LIVE ATTENUATED BACTERIAL STRAIN AND ITS USE AS A VACCINE

Information

  • Patent Application
  • 20200215172
  • Publication Number
    20200215172
  • Date Filed
    September 21, 2018
    7 years ago
  • Date Published
    July 09, 2020
    5 years ago
Abstract
Embodiments of the present disclosure relate to a vaccine composition comprising a bacterial strain with a deleted or inactive ntrX gene.
Description
FIELD OF THE INVENTION

The present invention relates to a vaccine composition comprising a live attenuated bacterial strain and its use as a vaccine.


BACKGROUND OF THE INVENTION

Vaccines have been one of the biggest success stories of modern medicine. There is arguably no single preventive health intervention more cost-effective than immunization. Time and again, the international community has endorsed the value of vaccines and immunization to prevent and control a large number of infectious diseases and, increasingly, several chronic diseases that are caused by infectious agents.


WHO estimates that at least 10 million human deaths were prevented between 2010 and 2015 thanks to vaccinations delivered around the world. Many millions more lives were protected from the suffering and disability associated with diseases such as pneumonia, diarrhea, whooping cough, measles, and polio.


Thank to vaccination global measles mortality has declined by 79% and the poliomyelitis is closer to be eradicated. Moreover, vaccines can help to limit the spread of antibiotic resistance.


In the last decades, significant advances in the human and veterinary vaccines and their production have been made. One of the main progresses is the improved production efficiency of live attenuated vaccines.


However, there is a still a need for new live attenuated vaccines against human or veterinary pathogens but many obstacles exist that have impeded their development. One of the obstacles to the design of live attenuated vaccine include notably understanding pathogen genetic and antigenic variability, variable host immune responses in order to identify protective antigens, and immunogenicity and identification of the antigens that stimulate protective immunity.


Therefore, it is an object of the invention to overcome at least some of the deficiencies of the existing vaccines and to provide new live attenuated vaccines.


In particular, it is another object of the invention to provide, in at least one embodiment, a live attenuated strain which exhibits an attenuated pathogenicity while maintaining its ability to colonize and which induces a strong protective immunity with limited clinical signs after vaccination and no clinical sign after challenge.


It is also another object of the invention to provide, in at least one embodiment, a method for producing a vaccine which can be adapted to a large number of strains in the same family.


It is also another object of the invention to provide, in at least one embodiment, a method for producing a vaccine which is easy to implement and which is relatively low in production costs.


SUMMARY OF THE INVENTION

Now, the inventors have found that by inactivating or deleting the ntrX gene of a wild bacterial strain they obtain a live strain with an attenuated virulence. Moreover, the inventors have also shown that this live attenuated strain was able to induce immunity sufficient for ensuring protection. Indeed, in order to provide a vaccine, it is not sufficient to provide a live attenuated strain, it is necessary that this strain also induces a strong immune response.


A subject of the present invention is therefore a vaccine composition comprising a bacterial strain with a deleted or inactive ntrX gene.


The present invention also relates to a vaccine composition comprising a bacterial strain with a deleted or inactive ntrX gene for use to induce a protective immune response against the bacterial strain.


The present invention also relates to a vaccine composition comprising a bacterial strain with a deleted or inactive ntrX gene for use as a vaccine.


The present invention also relates to a vaccine composition comprising a bacterial strain with a deleted or inactive ntrX gene for use in preventing an infection caused by the bacterial strain.


In yet another aspect, the present invention relates to method for producing a vaccine composition for use against a bacterial strain comprising a step of:


inactivating or deleting the ntrX gene of the bacterial strain, thereby obtaining an attenuated bacterial strain.


DETAILED DESCRIPTION OF THE INVENTION
Vaccine Composition

The present invention relates to vaccine composition comprising a bacterial strain with a deleted or inactive ntrX gene. This bacterial strain with a deleted or inactive ntrX gene is a live attenuated strain.


ntrx is transcriptional regulator whose product is Nitrogen assimilation regulatory protein NtrX.It functions as a Signal transduction mechanism (T.COG2204) and contains a “Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; cd00156”.


In one embodiment, the ntrX gene of the invention encodes a NtrX protein having the amino acid sequence of SEQ ID NO: 1.


The NtrX protein having the amino acid sequence of SEQ ID NO: 1 is the NtrX of Ehrlichia ruminantum Gardel. The NtrX protein of Ehrlichia ruminantum Welgevonden and Ehrlichia ruminantum Senegal have also the amino sequence of SEQ ID NO: 1.


The amino acid sequence of the NtrX protein of Erlichia ruminantum Gardel as well as the nucleic acid sequence of the ntrX gene of Erlichia ruminantum Gardel are given in the Table 1 below.











TABLE 1







amino acid
SEQ ID
MAQDFEMSKERLYISEVLVVDDEVDIRNLI


sequence of
NO: 1
KDILSDDNYVTKLAVDGLSAIKMAYEKEPD


the NtrX

VVLLDIWLRGSDIDGLSVLEKLKERYPYLP


protein

VIMISGHGNIATAVKSLHMGAYDYIEKPFT


of Erlichia

EGRLKLVVKRAIESGRLRRENDELKSAFED



ruminantum


YEIVGNSPVIRNLRSMINKAATTSSRILIT


Gardel

GSPGVGKEVVARLIHKKSKGYDTPFISMYS




SMLPANNYLVNIFGSEESNNILSHRVPPHI




GIIEQANHGTLFIDEVTDLRYDTQLRLLRL




LQEGKIYRENSKIPVSIDVRIIVSSSKDIE




SEVKAGRFCEDLYYRLNVLPIRVPSLVEYC




TDIPELCRYFMNSICKKIGLCTHVLSDEAL




IAMQSYEWPGNLRQLRNVIEWILIMKSPKE




MITAKDLPVDIVSNSPINDVLSAKVISVPL




RKAREEFERQYLKTQLSRFGGNVSRTAEFV




GMERSALHRKLKILGLCNVSE





nucleic acid
SEQ ID
ATGGCACAGGATTTTGAAATGTCCAAGG


sequence of
NO: 11
AAAGATTGTATATTTCTGAAGTATTAGT


the ntrX gene

TGTTGATGATGAAGTTGATATCAGAAAT


of Erlichia

CTAATAAAAGATATATTAAGTGATGATA



ruminantum


ATTATGTCACTAAATTAGCAGTTGATGG


Gardel

TTTATCCGCGATCAAGATGGCTTATGAA




AAAGAGCCTGATGTTGTATTATTGGATA




TATGGTTAAGAGGATCTGATATTGATGG




ATTAAGTGTACTGGAGAAGCTTAAAGAA




AGGTATCCTTATTTGCCTGTTATTATGA




TTAGTGGGCATGGTAATATTGCCACTGC




TGTAAAGTCTCTGCATATGGGTGCTTAT




GATTATATAGAAAAGCCTTTTACAGAAG




GAAGATTAAAGTTAGTTGTAAAGAGAGC




TATAGAGTCTGGTAGATTACGTAGAGAA




AATGATGAGTTGAAATCAGCATTTGAGG




ATTATGAAATAGTCGGTAACTCCCCTGT




TATACGTAATTTGAGAAGTATGATTAAT




AAAGCAGCTACTACATCGAGTCGTATAC




TCATTACTGGTTCGCCAGGTGTTGGAAA




GGAAGTAGTTGCTAGGCTAATACATAAA




AAATCCAAGGGGTATGATACTCCATTTA




TATCTATGTACTCATCTATGCTACCAGC




TAATAATTACTTGGTTAATATATTTGGT




AGTGAGGAAAGTAATAATATATTGTCTC




ATAGAGTACCTCCTCATATTGGAATTAT




AGAGCAAGCAAATCATGGTACGTTATTT




ATAGATGAAGTAACAGATTTACGATACG




ATACGCAATTAAGATTACTCAGATTATT




ACAGGAGGGAAAAATATATAGGGAAAAT




AGTAAGATTCCTGTTAGTATAGATGTGA




GAATTATTGTGTCTTCTTCCAAAGATAT




TGAAAGTGAAGTAAAAGCTGGTAGGTTT




TGTGAGGATTTATATTATAGATTAAATG




TCCTTCCAATTAGAGTACCGTCTTTAGT




AGAATATTGTACAGATATACCGGAATTG




TGTAGGTATTTTATGAATAGCATCTGTA




AAAAAATAGGTTTGTGTACTCATGTATT




AAGTGATGAAGCTTTAATAGCAATGCAG




TCATATGAATGGCCAGGTAACTTAAGAC




AATTACGTAATGTTATAGAATGGATTTT




AATTATGAAATCTCCTAAGGAGATGATT




ACAGCAAAAGATTTACCAGTAGATATAG




TATCTAATTCGCCTATTAATGATGTTTT




AAGTGCTAAAGTTATTTCTGTACCATTA




CGTAAAGCTCGTGAAGAATTTGAAAGAC




AGTATTTAAAAACTCAGTTATCTCGTTT




TGGAGGTAATGTATCACGAACTGCTGAA




TTTGTTGGAATGGAACGTTCAGCATTAC




ACCGTAAATTGAAAATTCTTGGATTGTG




TAATGTTTCTGAATAA









In another embodiment, the ntrX gene of the invention is an active homologue of the ntrX gene which encodes a NtrX protein having the amino acid sequence of SEQ ID NO: 1; said active homologue encodes a NtrX protein having an amino acid sequence with at least 50% of identity with SEQ ID NO: 1.


Preferably, said active homologue encodes a NtrX protein having a amino acid sequence with at least 60%, more preferably at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, and most preferably at least 95% of identity with SEQ ID NO: 1.


