comprises administrating to the host an effective amount of a pharmaceutical composition comprising a recombinant bacterium as described herein. In a further embodiment, a recombinant bacterium described herein may be used in a method for ameliorating one or more symptoms of an infectious disease in a host in need thereof. The method comprises administering an effective amount of a pharmaceutical composition comprising a recombinant bacterium as described herein.
The present invention is further illustrated by the following examples that should not be construed as limiting in any way. The contents of all cited references, including literature references, issued patents, and published patent applications, as cited throughout this application are hereby expressly incorporated herein by reference. It should further be understood that the contents of all the figures and tables attached hereto are also expressly incorporated herein by reference.
When delivered in a recombinant bacterium of the disclosure, the PlcC and GST-NetB antigens induce antibodies to counteract and prevent the toxicities caused by the Cp alpha toxin and the NetB toxin that damage the intestinal mucosa of a host, e.g., poultry, to cause it to thicken and be less able to absorb nutrients. This damage and thickening reduces the ability of the host to convert food to muscle, e.g., meat, in broilers, or to eggs in laying hens. Overall, this reduces performance and is an economic loss to poultry producers.
However, immune response against toxins would not contribute to diminishing levels of Cp colonization in poultry. In Listeria, production of bile hydrolase is attenuating, most likely due to reduced ability to colonize the intestinal tract. The inventors of the disclosure thus postulated that, if Cp produced a bile hydrolase, its loss might also diminish the ability to of Cp to colonize the gastrointestinal (GI) tract. The instant inventors, therefore, performed a bioinformatic search and identified a DNA sequence encoding a protein Cbh from C. perfringens. They next postulated that antibodies against Cbh would block its enzymatic activity and, thus, reduce the ability of Cp to colonize the GI tract.
The Cp enterotoxin CpeC is also a surface-localized protein that is responsible for disease in some animals, such as dogs and horses, but is the primary cause of food poisoning in humans if Cp gets into food, for example, potato salad. Cp is likely transmitted through the food chain from Cp colonizing poultry, similar to how Salmonella is transmitted through the food chain from poultry to humans. The inventors thus reasoned that induction of antibodies to CpeC would also reduce ability of Cp strains to colonize poultry.
These surprising ideas led the inventors to design codon-optimized sequences encoding synthesis of the C-terminal portions of the Cbh and CpeC antigens to induce immune responses that would be effective in reducing NE by reducing the ability of Cp to colonize the GI tract of poultry. Cp has a 28.6% GC content of DNA very different than the 52% GC of Salmonella. Thus, the redesign of coding sequences to fit Salmonella and permit synthesis of the antigens by the RASVs disclosed herein was surprising in terms of their success and is disclosed in more detail herein.
Bacterial strains, media and bacterial growth: Strain construction is performed in virulent S. Typhimurium strain χ3761 (75) and S. Enteritidis χ3550 (136). Different virulent wild-type Salmonella serovars, including S. Typhimurium χ3761 (B), S. Enteritidis χ3550 (D), S. Heidelberg χ3749 (B) (137), S. Choleraesuis χ3246 (C1) (138), S. Infantis χ3213 (C1) (139), S. Newport χ3240 (C2) (139), S. Dublin χ12323 (D) (140), are used for challenges. The LD50s of most of these strains are between103 and 105 in mice and chickens except that S. Heidelberg, S. Infantis and S. Newport do not often cause lethal disease in either mice or chickens. LB media or plates with appropriate supplements when needed are used for growth of Salmonella (141, 142). χ12341 has the following genotype: ΔPmurA25::TT araC ParaBAD murA ΔasasdA27:TT araC ParaBAD c2 Δpmi-2426 ΔwaaL46 ΔpagL64::TT rhaRS PrhaBAD waaL Δ(wza-wcaM)-8 ΔrelA197::araC ParaBAD lacI TT ΔrecF126 ΔsifA26.
Molecular and genetic procedures. Methods for DNA manipulations and PCR are standard (143). DNA sequence analysis is performed at the UFL DNA Sequence Laboratory while oligonucleotide and/or gene segment syntheses will be obtained commercially.
Strain characterization. Vaccine strains are fully characterized at each step in their construction of introducting recombinant plasmids encoding Cp protective antigens and before immunization studies for the presence of all phenotypes and genotypes. Genetic attributes are confirmed by PCR with appropriate probes and/or phenotype analyses. Strains are compared with vector control strains for stability of plasmid maintenance and antigen synthesis when strains are grown in the presence of arabinose or other sugars and/or DAP over a 50 generation period (147). LPS is checked by silver staining (148). Growth curves will be determined for each strain. Other experiments include determining OMP (147) and IROMPs profiles (149), OMV (80) and GMMA characterization (87, 150, 151), serum (152), bile and microbial peptides resistance (136), and attachment/invasion to epithelial INT-407 cells (153, 154). Each strain with antigen-specifying plasmid is evaluated for synthesis of the heterologous antigen by western blot.
Antigen preparation. Protective antigens CpeC, CpeC-Max, GST-NetB, Cbh, Fba, and/or PlcC with C-terminal His-tag, are cloned into pBAD-His or pET vectors for synthesis in E. coli Top10 or BL21 and isolated by nickel chromatography (Sigma). Purified proteins are used for ELISA and ELISPOT assays and for preparing antiserum in New Zealand female rabbits. Salmonella LPS O-antigens are obtained commercially. S. Typhimurium outer membrane proteins (SOMPs) are purified from strain χ9424 that has been engineered to be unable to produce flagella, all in vitro-expressed pilus antigens, LPS O-antigen and several capsules.
Statistics: The SAS program is used to do statistical tests and power analysis to evaluate animal numbers.
The following describes the generation of a triple-sugar regulated Salmonella vaccine that offers effective protection against C. perfringens-induced NE.
Experimental evidence demonstrating the phenotypes of triple-sugar regulated Salmonella vaccines are provided in
The two plasmids, pG8R78 and pG8R79, encode codon optimized cbh and cpeC genes synthesized by Genescript, respectively. The codons used less than 5% frequency in Salmonella in these two genes were optimized to highly used synonymous codons. The two genes were cloned into vector pG8R17 with KpnI/PstI sites to generate plasmids pG8R81 and pG8R82, respectively. Both plasmids were transformed strain χ12341. In observing pG8R82 encoding cpeC significantly retard the growth of strain χ12341 (
The dsbA SS was amplified with primers SDdsbASS-KpnIPstI-s (5′ GCGCGGTACCTGCAGAGGAAGTTGATCATGAAAAAG 3′) (SEQ ID NO:45) and dsbASS-XhoI-a (5′ TATACtcgaGGTCGCTGATCTGTGCTGCCG 3′) (SEQ ID NO:46) with strain χ3761 as template. The cbh gene was amplified with primers cbhN-XhoI-s (5′ CTGACTCGAGATGTGCACAGGCCTGGCACTG 3′) (SEQ ID NO:47) and cbhC-6×his-a1 (5′ CATTACCGCGGATGATGATGGTGGTGGTGCCGCGGGTTCACGTGGTTGATGC 3′) (SEQ ID NO:48) with pG8R78 as template. These two fragments were digested with XhoI and ligated. The SD dsbA SS-cbh was amplified with primers with SDdsbASS-KpnIPstI-s and cbhC-6×hisPstIApaI-a2 (5′ ATTACTGCAGGGCCCATTACCGCGGATGATGATG 3′) (SEQ ID NO:49) and cloned into pG8R223 digested with KpnI/PstI to generate plasmid pG8R224 (