For the purposes of comparing two closely-related polynucleotide or polypeptide sequences, the “% identity” between a first sequence and a second sequence may be calculated using an alignment program, such as BLAST® (available at blast.ncbi.nlm.nih.gov) using standard settings. The % identity is the number of identical residues divided by the number of residues in the reference sequence, multiplied by 100. The % identity in the above table is calculated by this methodology.


Alternatively, the % identity may also be calculated by dividing the number of identical residues by the number of aligned residues and multiplying by 100.


Alternative methods include using a gapped method in which gaps in the alignment, for example deletions in one sequence relative to the other sequence, are accounted for in a gap score or a gap cost in the scoring parameter (for more information, see the website blast.ncbi.nlm.nih.gov).


In an embodiment, the inactive ntrX gene is an inactive mutant of a ntrX gene encoding a NtrX protein having the amino acid sequence of SEQ ID NO: 1 or of an active homologue thereof encoding a NtrX protein having a amino acid sequence with at least 50%, 60%, 70%, 75%, 80%, 85%, 90% or 95% of identity with SEQ ID NO: 1. In another embodiment, it is a ntrX gene encoding a NtrX protein having the amino acid sequence of SEQ ID NO: 1 or an active homologue thereof encoding a NtrX protein having a amino acid sequence with at least 50%, 60%, 70%, 75%, 80%, 85%, 90% or 95% of identity with SEQ ID NO: 1 which is deleted.


Preferably, the bacterial strain is genetically engineered so as to delete or to inactivate the ntrX gene.


Advantageously, only the ntrX gene is inactivated or deleted.


In one embodiment, the vaccine composition comprises a bacterial strain with a deleted ntrX gene.


In this embodiment, the bacterial strain is a mutant strain from a bacterial strain, preferably a wild and/or pathogen strain, wherein the ntrX gene has been deleted. The deletion of a gene can be carried out by any methods known by the skilled person.


In one embodiment, the ntrX gene which is a ntrX gene encoding a NtrX protein having the amino acid sequence of SEQ ID NO: 1 is deleted.


In another embodiment, the ntrX gene which is an active homologue thereof encoding a NtrX protein having a amino acid sequence with at least 50%, 60%, 70%, 75%, 80%, 85%, 90% or 95% of identity with SEQ ID NO: 1 is deleted.


In another embodiment, the vaccine composition comprises a bacterial strain with an inactive ntrX gene. An inactive ntrX gene may be a ntrX gene which encodes a non functional NtrX protein or no NtrX protein at all.


In this embodiment, the bacterial strain is a mutant strain from a bacterial strain, preferably a wild and/or pathogen strain, wherein the ntrX gene has been inactivated.


The inactivation of a gene can be carried out by any methods known by the skilled person.


By way of example, inactivation of said ntrX gene can be obtained by mutagenesis and selection of the mutants having lost the NtrX protein activity. Mutagenesis can be performed for instance by targeted deletion of a portion of ntrX coding sequence or by targeted insertion of an exogenous sequence within said coding sequence. Mutagenesis may be also a deletion, an insertion or a replacement of at least one nucleic acid. For example, the inactive mutant of a ntrX gene may be a ntrX gene wherein a codon stop is inserted or wherein a region is deleted and/or rearranged. The inactive mutant of a ntrX gene may also be a ntrX gene wherein at least one nucleic acid has been inserted, for example an inactivating point mutation or an insertion leading to a frameshift mutation.


The inactivation can also be performed by random chemical or physical mutagenesis, followed by screening of the mutants within the ntrX gene. Methods for high throughput mutagenesis and screening are available in the art.


Preferably, a strain with an inactive ntrX gene is a strain wherein the ntrX gene is not expressed.


In one embodiment, the inactive ntrX gene is an inactive mutant of a ntrX gene encoding a NtrX protein having the amino acid sequence of SEQ ID NO: 1.


In another embodiment, the inactive ntrX gene is an inactive mutant of an active homologue of a ntrX gene encoding a NtrX protein having the amino acid sequence of SEQ ID NO: 1; said active homologue encodes a NtrX protein having a amino acid sequence with at least 50% of identity with SEQ ID NO: 1.


Preferably, said active homologue of a ntrX gene encoding a NtrX protein having the amino acid sequence of SEQ ID NO: 1 encodes a NtrX protein having a amino acid sequence with at least 60%, at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, and most preferably at least 95% sequence identity with SEQ ID NO: 1.


In one embodiment, the bacterial strain with a deleted or an inactive a ntrX gene is an Alphaproteobacteria strain, preferably a Rickettsiales strain, more preferably an Anaplasmataceae strain.


Anaplasmataceae are genetically related small Gram-negative pleomorphic cocci. Anaplasmataceae comprises the strains of genus selected from the group consisting of Anaplasma, Ehrlichia, Neorickettsia, and Wolbachia. Anaplasmataceae are obligatory intracellular bacteria which are mainly transmitted by arthropods, most frequently ticks, lice and mites, and cause major illnesses such as ehrlichiosis and anaplasmosis.


Vaccines directed against strains of Anaplasmataceae remain limited. In particular, only few cases of live attenuated vaccine directed against Anaplasmataceae have been reported and the possible mechanism of attenuation of such strains has been studied in only few cases.


For example, in an attempt to produce live attenuated vaccines against Ehrlichia ruminantium, a tick-borne intracellular pathogen of ruminants that causes heartwater, 3 attenuated strains from Guadeloupe (Garde!), South Africa (Welgevonden) and Senegal have been generated in vitro by passaging the virulent bacterium in bovine endothelial cells, in addition to canine macrophage-monocyte cells for Welgevonden strain (Jongejan 1991; Zweygarth et al. 2005; Pilet et al. 2012; Marcelino et al. 2015).


However, usage of these attenuated strains as vaccines has remained limited due to constraints associated with storage (no cold chain disruption) and intravenous administration. Their mechanisms of attenuation are unknown which is problematic considering the risk of virulence recovery. Moreover, attenuated vaccines, as for any other vaccine against heartwater, protect against homologous challenges but confer limited protections against heterologous strains and co-occurrence of different strains in infected animals is common (Zweygarth et al. 2005; Frutos et al. 2006).


Thus, it is also an object of the invention to provide, in at least one embodiment, a vaccine against disease caused by Anaplasmataceae and in particular against ehrlichiosis.


In particular, it is an object of the invention to overcome at least some of the deficiencies of the existing therapies and prophylaxis of disease caused by Anaplasmataceae.


In order to overcome the drawbacks of the prior art vaccines against Anaplasmataceae, the present invention provides a vaccine composition comprising an Anaplasmataceae strain with a deleted or an inactive ntrX gene.


As shown in the table 2 below, the NtrX protein is highly conserved among the Anaplasmataceae family from 84% to 93% of identity.









TABLE 2







% of identity of NtrX protein between different strains of Anaplasmataceae















% of




SEQ ID

identity



Disease
NO of

with



Anaplasmataceae

caused by
the NtrX

SEQ ID


strain
the strain
protein
Amino acid sequence of NtrX
NO: 1















Ehrlichia

ehril-
SEQ ID
MAQDFEMSKERLYISEVLVVDDEVDIRNLIKDILSDDNYVTKLAVDGLSAIKMAY
100%



ruminantium

chiosis
NO: 1
EKEPDVVLLDIWLRGSDIDGLSVLEKLKERYPYLPVIMISGHGNIATAVKSLHMG



Gardel


AYDYIEKPFTEGRLKLVVKRAIESGRLRRENDELKSAFEDYEIVGNSPVIRNLRS






MINKAATTSSRILITGSPGVGKEVVARLIHKKSKGYDTPFISMYSSMLPANNYLV






NIFGSEESNNILSHRVPPHIGIIEQANHGTLFIDEVTDLRYDTQLRLLRLLQEGK






IYRENSKIPVSIDVRIIVSSSKDIESEVKAGRFCEDLYYRLNVLPIRVPSLVEYC






TDIPELCRYFMNSICKKIGLCTHVLSDEALIAMQSYEWPGNLRQLRNVIEWILIM






KSPKEMITAKDLPVDIVSNSPINDVLSAKVISVPLRKAREEFERQYLKTQLSRFG






GNVSRTAEFVGMERSALHRKLKILGLCNVSE







Ehrlichia

ehril-
SEQ ID
MAQNFEMSKERLYISEVLVVDDEVDIRNLIKDILSDDNYVTKLAVDGLSAIKMAY
 96%



chaffeensis

chiosis
NO: 2
EKEPDVVLLDIWLKGSDIDGLSVLEKLKERYPYLPVIMISGHGNIATAVKSLHMG






AYDYIEKPFTEGRLKLVVKRAIESGRLRRENDELKSTFEDYEIVGNSPVIKNLRS






MINKAATTSSRILITGSPGVGKEVVARLIHKKSKGYDTPFISMYSSMLPANNYLV






NIFGSEESSNILSHRVPPHIGIIEQANHGTLFIDEVTDLRYDTQLRLLRLLQEGK






IYRENSKIPVSVDVRIIVSSSKDIENEVRAGKFCEDLYYRLNVLPIRVPSLVEYC






TDIPELCRYFMSSICKKIGLCTHILSDEALIAMQSYEWPGNLRQLRNVIEWILIM






KSPKEIITAKDLPVDIVSNSPINDVLSAKVISVPLRQAREEFERQYLKTQLSRFG






GNVSKTAEFVGMERSALHRKLKVLGLCSISE







Ehrlichia

ehril-
SEQ ID
MAQSFEMSKERLYISEVLVVDDEVDIRNLIKDILSDDNYVTKLAVDGLSAIKMAY
 96%


sp. HF
chiosis
NO: 3
EKEPDVVLLDIWLKGSDIDGLSVLEKLKERYPYLPVIMISGHGNIATAVKSLHMG






AYDYIEKPFTEGRLKLVVKRAIESGRLRRENDELKSTFEDYEIVGNSSVIKNLRS






MINKAATTSSRILITGSPGVGKEVVARLIHKKSKGYDTPFISMYSSMLPANNYLV






NIFGSEESSNILSHRVPPHIGIIEQANHGTLFIDEVTDLRYDTQLRLLRLLQEGK






IYRENSKIPVSVDVRIIVSSSKDIENEVKAGKFCEDLYYRLNVLPIRVPSLVEYC






TDIPELCRYFMNSICKKIGLCTHILSDEALIAMQSYEWPGNLRQLRNVIEWILIM






KSPKEIITAKDLPVDIVSNSPINDVLSAKVISIPLRQAREEFEKQYLKTQLSRFG






GNVSKTAEFVGMERSALHRKLKVLGLCNMSE







Ehrlichia muris

ehril-
SEQ ID
MAQNFEMSKERLYISEVLVVDDEVDIRNLIKDILSDDNYVTKLAVDGLSAIKMAY
 96%



chiosis
NO: 4
EKEPDVVLLDIWLKGSDIDGLSVLEKLKERYPYLPVIMISGHGNIATAVKSLHMG






AYDYIEKPFTEGRLKLVVKRAIESGRLRRENDELKSTFEDYEIVGNSSVIKNLRS






MINKAATTSSRILITGSPGVGKEVVARLIHKKSKGYDTPFISMYSSMLPANNYLV






NIFGSEESSNILSHRVPPHIGIIEQANHGTLFIDEVTDLRYDTQLRLLRLLQEGK






IYRENSKIPVGVDVRIIVSSSKDIENEVKAGKFCEDLYYRLNVLPIRVPSLVEYC






TDIPELCRYFMNSICKKIGLCTYILSDEALIAMQSYEWPGNLRQLRNVIEWILIM






KSPKEIITAKDLPVDIVSNSPINDVLSAKVISIPLRQAREEFEKQYLKTQLSRFG






GNVSKTAEFVGMERSALHRKLKVLGLCNISE







Ehrlichia canis

ehril-
SEQ ID
MAQDFEMSKERLYISEVLVVDDEGDIRNLIKDILSDDNHGTKLAVDGLSAIKMA
 94%



chiosis
NO: 5
YEKEPDVVLLDIWLKGSDIDGLSVLEKLKERYPHLPVIVISGHGNIATAVKSLHI






GAYDYIEKPFTESRLKLVVKRAIESGRLRRENDELKSAFEDYEIVGSSSVIKNLR






SMVNKAAATSSRILITGSPGVGKEVVARLIHKKSKGYDTPFISMYSSMLPANNYL






VNIFGSEESSNILSHRVPPHIGIIEQANRGTLFIDEVTDLRYDTQLRLLRLLQEG






KIYRENSKVPVSVDVRIIVSSSKDIENEVRAGKFCEDLYYRLNVLPIRVPSLVEY






CTDIPELCRYFMNSICKKMGLCTHILSDEALIAMQSYEWPGNLRQLRNVIEWILI






MKSPKEVITAKDLPVDIVSNSPINDVLSAKVISVPLRQAREEFERQYLKTQLSRF






GGNVSKTAEFVGMERSALHRKLKVLGLCNISE







Ehrlichia

ehril-
SEQ ID
MAQDFEMSKERLYISEVLVVDDEGDIRNLIKDILSDDNHGTKLAVDGLSAIKMAY
 94%



minasensis

chiosis
NO: 6
EKEPDVVLLDIWLKGSDIDGLSVLEKLKERYPHLPVIVISGHGNIATAVKSLHIG






AYDYIEKPFTESRLKLVVKRAIESGRLRRENDELKSAFEDYEIVGSSSVIKNLRS






MVNKAAATSSRILITGSPGVGKEVVARLIHKKSKGYDTPFISMYSSMLPANNYLV






NIFGSEESSNILSHRVPPHIGIIEQANRGTLFIDEVTDLRYDTQLRLLRLLQEGK






IYRENSKVPVSVDVRIIVSSSKDIENEVRAGKFCEDLYYRLNVLPIRVPSLVEYC






TDIPELCRYFMNSICKKMGLCTHILSDEALIAMQSYEWPGNLRQLRNVIEWILIM






KSPKEIITAKDLPVDIVSNSPINDVLSAKVISVPLRQAREEFERQYLKTQLSRFG






GNVSKTAEFVGMERSALHRKLKVLGLCNISE







candidatus

ehril-
SEQ ID
MLKAKRFCISEVLIVDDEADIRNLIRDILSDENYATKSSVDGLSAIKLAYEKEPD
 78%



Neoehrlichia

chiosis
NO: 7
VVLLDIWLKGSDVDGLSVLEKLKERYPYLPVIMISGHGNVATAVKSLHKGAYDYI




lotoris



EKPFTENRLKLAVKRAIESGRLRRENDELKASFEDYEFIGNSPVIRNLRNIIEKA






SITSSRVLITGASGTGKEVVARLIHKKSKGCDTPFVTMCTSMMPANNYLANIFGI






EEYSNSLPNKLLPNIGIVEQANRGTLFIDEVTEVRYDVQLRLLRLLQEGKIYREN






GKIPIGIDARVIAASSRVIKDEVKLGRFCEDLYYRLNVLPIVVPSLCEYCSDIPE






ICRYFMKSICKKMGLADHVISNDAIIAMQSYSWPGNLRQLRNVLEWVLIMKSSEG






IITVEDLPAEIISGSAVNDTLSARMVSVPLRQAREEFERQYLKTQLSRFGGSVSK






TAEFVGMERSALHRKLKVLGLYNIDTAKTN







Anaplasma

ana-
SEQ ID
MSKVKRFYIPEVLIVDDEADLRAMIQDILRDDNYVTRVAADGLSAMKLAYEREP
 74%



phagocytophilum

plasmosis
NO: 8
DVVLLDIWLKGSDIDGLSVLEKLKERYPSLPVIMISGHGNIATAVKSLHIGAYDY






IEKPFTENRLKLVVKRAVESGRLRRENDELRSFFEDYELIGNSPQIKSLRSTVNK






AASTFSRILITGAPGTGKEVVARLIHKKFRGGSTFVSFCPSILPENSYLENIFGS






EGENSSLQHVVPHSVGIIEQANHGTLFIDEVTDLRYDAQLRLMRLLQEGRIYRES






GKIPVIVDTRVIASSSKIMEDEVRLGKFCEDLYYRLNVFPIRVPSLSEYCADLPE






ICEYMMKSICKKMRLFPRAISEEAIVAMQSYCWPGNLRQLRNVLEWVMIMQTKH






DVITVDDLPAEIVNGAPINSVFTHIVSAPLRKAREEFERQYLKTQLSRFGGSVSR






TAEFIGMERSALHRKLKMLGLFTG







Anaplasma

ana-
SEQ ID
MGFMSRAKRFYTPEVLIVDDEADLRAMVQDILSDDNYVTNVSHDGLTAIKLAYE
 72%



centrale

plasmosis
NO: 9
REPDVVLLDIWLKGSDIDGLSVLEKLRCRYPHLPVIVISGHGNIATAVKSLHIGA






YDYIEKPFTENRLKLVVKRAVESGRLKRENRELRSLFEDYEIVGSSPQIKNLRST






ISKAASTCSRILITGAPGTGKEVVARFVHRKFRGYNSSFVSFCPSI






LPESSYLENIFGSESGSEALPNVVPHSVGIIEQANHGTLFIDEVTNLRYDAQMRL






MRLFQEGRIYREHGKSPVTVDTRVIASSSRAIEEEVKLGRFCEDLYYRLGVFPIR






VPSLSEYCVDLPEVCEYLMRSICRKMGLLPRPISEDAIVAMQSYSWPGNLRQL






RNVLEWILIMQSSKDIITVNDLPAEIASGSPINNAFTNIVSAPLREAREEFERHY






LRTQLSRFGGSVSKTAEFIKMERSALHRKLKALGLCGS







Anaplasma

ana-
SEQ ID
MGFMSRAKRFYTPEVLIVDDEADLRAMVQDILSDDNYVTKISHDGLTAIKLAYE
 72%



marginale

plasmosis
NO: 10
REPDVVLLDIWLKGSDIDGLSVLEKLRYRYPHLPVIVISGHGNIATAVKSLHIGA






YDYIEKPFTESRLKLVVKRAVESGRLKRENYELRSLFEDYEIVGSSPQIKNLRST






ISKAASTCSRILITGAPGTGKEVVARFVHRKFKGCNSSFVPFCPSILPESSYLEN






IFGSESGNGALPNVVPHSVGIIEQANHGTLFIDEVTDLRYDAQMRLMRLLQEGRI






YRENGKNPVTIDTRVIASSSRVIEEEVKLGRFCEDLYYRLGVFPIRVPSLSEYCV






DIPEVCEYMMRSICRKMGLSPRPISEDAIVAMQSYSWPGNLRQLRNVLEWILIMQ






SSKDIITIDDLPAEIVSGSPINNVFTHIVSAPLRKAREEFERHYLRTQLSRFGGS






VSKTAEFIGMERSALHRKLKALGLCGS









Thus, the inactive ntrX gene may be an inactive mutant of a ntrX gene encoding a NtrX protein having the amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9 and SEQ ID NO:10.


In one embodiment, the inactive ntrX gene may be an inactive mutant of a ntrX gene encoding a NtrX protein having at least 50%, 60%, 65%, 70%, 75%, 80%, 85% 90% or 95% of the amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9 and SEQ ID NO:10.


In another embodiment wherein the ntrX gene is deleted, it is a ntrX gene encoding a NtrX protein having the amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9 and SEQ ID NO:10 which is deleted.


In one embodiment, the deleted ntrX gene may be a ntrX gene encoding a NtrX protein having at least 50%, 60%, 65%, 70%, 75%, 80%, 85% 90% or 95% of the amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9 and SEQ ID NO:10.