The ompA SS was amplified with primers SDompASS-KpnIPstI-s (5′ ATATGGTACCTGCAGAGGACGCAAAAAATGAAAAAGACAGC 3′) (SEQ ID NO:50) and ompASS-SacI-a (5′ CTTAGAGCTCGTTATCTTTCGGAGCGGCCTGC 3′) (SEQ ID NO:51) with strain χ3761 as template. The cpeCMax gene was amplified with primers cpeCMax-SacI-s (5′ GCCGGAGCTCGACATCGAAAAAGAAATCCTGGAC 3′) (SEQ ID NO:52) and cpeCMax-6×his-a1 (5′ ATTACCTAGGATGGTGGTGATGATGGTGCCTAGGGAATTTCTGGAACAGGATAG 3′) (SEQ ID NO:53) with pG8R80 as template. These two fragments were digested with SacI and ligated. The SD ompA SS-cpecMax was amplified with primers with SDompASS-KpnIPstI-s/cpeCMax-6×hisPstIApaI-a2 (5′ GTGACTGCAGGGCCCATTACCTAGGATGGTGGTG 3′) (SEQ ID NO:54) and cloned into pG8R223 digested with KpnI/PstI to generate plasmid pG8R225 ((
The fragment cbh-ompASS-cpeCMax was amplified using primers cbhN-XhoI-s (5′ CTGACTCGAGATGTGCACAGGCCTGGCACTG 3′) (SEQ ID NO:55) and cpeCMax-6×hisPstIApaI-a2 (5′ GTGACTGCAGGGCCCATTACCTAGGATGGTGGTG 3′) (SEQ ID NO:56) with pG8R226 as template. The dsbA SS was amplified with primers SDdsbASS-KpnIPstI-s (5′ GCGCGGTACCTGCAGAGGAAGTTGATCATGAAAAAG 3′) (SEQ ID NO:57) and dsbASS-XhoI-a (5′ TATACtcgaGGTCGCTGATCTGTGCTGCCG 3′) (SEQ ID NO:58) with strain χ3761 as template. These two fragments were cut with XhoI and ligated. The SD-dsbA SS-cbh-SD-ompA SS-cpecMax were amplified using primers SDdsbASS-KpnIPstI-s/cbhC-6×hisPstIApaI-a2 and cloned into pG8R223 digested with KpnI/ApaI to generate plasmid pG8R252 (
Similar C. perfringens challenge studies in which birds were vaccinated with host-vector strains expressing PlcC and NetB antigens also indicated the vaccines protection against C. perfringens as reflected in the average lesion scores, percent mortality and feed conversion ratios shown in
Thus, results in consecutive studies using a single oral vaccination of chicks with χ12341(pG8R220) on the day of hatch chicken indicated: (1) statistically significant protection from mortality in a “real world” C. perfringens-coccidia; (2) statistically significant protection from development of lesions from C. perfringens; (3) a dose dependent effect in protection; (4) improved body weights and feed conversion ratios comparable to the standard antibiotic treatment and better than vaccine 1, an earlier generation vaccine with evidence of protection; (5) effectiveness of multiple immunization routes, as regardless of the variables in E. maxima strain, C. perfringens strain, vaccine route and/or vaccine dose, χ12341(pG8R220) demonstrated consistent protection from the effects of C. perfringens challenge at a level equal or superior than BMD treatment; and (6) feed conversation at a lever similar to non-vaccinate/non challenge group.
pG8R220, a pYA5112 derived plasmid lacking the Pst I site of pYA5112, was used for constructing additional plasmids encoding C. perfringens antigens. These derivatives of pG8R220 are summarized in Table 1 below.
The structures of the plasmid constructs in Table 1 are illustrated in
In the above constructs, the his sequence in cbh-his has the sequence: cac cac cac cat cat cat (SEQ ID NO: 30), and the his sequence in cpeC-his has the sequence: cac cat cat cac cac cat (SEQ ID NO: 31).
pYA3681 is a lysis plasmid originally described in Kong et al., Proc. Acad. Natl. Sci., 105(27):9361-9366, 2008. pYA3681 serves as the backbone with the addition of the optimized bla SS described by Jiang et al., Avian Diseases, 59(4):475-485, resulting in plasmid pG8R114. The difference between the native bla SS and the optimized blaSS is the change of the second and third codons to AAA for Lys. Having A-rich codons in the second and third codon increases translation efficiency of mRNA significantly. Therefore, in one embodiment of the invention, a signal sequence can be a blaSS signal sequence or an optimized blaSS signal sequence. In one embodiment, the codon-optimized fba sequence can be inserted into pG8R114 with an optimized bla SS.