In a preferred embodiment, the bacterial strain is selected from the group consisting of Anaplasma strain, Ehrlichia strain, Wolbachia strain and Neorickettsia strain.


In a preferred embodiment, the bacterial strain is an Ehrlichia strain.


The Ehrlichia strain may be selected from the group consisting of E. canis, E. chaffeensis, E. ewingii, E. muris, and E. ruminantium.


Among the species of the genus Ehrlichia, some are species pathogenic for humans and animals such as E. chaffeensis, responsible for Human monocytic ehrlichiosis or E. canis, the causing agent of canine monocytic ehrlichiosis.



Ehrlichia ruminantium, is also pathogenic. This tick-borne intracellular pathogen of ruminants that causes heartwater. Heartwater is an economically important tropical disease of ruminants. It can cause up to 80% mortality in susceptible animals. This disease is present in Sub-saharan Africa, islands in the Indian Ocean and the Caribbean, and is threatening the American mainland. It is listed within the 12th most important transboundary animal diseases for US homeland security department.


Preferably, the Ehrlichia strain is an E. ruminantium strain.



E. ruminantium strain may be selected from the group consisting of Senegal, Garde! and Welgevonden E. ruminantium strains.


Preferably, the E. ruminantium strain is a Senegal E. ruminantium strain.


In one embodiment, the vaccine composition comprises a bacterial strain which is not an E. ruminantium strain.


In one embodiment, the vaccine composition comprises a bacterial strain which is not a Senegal E. ruminantium strain.


In one embodiment, the vaccine composition comprises a bacterial strain which is not an E. canis strain.


In one embodiment, the vaccine composition comprises a bacterial strain which is not a E. canis Israel strain.


In another embodiment, the bacterial strain is not an Anaplasmataceae strain.


The bacterial strain may also be selected from the group consisting of a Rickettsia strain, an Orientia strain, a Bartonella strain and a Brucella strain.


Typically, the vaccine composition may comprise a pharmaceutically acceptable excipient.


If desired, the vaccine composition according to the invention may also comprise an adjuvant. Examples of suitable compounds and compositions with adjuvant activity are well known in the art. Adjuvant may be for example selected from the group consisting of: inorganic adjuvants, organic adjuvants, oil-based adjuvants, cytokines, particulate adjuvants, liposomes, virosomes, bacterial adjuvants, synthetic adjuvants, synthetic polynucleotides adjuvants, immunostimulatory oligonucleotides containing unmethylated CpG dinucleotides and a combination thereof.


In addition to the live attenuated bacterial strain, the vaccine composition can also comprise one or more additional active immunizing agent in order to produce a vaccine composition capable of inducing immunity against a number of different pathogens. The vaccine composition may comprise several live attenuated bacterial strains.


Method of Treatment

The present invention also relates to a vaccine composition according to the invention for use to induce an immune response against a bacterial strain, in particular an Anaplasmataceae strain.


As discussed above, the inventors have found that by inactivating the ntrX gene in a wild bacterial they obtain a live strain with an attenuated virulence which induces a protective immune response against the wild bacterial strain in the subject in which it is administered.


As used herein, “subject” refers to a human or animal that may benefit from the administration of a vaccine composition as recited herein.


The subject may be a human or a non human animal. For example, the non human animal is selected from the group consisting of a bovine, an ovine, an equine, a feline, a caprine or a canine.


The present invention also relates to a method for inducing an immune response against a bacterial strain, preferably an Anaplasmataceae strain, in a subject in need thereof comprising administering to said subject an effective amount of the vaccine composition of the invention.


The present invention also relates to a vaccine composition according to the invention for use as a vaccine, preferably a prophylaxis vaccine.


The inventors have shown that administering to a subject a vaccine composition comprising bacterial strain attenuated by the inactivation or the deletion of the ntrX gene prevents or alleviates the effects of an infection caused by the wild bacterial strain.


Also provided, a method for protecting or treating a subject against disease caused by a bacterial strain comprising administering to said subject a bacterial strain with a deleted or inactive ntrX gene.


In a preferred embodiment, the vaccine composition is for use in preventing and/or treating an infection caused by bacterial strain, preferably an Anaplasmataceae strain.


The infection caused by an Anaplasmataceae strain is preferably ehrlichiosis or anaplasmosis, more preferably ehrlichiosis.


In order to prevent and/or treat an infection caused by a given wild bacterial strain, it would be preferred to use a vaccine composition comprising the given bacterial strain which has been attenuated by deleting or inactivating its ntrX gene thereby providing an attenuated mutant strain of the given bacterial. For example, for preventing or treating ehrlichiosis, it would be preferred to use an Ehrlichia strain with a deleted or an inactive ntrX gene. In the same way, for preventing or treating ehrlichiosis caused by Senegal Ehrlichia strain, it would be preferred to use a Senegal Ehrlichia strain with a deleted or an inactive ntrX gene.


In another embodiment, in order to prevent and/or treat an infection caused by a given bacterial strain, it could be use a vaccine composition comprising a bacterial strain close from the given bacterial strain, for example a strain from the same genus or species, with a deleted or inactive ntrX gene.


In yet another aspect, the present invention relates to a method for preventing and/or treating a subject in need thereof against an infection caused by a bacterial strain comprising administering to said subject an effective amount of the vaccine composition of the invention.


The vaccine composition may be administered by intramuscular, intradermal, subcutaneous or intranasal inoculation or injection. The vaccine composition is administered in an amount, which is effective to protect the subject against challenge, by a virulent bacterial strain. This amount may vary according to the subject being inoculated, taking into consideration the size and weight of the subject. The vaccine composition according to the invention comprises preferably an effective dosage of the live attenuated bacterial strain as the active component, i.e. a sufficient amount of the bacterial live attenuated strain that will induce immunity in the vaccinated subjects, against challenge by the corresponding virulent bacterial strain.


Method for Producing a Vaccine Composition

In yet another aspect, the present invention provides the use of a bacterial strain, preferably an Anaplasmataceae strain, with a deleted or inactive ntrX gene for the manufacture of a vaccine.


The present invention also relates to a method for producing a vaccine composition for use as a vaccine against a bacterial strain comprising a step of:


inactivating or deleting the ntrX gene of the bacterial strain, thereby obtaining an attenuated bacterial strain.


Preferably, the bacterial strain is an Anaplasmataceae strain.


Examples of Anaplasmataceae strain are given herein above. In a preferred embodiment, the Anaplasmataceae strain is an Ehrlichia strain.


The Ehrlichia strain may be selected from the group consisting of: E. canis, E. chaffeensis, E. ewingii, E. muris, and E. ruminantium.


The ntrX gene of the bacterial strain may be deleted or inactivated for example by mutation. Thus, the ntrX gene may be mutated by point mutation, by insertion or by deletion of one or more nucleotides so as to for example interrupting the open reading frame of the ntrXgene.


Techniques of inactivation of a gene are well known from the person skilled in the art. Techniques which may be used to inactivate the ntrX gene, may be for example site directed mutagenesis or homologous recombination. It also includes the use of molecules that trigger preferentially the ntrXgene for inactivation.


The method for producing a vaccine composition may also comprise a step of mixing the attenuated strain with a pharmaceutically acceptable excipient.


The method for producing a vaccine composition according to the invention can also comprise steps conventionally used in the manufacture of the commercially available vaccine composition based on live attenuated strains.


The invention will be further illustrated by the following figures and examples. However, these examples should not be interpreted in any way as limiting the scope of the present invention.





FIGURES


FIGS. 1 and 2 show an evidence of gene conversion between ntrX and its inverted duplicate.






FIG. 1 shows an alignment showing the duplicated region (top four rows) of ntrX gene and the matching parental ntrX region (next four rows) in Welgevonden, Gardel and Senegal virulent and attenuated strains and in E. chaffeensis (last row) where there is no inverted duplicate. Alignment positions that show a closer relationship between ntrX and the duplicate within a strain than between strains, including the 4 bp deletion in Senegal strain are bordered by boxes.



FIG. 2 shows a phylogram (left) depicting the expected relationship between ntrX and its duplicate (star) given that it is present in all E. ruminantium strains. The structure of the phylogram is based on the interstrain relationship reconstructed in the maximum likelihood phylogeny (right) by concatenating 54 orthologous ribosomal proteins from the strains and E. chaffeensis.


EXAMPLES
Material and Methods

Genomics


DNA Extraction and Purification



Ehrlichia ruminantium Senegal strain passage 7 (80% lysis at day 21 p.i.) and 63 and 64 (80% lysis at day 7 p.i.) were cultured in Bovine Aortic endothelial cells as previously described for Gardel strain (Marcelino et al. 2005). When 80% lysis had occurred, supernatant and cellular debris were collected and centrifuged for 15 minutes at 4,000 g at 4° C. to remove cellular debris. The supernatant was then centrifuged for 30 minutes at 20,000 g at 4° C. in order to collect elementary bodies and remove the supernatant. The pellet was resuspended in 2 ml of cold PBS and homogenized gently then 20 ml of PBS was added to wash it, followed by centrifugation for 30 minutes at 20,000 g at 4° C. The pellet was resuspended in 350 μl PBS and 10 μl of RNase at 10 mg/ml (SIGMA, Lyon, France) and 150 μl of DNase I (Roche, Boulogne-Billancourt, France) were added. The pellet was incubated at 37° C. for 90 minutes and the reaction was stopped by adding 25 μl 0.5M EDTA, pH8. The DNase and Rnase were removed by centrifugation for 15 minutes at 20,000 g at 12° C. followed by a wash with 900 μl of sterile DNase and RNase free water. Cells were centrifuged under the same conditions and the washing step was repeated twice. Lysis of elementary bodies was performed by adding 500 μl of lysis solution (0.1M TRIS-HCl (pH8), 0.15M NaCl, 0.025M EDTA (pH8), 1.5% SDS, 0.3 mg/ml Proteinase K) followed by Incubation for 120 minutes at 55° C. DNA extraction was performed using phenol/chloroform (Perez et al. 1997) as follows: 500 μl of phenol (Eurobio, Courtaboeuf, France) was added to 500 μl of sample and mixed gently to homogenize followed by centrifugation for 5 minutes at 8000 g. The aqueous phase was collected and an equivalent volume of phenol was added before centrifugation for 5 minutes at 8,000 g. The aqueous phase was collected and an equivalent volume of phenol (Eurobiotech, France), chloroform and isoamylalcool (Prolabo, Normapur, France) in 24:24:1 proportion was added and mixed gently. The mixture was centrifuged for 5 minutes at 8,000 g and the aqueous phase collected and mixed gently with an equal volume of chroroform/isoamylalcool in 48:1 proportion. The mixture was centrifuged for 5 minutes at 8,000 g and the supernatant was collected and precipitated in ethanol (Prolabo, Normapur) by adding 2 volumes of absolute ethanol for 1 volume of the collected sample. The sample was stored at 4° C. for one hour in order to obtain a white precipitate which was then centrifuged for 10 minutes at 10,000 g at 10° C. The supernatant was removed and the pellet resuspended in 1 ml of 75% ethanol followed by centrifugation for 5 minutes at 10,000 g. The supernatant was removed and the pellet air dried. The pellet was resuspended in 25 μl of TE buffer (10 mM TRISpH8, 1 mM EDTA pH8). DNAs from Senegal passage 7, 63 and 64 in TE buffer were stored at −20° C. before being used for further sequencing.


Genome Sequencing and Assembly


The genome of the virulent Senegal strain (passage 7) was sequenced using 454 GS FLX technology. The attenuated strain (passage 63 & 64) was sequenced using 454 GS FLX technology and Sanger sequencing. Adapters for the 454 sequences were clipped using NextGen Sequence Workbench v3.2.3 (“NextGen Sequence Workbench” 2015), and reads were clipped for adaptors and quality scores according to the information in the SFF sequence files as well as removing reads less than 25 bp long or those with an average quality score less than 16. Quality trimming was performed for the Sanger sequences using NextGen Sequence Workbench v3.2.3 (“NextGen Sequence Workbench” 2015) with default settings (clip the reads in a 14 bp window until>63% have a quality score>=20) and removing reads less than 25 bp long or those with an average quality score less than 16. The virulent strain was de novo assembled using Mira 4.0.2 (Chevreux, Wetter, and Suhai 1999), resulting in 43 contigs larger than 1 kb. The contigs were ordered according to the previously published Welgevonden strain genome (Collins et al. 2005) using CONTIGuator (Galardini et al. 2011), which mapped 42 of the 43 contigs to the Welgevonden genome. The assembly was checked by realigning the reads onto the concatenated assembly using Bowtie 2 (Langmead and Salzberg 2012) and checking any predicted variants against the Welgevonden genome sequence (Collins et al. 2005). Duplicate reads were removed using Picard (“Picard Tools” 2016), conversion between SAM and BAM formats, sorting and mpileup was done using Samtools (Li et al. 2009) and variants were called using BCFtools (Li et al. 2009) and viewed with Tablet (Milne et al. 2013). Variant calls were manually examined in Tablet (Milne et al. 2013) and the assembly was edited accordingly. The attenuated strain was mapped onto the assembled virulent strain as described for remapping the virulent strain. Indels and SNPs were identified with quality cutoffs of 50 and 20 respectively and manually examined in the read alignment. Both genome assemblies were submitted to


Genbank (Accessions MQUJ00000000 for Ehrlichia ruminantium Senegal Virulent, MRDC00000000 for Ehrlichia ruminantium Senegalp63 attenuated).



E. ruminantium RNA purification for RT-PCR



E. ruminantium Senegal attenuated (passage 63 and 66) and virulent (passage 7 and 11) were inoculated in 25 cm2 TC flask containing BAE cells as previously described (Marcelino et al. 2005). The medium was changed at 24 h and 72 h for the attenuated strain and at 24 h and every two days, thereafter, for the virulent strain. Cell layers were allowed to reach around 80-90% lysis and were mechanically harvested with a scraper. Re-suspended cells were centrifuged at 4,500×g for 30 minutes at 4° C. Supernatant was discarded and cells were re-suspended in 1 ml PBS. Cells were then centrifuged at 10,000×g for 10 minutes and PBS was removed. Pellets were stored at −70° C. until RNA purification. Cell pellets were allowed to thaw for 5 minutes in ice and RNA was purified using the SV total RNA isolation system (Promega Corporation, Wisconsin, USA). An additional DNAse treatment was added by using the rigorous DNAse treatment with Turbo DNA-free (Ambion, Fisher Scientific, Illkirch, France), which consisted in adding 0.5 μl of the DNAse, incubating for 30 minutes, and repeating this procedure. RNA was immediately stored at −70° C. after inactivation of the DNAse before ntrX RT-PCR.


RT-PCR of ntrX


The expression of the ntrX in the virulent (passage 7 and 11) and attenuated (passage 63 and 66) Senegal strains was determined using the primers ntrX qRT F1 (5′-GGAAAGATTGTATATTTCTG-3′) (SEQ ID NO: 21) and ntrX qRT2 R1 (5′-ACCAGTAATGAGTATACGAC-3′) (SEQ ID NO: 22) that amplify a 517 bp piece of the ntrX gene. Amplifications were done using the OneStep RT-PCR kit (QlAgen, California, USA) with the following conditions: one Reverse transcriptase cycle at 50° C. for 30 minutes, a denaturating cycle at 95° C. for 15 minutes for activation of HotStart Taq, 35 cycles with a denaturating step 95° C. for 1 minute, an annealing step at 50° C. for 1 minute, and an amplification step at 72° C. for 1 minute, followed by an amplification cycle of 72° C. for 10 minutes. DNA from E. ruminantium Senegal passage 6 was used as positive control. Products were run in agarose gel and bands were visualized with SYBR safe.


Distance of E. muris and Senegal Strain Intergenic Regions


The Senegal strain genome was aligned to the Ehrlichia muris genome using Mauve 2.3.1 (Darling et al. 2004) and intergenic regions were output from the alignment based on the E. muris annotation. Distances were calculated between the aligned intergenic regions using the TN93 model (Tamura and Nei 1993) in the APE package (Paradis, Claude, and Strimmer 2004) in R version 3.2.3 (R Core Team 2015) where at least 30 bases could be aligned, resulting in 364 intergenic distances between Senegal strain and E. muris. The distance between the ntrX gene from E. muris and the duplicate from Senegal strain was measured in the same way for comparison with the intergenic regions.


Vaccination


Preparation of the Inoculum

    • A. Preparation of the Purified Supernatant


As soon as 80% of lysis of cells is reached with a synchronous infection corresponding to 5 days of culture of Senegal passage 68, the supernatant with the cellular debris was passed in a syringe 26G3/8. The totality of the supernatant was collected and centrifuged for 15 minutes at 3000 rpm. Then, the supernatant was recovered without removing the cellular pellet.


500 μl of the supernatant was tested in order to evaluate the viability of the sample. One part of the purified supernatant has been used to infect endothelial cell TC flask in order to control the infectivity of the inoculum 14 ml were at 4° C. before inoculation.

    • B Evaluation of the Viability using The LIVE/DEAD BacLight™ Bacterial Viability Kits (ThermoFisher Scientific)


The purified supernatant was washed in 15 ml of physiological serum and then centrifuged 30 min at 20,000 g at 4° C. It has been suspended again in 500 μl of physiological serum, passed in a syringe. 1.50 μl of Syto9 and Propidium Iodide was added. It was incubated 15 min then counted on a slide and passed in a flow cytometer. It was counted in a Neubeaur chamber in triplicate 8 squares each time. The final concentration was obtained by multiplication by the factor 1.6*105. There was no dilution factor.


Infection of the Animals


Naïve goats were injected intravenously with the following doses of elementary bodies of live attenuated Senegal strain passage 64. The calibrated doses which reproduce natural challenge for virulent strain (between 10 and 12 days before hyperthermia and dead between day 12 and 15 after infection) is comprised between 3 104 an 9 104 live elementary bodies per goat (Vachiery et al, 2006). For this experiment, we decided to use a lethal dose and ten times the lethal dose using 9 104 and 9 105 live elementary bodies per goat.
















Goat
Challenge Doses (Live elementary



number
body number)









0615
9 104



0636
9 104



0803
9 105










Preparation of inoculum depending on the viabilities and concentrations which were found.


Viability


From the cell culture supernatant we measured 5.89 106 elementary bodies/ml on neaubeaur counting cell. The percentage of viability was measured by flow cytometry and we obtained 40% of viability. The number of live elementary bodies was 2.35 106 CE live/ml. The supernatant was diluted in fresh cell culture medium to get 9 104 and 9 105 elementary bodies in a final volume of 2 ml.


Monitoring of Animals:


Clinical signs were checked every day in order to score the severity of the disease. A serology targeting MAP-1 antibodies was done one time a week and one blood sample were taken daily.


Results

Virulent and Attenuated Senegal Strains Genomic Differences: SNPs and Indels


The variants found between the virulent and attenuated strains are shown in Table below.