Additional plasmids used in the studies are also disclosed in Table 2.
Expression of C. perfringens antigens by three Salmonella host strains transformed with one of plasmid constructs were evaluated. The host strains and plasmid constructs evaluated are identified in Table 3.
C. perfringens antigens useful as vaccines
Evidence of expression of antigens PlcC, Fba, GST-NetB Cbh, and CpeC-max, by three Salmonella host-plasmid constructs are provided in
Multiple species of Clostridium strains occupy the intestinal microbiota in chickens. From this population, a mutant derivative of a wild-type virulent C. perfringens strain capable of causing necrotic enteritis was isolated. The isolate, a mutant derivative of the wild-type virulent C. perfringens CP4 strain, is resistant to the DNA synthesis inhibitor nalidixic acid. Nalidixic acid at 50 μg/mL is able to almost completely inhibit growth by all strains of bacteria present in the chicken intestinal tract. A spontaneous mutant of the CP4 strain was isolated by growing the CP4 culture in 100 mL of Tryptic Soy Broth (TSB) in a 250 mL flask at 37° C. for 24 hours in an anaerobic jar containing GasPak™ EZ Anaerobe Sachets with indicator. The culture was then placed in 50 mL centrifuge tubes with caps and then centrifuged in a Sorvall Legend RT refrigerated tabletop centrifuge using a swinging-bucket rotor at 3750 rpm for 18 minutes at room temperature. The supernatants were removed by aspiration and the pellet gently resuspended in 1 mL of sterile buffered saline with gelatin (BSG).
Tryptic Soy Agar II plates with 5% sheep blood and 50 ug/Nal/mL were inoculated with 100 uL (each) of the resuspended concentrated bacteria and incubated in a warm room at 37° C. for 24 hours in an anaerobic jar containing GasPak™ EZ Anaerobe Sachets with Indicator. Colonies appearing were picked with a sterile needle and streaked on selective plates to isolate pure mutant clones resistant to 50 μg nalidixic acid/mL. Multiple isolates were evaluated for growth with and without nalidixic acid and for hemolysis of red blood cells. Two representative strains that grew, with or without the presence of nalidixic acid, at nearly the same rates as the wild-type parent were saved and stocked in TSB+20% glycerol at −80° C.
One of these strain is used to inoculate chicks of different ages with fecal samples collected daily to quantitate the titers of the NalR CP4 mutant. Subsequent studies will show that perturbations of the chicken microbial flora by addition of inflammatory agents such as by pretreatment with antibiotics such as streptomycin or Eimeria oocysts or by administering sodium dextran sulfate result in higher intestinal densities of the NalR CP4 mutant.
These enable evaluation studies of day-of-hatch chicks immunized with various RASV strains delivering C. perfringens protective antigens such as the GST-NetB fusion, PlcC, CpeC-Max, Fba, and/or Cbh. The degree to which immune responses to the antigens alone or collectively reduce the intestinal titers of the NalR CP4 mutant can be determined. Based on the fact that antibodies against the PlcC antigen coat the surface of C. perfringens cells, as revealed by indirect immunofluorescence assays, and reduce the growth of C. perfringens during growth in broth (Zekarias et al. 2008), reductions are expected in titers in immunized but not in unimmunized chicks. This allows for determining the effectiveness of vaccine constructs to reduce ability of C. perfringens strains from colonizing and persisting in the GI track of poultry and other animals such as dogs, horses and swine that are subject to diseases induced by C. perfringens
Many Salmonella serotypes colonize laying hens and broiler chickens to enable transmission of Salmonella in or on eggs or on contaminated broiler carcasses through the food chain to infect humans. Most recent estimates consider poultry to be the source of about half of the cases of human Salmonella infection, which total about 2 million infections and 500 deaths per year in the U.S. Effective immunization of chickens with vaccines to prevent or reduce colonization of chickens with Salmonella would thus enhance food safety by reducing the frequency of Salmonella transmission through the food chain to humans. It is thus expected that any of the vaccine constructs using the S. Typhimurium vaccine vector strain χ12341 to synthesize the C. perfringens protective antigens PlcC, GST-NetB, CpeC, Cbh and/or Fba encoded by the various pG8R and pYA plasmids listed in Tables 1 and 2, if used to immunize day-of-hatch chicks, would induce immune responses that would prevent or reduce colonization by Salmonella serotypes frequently found to colonize chickens.