TABLE







Days for lysis of virulent and attenuated Senegal strain passages











Passage
Days to lyse
Virulence















4
5
Virulent



4
8
Virulent



4
>8
Virulent



4
>10
Virulent



5
6
Virulent



5
>7
Virulent



5
5
Virulent



6
14
Virulent



6
14
Virulent



6
>7
Virulent



6
7
Virulent



6
>5
Virulent



7
4
Virulent



7
4
Virulent



7
6
Virulent



7
6
Virulent



8
6
Virulent



8a
6
Virulent



8b
6
Attenuated



65
4
Attenuated



68
5
Attenuated



69
5
Attenuated



70
5
Attenuated



70
4
Attenuated



71
4
Attenuated



73
4
Attenuated



74
4
Attenuated



74
4
Attenuated



75
5
Attenuated



75
4
Attenuated



76
4
Attenuated










We identified only two SNPs and three indels between the virulent and attenuated Senegal strains. The SNPs occur in the glyA (ERGA_CDS_07110 ortholog), a serine hydroxymethyltransferase involved in the interconversion of serine and glycine as well as tetrahydrofolate production, and the ERGA_CDS_07720 ortholog, a putative M16 protease. Both SNPs are non synonymous. The indels occur in a hypothetical gene (ERGA_CDS_01780 ortholog), the response regulator of the putative nitrogen-sensing two-component system, ntrX (ERGA_CDS_06840 ortholog) and map1-2 (ERGA_CDS_09130 ortholog), a member of the map1 family of outer membrane proteins. The hypothetical gene and ntrX both contain a 4bp deletion, while the map1-2 gene contains a 2 bp insertion. The map1-2 gene appears to be a pseudogene in the virulent Senegal strain and the result of the insertion is to restore the open reading frame of the gene in the attenuated strain, making it a possible gain of function mutation. The hypothetical protein contains a Patatin domain and has sequence similarity to other patatin-like phospholipase family proteins that have lipolytic activity (Banerji and Flieger 2004).


Candidate Mutations for Senegal Strain Attenuation


The two nonsynonymous SNPs and the three indels identified between the virulent and attenuated Senegal strains provide a small number of candidates to explain the attenuation process in this strain.


The glyA gene is involved in the interconversion of serine and glycine, and is necessary for virulence in Salmonella typhimurium and Brucella species (Köhler et al. 2002; Xiang, Zheng, and He 2006; Jelsbak et al. 2014). However, the attenuation in Brucella suis was obtained by Tn5 insertion to knock out the gene, and in the case of the SNP in our data, the protein is still probably produced. The substituted amino acid lies near the end of the protein (position 388/421) and outside of any predicted domains. An alignment of glyA in several Rickettsial species shows that while most of the protein is well conserved, the portion where the mutation occurs is variable across the species suggesting that the region is not vital for protein function.


The map1-2 gene is a member of a multigene family of Major Antigenic Proteins in the Anaplasmataceae, Pfam PF01617 (Dunning Hotopp et al. 2006), which are surface exposed and have been identified as potential vaccine targets (Bekker et al. 2002). Some members of these map genes have been experimentally characterized as porins (Huang et al. 2007) and are suspected to be involved in host cell adhesion (Garcia-Garcia et al. 2004; Park, Choi, and Dumler 2003). Thus, its mutation appears to be a potential candidate for attenuation. However, a study of the map1-2 gene in several different strains of E. ruminantium failed to provide evidence of transcription of this gene in any of the strains they tested (Senegal virulent and attenuated, Garde!, Welgevonden and Sankat 430) in either ticks or bovine endothelial cells (Bekker et al. 2002). A different study did however report the transcription of the map1-2 gene in Welgevonden (van Heerden et al. 2004). The map1-2 gene contains a 2 bp deletion in the Senegal virulent strain (presumably rendering it non-functional) that is reverted in the attenuated strain. Curiously, the deletion is not present in a previous study using a different isolate of the virulent Senegal strain (Bekker et al. 2005). Examination of the reads covering this indel in our data revealed that they fully support the deletion in the virulent Senegal, while it is not present in any reads in the attenuated strain. This result suggests that this deletion may be unique to the virulent strain sequenced in this study. The lack of detectable transcription of the gene in some strains (Bekker et al. 2002) and the fact that the complete map1-2 sequence is present in several other virulent strains of E. ruminantium including another Senegal isolate makes the reversion insertion unlikely to be the cause of attenuation of the Senegal strain.


The patatin domain-containing protein (ERGA_CDS_01780 ortholog) may play a role in the virulence of E. ruminantium, as patatin-like phospholipase proteins are putatively involved in host cell entry in Rickettsia (Rahman et al. 2010). Phospholipase proteins have been identified as virulence factors secreted by the Type III secretion system in Pseudomonas aeruginosa (ExoU), and the Type IV-B secretion system in Pseudomonas aeruginosa (VipD) (Rahman et al. 2010). Bacterial pathogens also tend to contain more patatin-like-proteins than non-pathogens (Banerji and Flieger 2004), suggesting possible roles in virulence. However, their presence in non-pathogens also shows that patatins are not always involved in virulence functions. The indel in the attenuated strain is close to, but outside of the predicted patatin domain, suggesting that the phospholipase activity might be maintained, but making the result of the indel unsure in terms of its effect on the function of the protein. Proteolysis can play roles in virulence at various levels in bacterial pathogens (Frees, Brondsted, and Ingmer 2013), and although we could find no evidence for a known role of proteases from the M16 family in bacterial virulence, proteases from this family in Toxoplasma gondii have been suggested to play a possible role in host invasion by the parasite (Laliberté and Carruthers 2011).


Consequently, the only attenuation candidate is the ntrX gene containing the 4 bp deletion because it is the response regulator of one of only three two-component systems in E. ruminantium that are responsible for global regulation of various bacterial systems (Cheng et al. 2006; Kumagai et al. 2006; Cheng, Lin, and Rikihisa 2014). Two-component systems are involved in sensing of environmental or cellular signals and the downstream expression of genes, allowing bacteria to coordinate their gene expression in response to their environment or cellular state. During infection, bacterial pathogens need to efficiently coordinate their metabolic activities with their virulence to allow for maximization of their growth and successful attack on the host cells, while avoiding host defences. Signals such as the availability of nutrients or metabolites may inform the bacteria of the optimal time to produce virulence factors, and the regulation of many bacterial virulence factors is linked with nutrient availability (Somerville and Proctor 2009; Barbier, Nicolas, and Letesson 2011). NtrX lies at the crossroads of environmental sensing and gene expression and is therefore the ideal candidate to explain attenuation because perturbations to the NtrY/X system are likely to have major consequences for the growth, survival and the coordination of bacterial metabolism and virulence. Furthermore, ntrX as the attenuator explains the apparently biased nature of attenuation in the Senegal strain as compared to other E. ruminantium strains due to its genomic context, which will be discussed later.


The ntrX gene is Disrupted by Segmental Gene Conversion from a Nearby Inverted Partial ntrX Duplication in Attenuated Senegal Strain


A segment of the ntrX gene has been duplicated in all E. ruminantium genomes for which there is available genome sequence data. The duplicated section is inverted and covers 421 bp close to the 5′ end of ntrX (not including the start codon), and lies roughly 2 kb downstream of the ntrX gene itself. The alignment between the ntrX and the duplicate region reveals that the 4 bp deletion identified in the ntrX gene in the Senegal attenuated strain is also present in the duplicated segment in both the attenuated and virulent strains of Senegal, but not in any of the other strains. The 4 bp deletion in ntrX in the attenuated strain causes a frameshift between the domain regions for the response regulator receiver domain and the sigma factor interaction domain, which introduces a stop codon that disrupts the gene. There are also seven other mutations across the sequenced strains between ntrX and its duplicate that exhibit a pattern that is incongruent with the expected phylogeny. At these residues, the ntrX gene and its duplicate are more similar within a strain than they are to their orthologous positions in the other strains, a pattern that indicates gene conversion (FIGS. 1 and 2).