In these regards, a diversity of recombinant attenuated S. Typhimurium vaccines with the regulated delayed lysis in vivo phenotype have induced significant antibody titers against Salmonella LPS and outer membrane proteins (SOMPs) when used to orally immunize mice (see Kong et al. PNAS 2008; Ameiss et al. Vaccine 2010; Juarez-Rodriquez et al. Infect Immun. 80:815 2012). It is thus logical that use of the χ12341-vectored vaccines described herein would stimulate such antibody responses after mucosal immunization of day-of-hatch chicks and as a consequence prevent or reduce colonization of immunized chicks after challenge with Salmonella serotypes.
Groups of ten day-of-hatch chicks are orally immunized with 50 to 100 μl of BSG suspensions of a χ12341 construct delivering one or more C. perfringens antigens and a group of 10 chicks with BSG with no vaccine cells as a control. Then at 3 weeks after immunization, each group of 10 immunized chicks and a group of BSG ‘immunized’ controls is orally inoculated with 1×105 CFU of S. Enteritidis, S. Typhimurium, S. Newport, S. Infantis, S. Agona, etc. as listed in the Materials and Methods section. Four days later, 5 birds in each group are euthanized and quantitative titers of the Salmonella strain in the bursa of Fabricius, liver and spleen and in intestinal and cecal contents are determined by plating on selective selenite agar as described in previous similar studies (Hassan and Curtiss, Infect. Immun. 1994). The remaining five birds in each group are euthanized 11 days after challenge and the titers of Salmonella determined. High titers of each Salmonella strain in BSG ‘immunized’ control birds are anticipated, but decreased titers of the B group Salmonella S. Typhimurium and S. Heidelberg and the D group Salmonella S. Enteritidis and S. Dublin challenge strains as observed in previous studies after immunization of chickens with S. Typhimurium derived vaccines (Hassan and Curtiss) are anticipated. However, the results in decreasing titers of C group Salmonella are more uncertain since attenuated S. Typhimurium vaccines that do not undergo lysis in vivo only poorly decreased colonization by C group Salmonella such as S. Infantis, S. Newport and S. Kentucky in previous studies. We predict, however, that using a vaccine that undergoes lysis in vivo should be superior to non-lysing strains in reducing colonization be C group Salmonella. This expectation will be determined by immunization of chicks with the χ12341 strains delivering C. perfringens protective antigens.
This application is a 35 U.S.C. § 371 national stage filing of International Application No. PCT/US2018/045231, filed on Aug. 3, 2018, which in turn claims priority to U.S. Provisional Application No. 62/541,293, filed on Aug. 4, 2017. The entire contents of each of the foregoing applications is expressly incorporated by reference herein.
This invention was made with government support under Grant No. 2017-67017-26179 awarded by the United States Department of Agriculture, National Institute of Food and Agriculture, and Grant Nos. AI056289 and AI26172 awarded by the National Institutes of Health. The government has certain rights in the invention.