SEQ ID




NO:
Nucleic acid sequences of regions shown at figure 1







Welgevonden
12
CTAATAATGATATATTAGGTGTGATAATTATATCACTAAATTAGCAGTTGATGGTTTATCCGCGATCAAGATG


Duplicate

GCTTATGAAAAAGAGCCTGATGTTGTATTATTGGATATATGGTTAAGAGGATCTGATATTGATGGATTAAGT




GTACTGGAAAAGCTTAAAGAAAGGTATCCTTATTTGCCTGTTATTATGATTAGTGGGCATGGTAATATTGCCA




CTGCTGTAAAGTCTCTGCATATGGGTGCTTATGATTATATAGAAAAGCCTTTTACAGAAGGAAGATTAAAGT




TAGTTGTAAAGAGAGCTATAGAGTCTGGTAGATTACGTAGAGAAAATGATGAGTTGAAATCAGCATTTGAG




GATTATGAAATAGTCGGTAACTCCCCTGTTATACGTAATTTGAGAAGTATGGTTAATAA





Gardel
13
CTAATAATGATATATTAAGTGATGATAATTATGTCACTAAATTAGCAGTTGATGGTTTATCCGCGATCAAGAT


Duplicate

GGCTTATGAAAAAGAGCCTGATGTTGTATTATTGGATATATGGTTAAGAGGATCTGATATTGATGGATTAAG




TGTACTGGAGAAGCTTAAAGAAAGGTATCCTTATTTGCCTGTTATTATGATTAGTGGGCATGGTAATATTGCC




ACTGCTGTAAAGTCTCTGCATATGGGTGCTTATGATTATATAGAAAAGCCTTTTACAGAAGGAAGATTAAAG




TTAGTTGTAAAGAGAGCTATAGAGTCTGGTAGATTACGTAGAGAAAATGATGAGTTGAAATCAGCATTTGAG




GATTATGAAATAGTCGGTAACTCCCCTGTTATACGTAATTTGAGAAGTATGATTAATAA





Senegal
14
CTAATAATGATATATTAGGCAATGATAATTATGTAACCAAATTAGCAGTTGATTATTTATGAAAAAGAGCCTG


Virulent

ATGTTGTATTATTGGATATATAGTTAAAGAGGATCTGATATTGATGGATTAAGCGTACTGGAAAAGCTTAAA


Duplicate

GAAAGGTATCCTTATTTGCCTGTTATTATGATTAGTGGGCATGGTAATATTGCTACTGCTGTAAAGTCTTTGC




ATATGGGTGCTTATGATTATATAGAAAAGCCTTTTACAGAAGGAAGATTAAAGTTGTAAAGAGAGCTATAGA




GTCTGGTAGATTACGTAGAGAAAATGATGAGTTGAAATCAGCATTTGAGGATTATGAGATAGTGGGTAACTC




GCCTGTTATACGTAATTTGAGAAGTATGATTAATAA





Senegal
15
CTAATAATGATATATTAGGCAATGATAATTATGTAACCAAATTAGCAGTTGATTATTTATGAAAAAGAGCCTG


Attenuated

ATGTTGTATTATTGGATATATAGTTAAAGAGGATCTGATATTGATGGATTAAGCGTACTGGAAAAGCTTAAA


Duplicate

GAAAGGTATCCTTATTTGCCTGTTATTATGATTAGTGGGCATGGTAATATTGCTACTGCTGTAAAGTCTTTGC




ATATGGGTGCTTATGATTATATAGAAAAGCCTTTTACAGAAGGAAGATTAAAGTTGTAAAGAGAGCTATAGA




GTCTGGTAGATTACGTAGAGAAAATGATGAGTTGAAATCAGCATTTGAGGATTATGAGATAGTGGGTAACTC




GCCTGTTATACGTAATTTGAGAAGTATGATTAATAA





Welgevonden
16
CTAATAAAAGATATATTAAGTGATGATAATTATGTCACTAAATTAGCAGTTGATGGTTTATCCGCGATCAAGA


ntrX

TGGCTTATGAAAAAGAGCCTGATGTTGTATTATTAGATATATGGTTAAGAGGATCTGATATTGATGGATTAAG




TGTACTGGAAAAGCTTAAAGAAAGGTATCCTTATTTGCCTGTTATTATGATTAGTGGGCATGGTAATATTGCC




ACTGCTGTAAAGTCTCTGCATATGGGTGCTTATGATTATATAGAAAAGCCTTTTACAGAAGGAAGATTAAAG




TTAGTTGTAAAGAGAGCTATAGAGTCTGGTAGATTACGTAGAGAAAATGATGAGTTGAAATCAGCATTTGAG




GATTATGAAATAGTCGGTAACTCCCCTGTTATACGTAATTTGAGAAGTATGATTAATAA





Gardel ntrX
17
CTAATAAAAGATATATTAAGTGATGATAATTATGTCACTAAATTAGCAGTTGATGGTTTATCCGCGATCAAGA




TGGCTTATGAAAAAGAGCCTGATGTTGTATTATTGGATATATGGTTAAGAGGATCTGATATTGATGGATTAA




GTGTACTGGAGAAGCTTAAAGAAAGGTATCCTTATTTGCCTGTTATTATGATTAGTGGGCATGGTAATATTGC




CACTGCTGTAAAGTCTCTGCATATGGGTGCTTATGATTATATAGAAAAGCCTTTTACAGAAGGAAGATTAAA




GTTAGTTGTAAAGAGAGCTATAGAGTCTGGTAGATTACGTAGAGAAAATGATGAGTTGAAATCAGCATTTGA




GGATTATGAAATAGTCGGTAACTCCCCTGTTATACGTAATTTGAGAAGTATGATTAATAA





Senegal
18
CTAATAAAAGATATATTAAGTGATGATAATTATGTCACTAAATTAGCAGTTGATGGTTTATCTGCGATCAAGA


Virulent ntrX

TGGCTTATGAAAAAGAGCCTGATGTTGTATTATTGGATATATGGTTAAGAGGATCTGATATTGATGGATTAA




GCGTACTGGAAAAGCTTAAAGAAAGGTATCCTTATTTACCTGTTATTATGATTAGTGGGCATGGTAATATTGC




TACTGCTGTAAAGTCTTTGCATATGGGTGCTTATGATTATATAGAAAAGCCTTTTACAGAAGGAAGATTAAA




GTTAGTTGTAAAGAGAGCTATAGAGTCTGGTAGATTACGTAGAGAAAATGATGAGTTGAAATCAGCATTTGA




GGATTATGAGATAGTGGGTAACTCGCCTGTTATACGTAATTTGAGAAGTATGATTAATAA





Senegal
19
CTAATAAAAGATATATTAAGTGATGATAATTATGTCACTAAATTAGCAGTTGATGGTTTATCTGCGATCAAGA


Attenuated

TGGCTTATGAAAAAGAGCCTGATGTTGTATTATTGGATATATGGTTAAGAGGATCTGATATTGATGGATTAA


ntrX

GCGTACTGGAAAAGCTTAAAGAAAGGTATCCTTATTTACCTGTTATTATGATTAGTGGGCATGGTAATATTGC




TACTGCTGTAAAGTCTTTGCATATGGGTGCTTATGATTATATAGAAAAGCCTTTTACAGAAGGAAGATTAAA




GTTGTAAAGAGAGCTATAGAGTCTGGTAGATTACGTAGAGAAAATGATGAGTTGAAATCAGCATTTGAGGA




TTATGAGATAGTGGGTAACTCGCCTGTTATACGTAATTTGAGAAGTATGATTAATAA






E. chaffeensis

20
TTAATAAAGGATATATTAAGTGATGATAATTATGTCACAAAATTAGCAGTTGATGGGTTGTCTGCTATTAAGA


ntrX

TGGCTTATGAGAAAGAACCAGATGTTGTTTTACTAGATATATGGTTAAAAGGATCAGATATTGATGGGTTAA




GTGTTTTAGAGAAACTAAAGGAAAGGTATCCATATTTACCTGTGATTATGATTAGTGGACATGGTAATATTGC




TACTGCTGTGAAGTCTTTGCACATGGGAGCTTATGATTATATAGAGAAACCTTTTACAGAAGGTAGATTAAA




GTTAGTAGTTAAGAGAGCGATAGAATCTGGTAGATTGCGTAGAGAAAATGACGAATTAAAATCAACATTTGA




AGATTACGAAATAGTTGGCAACTCTCCTGTAATAAAAAATCTAAGGAGTATGATTAATAA









NtrX is Expressed in Senegal Virulent Strain but not in the Attenuated Strain


To confirm the pseudogenisation of ntrX in the attenuated strain, we performed a RT-PCR on RNA samples from the virulent (passage 7 and 11) and avirulent (passage 63 and 66) strains. RT-PCR resulted in the amplification of a 517 bp in one (Senegal passage 11 and not Senegal passage 7) of the two virulent samples confirming the expression of ntrX. No band was observed in either of the samples from the attenuated strain indicating that ntrX gene is not expressed in the attenuated Senegal strain.


Vaccination with the Attenuated Strain


After inoculation, the goats infected with the attenuated strain suffered from a slight hyperthermia with no other clinical signs and all survived even with 10 fold lethal dose of challenge. Consequently, the mutant E. ruminantium passage 64 is attenuated.


100% of goats infected with the attenuated strain and which were submitted to a challenge with the virulent strain (E. ruminantium passage 7) survived, whereas all the control goats, which were submitted to a challenge with the virulent strain without having been previously infected with the attenuated strain, died.


These results show that a E. ruminatium with an inactive or deleted ntrX gene provides an efficient vaccine against ehrlichiosis.


Owing to the very high conservation degree of the ntrX gene in the Anaplasmataceae family (see table 1), these results apply to the other strains of the Anaplasmataceae family.


REFERENCES

Throughout this application, various references describe the state of the art to which this invention pertains. The disclosures of these references are hereby incorporated by reference into the present application.


Atack, John M., Yogitha N. Srikhanta, Karrera Y. Djoko, Jessica P. Welch, Norain H. M. Hasri, Christopher T. Steichen, Rachel N. Vanden Hoven, et al. 2013. “Characterization of an ntrX Mutant of Neisseria Gonorrhoeae Reveals a Response Regulator That Controls Expression of Respiratory Enzymes in Oxidase-Positive Proteobacteria.” Journal of Bacteriology 195 (11): 2632-41. doi:10.1128/JB.02062-12.


Banerji, Sangeeta, and Antje Flieger. 2004. “Patatin-like Proteins: A New Family of Lipolytic Enzymes Present in Bacteria?” Microbiology (Reading, England) 150 (Pt 3): 522-25. doi:10.1099/mic.0.26957-0.


Bekker, Cornelis P. J., Lesley Bell-Sakyi, Edith A. Paxton, Dominique Martinez, Albert Bensaid, and Frans Jongejan. 2002. “Transcriptional Analysis of the Major Antigenic Protein 1 Multigene Family of Cowdria Ruminantium.” Gene 285 (1-2): 193-201.


Bekker, Cornelis P. J., Milagros Postigo, Amar Taoufik, Lesley Bell-Sakyi, Conchita Ferraz, Dominique Martinez, and Frans Jongejan. 2005. “Transcription Analysis of the Major Antigenic Protein 1 Multigene Family of Three In Vitro-Cultured Ehrlichia Ruminantium Isolates.” Journal of Bacteriology 187 (14): 4782-91. doi:10.1128/JB.187.14.4782-4791.2005.


Camus, E., and N. Barré. 1988. “[Diagnosis of heartwater from brain ecrasement].” Revue


Cheng, Zhihui, Yumi Kumagai, Mingqun Lin, Chunbin Zhang, and Yasuko Rikihisa. 2006. “Intra-Leukocyte Expression of Two-Component Systems in Ehrlichia Chaffeensis and Anaplasma phagocytophilum and Effects of the Histidine Kinase Inhibitor Closantel.” Cellular Microbiology 8 (8): 1241-52. doi:10.1111/j.1462-5822.2006.00704.x.