Filing Document | Filing Date | Country | Kind |
---|---|---|---|
PCT/US2018/045231 | 8/3/2018 | WO |
Publishing Document | Publishing Date | Country | Kind |
---|---|---|---|
WO2019/028396 | 2/7/2019 | WO | A |
Number | Name | Date | Kind |
---|---|---|---|
8465755 | Curtiss, III et al. | Jun 2013 | B2 |
9040059 | Curtiss, III et al. | May 2015 | B2 |
9050285 | Curtiss, III et al. | Jun 2015 | B2 |
10988729 | Curtiss, III et al. | Apr 2021 | B2 |
20060233825 | Jayappa | Oct 2006 | A1 |
20100255022 | Prescott et al. | Oct 2010 | A1 |
20110256181 | Curtiss, III et al. | Oct 2011 | A1 |
20110287052 | Curtiss, III et al. | Nov 2011 | A1 |
20130337013 | Mellata | Dec 2013 | A1 |
20150056232 | Curtiss, III | Feb 2015 | A1 |
20160074440 | Brugere et al. | Mar 2016 | A1 |
20190185520 | Curtiss, III | Jun 2019 | A1 |
20190382717 | Curtiss, III et al. | Dec 2019 | A1 |
Number | Date | Country |
---|---|---|
1874344 | Jan 2008 | EP |
1874344 | Jun 2016 | EP |
2006113772 | Oct 2006 | WO |
2009046449 | Apr 2009 | WO |
2009046451 | Apr 2009 | WO |
2010045620 | Apr 2010 | WO |
2011150421 | Dec 2011 | WO |
2015118541 | Aug 2015 | WO |
Entry |
---|
Coleman et al., Cloning and characterization of a conjugated bile acid hydrolase gene from Clostridium perfringens. Appl Environ Microbiol. Jul. 1995;61(7):2514-20. |
International Preliminary Report on Patentability for Application No. PCT/US2018/045231, dated Feb. 13, 2020, 6 pages. |
International Search Report and Written Opinion for Application No. PCT/US2018/045231, dated Nov. 5, 2018, 8 pages. |
U.S. Appl. No. 16/480,253, filed Jul. 23, 2019, U.S. Pat. No. 10,988,729, Issued. |
U.S. Appl. No. 17/213,619, filed Mar. 26, 2021, Filed. |
Curtiss et al., New technologies in using recombinant attenuated Salmonella vaccine vectors. Crit Rev Immunol. 2010;30(3):255-270. |
Czeczulin et al., Cloning, nucleotide sequencing, and expression of the Clostridium perfringens enterotoxin gene in Escherichia coli. Infect Immun. Aug. 1993;61(8):3429-39. |
Dwivedi et al., Comparative analysis of extractable proteins from Clostridium perfringens type A and type C strains showing varying degree of virulence. Anaerobe. Oct. 2015;35(Pt B):77-91. |
Jiang et al., Protection against necrotic enteritis in broiler chickens by regulated delayed lysis Salmonella vaccines. Avian Dis. Dec. 2015;59(4):475-85. |
Kong et al., Effect of deletion of genes involved in lipopolysaccharide core and O-antigen synthesis on virulence and immunogenicity of Salmonella enterica serovar typhimurium. Infect Immun. Oct. 2011;79(10):4227-39. |
Kong et al., Turning self-destructing Salmonella into a universal DNA vaccine delivery platform. Proc Natl Acad Sci U S A. Nov. 20, 2012;109(47):19414-9. Including supplementary information. |
Kulkarni et al., Oral immunization of broiler chickens against necrotic enteritis with an attenuated Salmonella vaccine vector expressing Clostridium perfringens antigens. Vaccine. Aug. 5, 2008;26(33):4194-203. |
Zekarias et al., Recombinant attenuated Salmonella enterica serovar typhimurium expressing the carboxy-terminal domain of alpha toxin from Clostridium perfringens induces protective responses against necrotic enteritis in chickens. Clin Vaccine Immunol. May 2008;15(5):805-16. |
Extended European Search Report for Application No. EP18841409.8, dated May 10, 2021, 11 pages. |
Number | Date | Country | |
---|---|---|---|
20200368339 A1 | Nov 2020 | US |
Number | Date | Country | |
---|---|---|---|
62541293 | Aug 2017 | US |