Cheng, Zhihui, Mingqun Lin, and Yasuko Rikihisa. 2014. “Ehrlichia Chaffeensis Proliferation Begins with NtrY/NtrX and PutA/GInA Upregulation and CtrA Degradation Induced by Proline and Glutamine Uptake.” mBio 5 (6). doi:10.1128/mBio.02141-14.


Chevreux, B., T. Wetter, and S. Suhai. 1999. “Genome Sequence Assembly Using Trace Signals and Additional Sequence Information.” In Proceedings of the German Conference on Bioinformatics, 99:45-56.


Collins, Nicola E., Junita Liebenberg, Etienne P. de Villiers, Kelly A. Brayton, Elmarié Louw, Alri Pretorius, F. Erika Faber, et al. 2005. “The Genome of the Heartwater Agent Ehrlichia ruminantium Contains Multiple Tandem Repeats of Actively Variable Copy Number.” Proceedings of the National Academy of Sciences of the United States of America 102 (3): 838-43. doi:10.1073/pnas.0406633102.


Darling, Aaron C. E., Bob Mau, Frederick R. Blattner, and Nicole T. Perna. 2004. “Mauve: Multiple Alignment of Conserved Genomic Sequence with Rearrangements.” Genome Research 14 (7): 1394-1403. doi:10.1101/gr.2289704.


Dunning Hotopp, Julie C., Mingqun Lin, Ramana Madupu, Jonathan Crabtree, Samuel V. Angiuoli, Jonathan A. Eisen, Jonathan Eisen, et al. 2006. “Comparative Genomics of Emerging Human Ehrlichiosis Agents.” PLoS Genetics 2 (2): e21. doi:10.1371/journal.pgen.0020021.


Frees, Dorte, Lone Brondsted, and Hanne Ingmer. 2013. “Bacterial Proteases and Virulence.” Sub-Cellular Biochemistry 66: 161-92. doi:10.1007/978-94-007-5940-4_7.


Frutos, Roger, Alain Viari, Conchita Ferraz, Anne Morgat, Sophie Eychenié, Yane Kandassamy, Isabelle Chantal, et al. 2006. “Comparative Genomic Analysis of Three Strains of Ehrlichia ruminantium Reveals an Active Process of Genome Size Plasticity.” Journal of Bacteriology 188 (7): 2533-42. doi:10.1128/JB.188.7.2533-2542.2006.


Galardini, Marco, Emanuele G. Biondi, Marco Bazzicalupo, and Alessio Mengoni. 2011. “CONTIGuator: A Bacterial Genomes Finishing Tool for Structural Insights on Draft Genomes.” Source Code for Biology and Medicine 6: 11. doi:10.1186/1751-0473-6-11.


Garcia-Garcia, Jose C., José de la Fuente, Gianna Bell-Eunice, Edmour F. Blouin, and Katherine M. Kocan. 2004. “Glycosylation of Anaplasma Marginale Major Surface Protein 1a and Its Putative Role in Adhesion to Tick Cells.” Infection and Immunity 72 (5): 3022-30. doi:10.1128/IAI.72.5.3022-3030.2004.


Jansen, Gunther, Lena L. Crummenerl, Felix Gilbert, Timm Mohr, Roxana Pfefferkorn, Robert Thanert, Philip Rosenstiel, and Hinrich Schulenburg. 2015. “Evolutionary Transition from Pathogenicity to Commensalism: Global Regulator Mutations Mediate Fitness Gains through Virulence Attenuation.” Molecular Biology and Evolution 32 (11): 2883-96. doi:10.1093/molbev/msv160.


Jelsbak, Lotte, Hassan Hartman, Casper Schroll, Jesper T. Rosenkrantz, Sebastien Lemire, Inke Wallrodt, Line E. Thomsen, et al. 2014. “Identification of Metabolic Pathways Essential for Fitness of Salmonella Typhimurium In Vivo.” PLoS ONE 9 (7): e101869. doi:10.1371/journal.pone.0101869.


Jongejan, F. 1991. “Protective Immunity to Heartwater (Cowdria Ruminantium Infection) Is Acquired after Vaccination with in Vitro-Attenuated Rickettsiae.” Infection and Immunity 59 (2): 729-31.


Köhler, Stephan, Vincent Foulongne, Safia Ouahrani-Bettache, Gisèle Bourg, Jacques Teyssier, Michel Ramuz, and Jean-Pierre Liautard. 2002. “The Analysis of the Intramacrophagic Virulome of Brucella Suis Deciphers the Environment Encountered by the Pathogen inside the Macrophage Host Cell.” Proceedings of the National Academy of Sciences of the United States of America 99 (24): 15711-16. doi:10.1073/pnas.232454299.


Kumagai, Yumi, Zhihui Cheng, Mingqun Lin, and Yasuko Rikihisa. 2006. “Biochemical Activities of Three Pairs of Ehrlichia Chaffeensis Two-Component Regulatory System Proteins Involved in Inhibition of Lysosomal Fusion.” Infection and Immunity 74 (9): 5014-22. doi:10.1128/IAI.00735-06.


Laliberté, Julie, and Vern B. Carruthers. 2011. “Toxoplasma Gondii Toxolysin 4 Is an Extensively Processed Putative Metalloproteinase Secreted from Micronemes.” Molecular and Biochemical Parasitology 177 (1): 49-56. doi:10.1016/j.molbiopara.2011.01.009.


Langmead, Ben, and Steven L. Salzberg. 2012. “Fast Gapped-Read Alignment with Bowtie 2.” Nature Methods 9 (4): 357-59. doi:10.1038/nmeth.1923.


Li, Heng, Bob Handsaker, Alec Wysoker, Tim Fennell, Jue Ruan, Nils Homer, Gabor Marth, Goncalo Abecasis, Richard Durbin, and 1000 Genome Project Data Processing Subgroup. 2009. “The Sequence Alignment/Map Format and SAMtools.”


Bioinformatics (Oxford, England) 25 (16): 2078-79. doi:10.1093/bioinformatics/btp352.


Marcelino, Isabel, Célia Veríssimo, Marcos F. Q. Sousa, Manuel J. T. Carrondo, and Paula M. Alves. 2005. “Characterization of Ehrlichia ruminantium Replication and Release Kinetics in Endothelial Cell Cultures.” Veterinary Microbiology 110 (1-2): 87-96. doi:10.1016/j.vetmic.2005.07.012.


Milne, Iain, Gordon Stephen, Micha Bayer, Peter J. A. Cock, Leighton Pritchard, Linda Cardle, Paul D. Shaw, and David Marshall. 2013. “Using Tablet for Visual Exploration of Second-Generation Sequencing Data.” Briefings in Bioinformatics 14 (2): 193-202. doi:10.1093/bib/bbs012.


Nene, Vishvanath, and Chittaranjan Kole. 2008. Genome Mapping and Genomics in Animal-Associated Microbes. Springer Science & Business Media.


Park, Jinho, Kyoung Seong Choi, and J. Stephen Dumler. 2003. “Major Surface Protein 2 of Anaplasma phagocytophilum Facilitates Adherence to Granulocytes.” Infection and Immunity 71 (7): 4018-25. doi:10.1128/IAI.71.7.4018-4025.2003.


Parkinson, J. S., and E. C. Kofoid. 1992. “Communication Modules in Bacterial Signaling Proteins.” Annual Review of Genetics 26: 71-112. doi:10.1146/annurev.ge.26.120192.000443.


Paradis, Emmanuel, Julien Claude, and Korbinian Strimmer. 2004. “APE: Analyses of Phylogenetics and Evolution in R Language.” Bioinformatics 20 (2): 289-90. doi:10.1093/bioinformatics/btg412.


“Picard Tools.” 2016. Accessed March 22. http://broadinstitute.github.io/picard/.


Pilet, Héloïse, Nathalie Vachiéry, Moez Berrich, Rim Bouchouicha, Benoît Durand, Ludovic Pruneau, Valérie Pinarello, et al. 2012. “A New Typing Technique for the Rickettsiales Ehrlichia ruminantium: Multiple-Locus Variable Number Tandem Repeat Analysis.” Journal of Microbiological Methods 88 (2): 205-11. doi:10.1016/j.mimet.2011.11.011.


Rahman, M. Sayeedur, Nicole C. Ammerman, Khandra T. Sears, Shane M. Ceraul, and Abdu F. Azad. 2010. “Functional Characterization of a Phospholipase A2 Homolog from Rickettsia typhi.” Journal of Bacteriology 192 (13): 3294-3303. doi:10.1128/JB.00155-10.


Tanner, Jennifer R., Laam Li, Sebastien P. Faucher, and Ann Karen C. Brassinga. 2016. “The CpxRA Two-Component System Contributes to Legionella pneumophila Virulence.” Molecular Microbiology, March, n/a-n/a. doi:10.1111/mmi.13365.


Tamura, K., and M. Nei. 1993. “Estimation of the Number of Nucleotide Substitutions in the Control Region of Mitochondrial DNA in Humans and Chimpanzees.” Molecular Biology and Evolution 10 (3): 512-26.


Vachiéry N., Lefrançois, T., Esteves, I., Molia, S., Sheikboudou, C., Kandassamy Y., Martinez, D., Optimisation of the inactivated vaccine dose against heartwater and in vitro quantification of Ehrlichia ruminantium challenge material. 2006. Vaccine, 24: 4747-4756.


Van Heerden H1, Steyn H C, Allsopp M T, Zweygarth E, Josemans A I, Allsopp B A. 2004 “Characterization of the pCS20 region of different Ehrlichia ruminantium isolates.” Vet Microbiol. 101(4):279-91.


Xiang, Zuoshuang, Wenjie Zheng, and Yongqun He. 2006. “BBP: Brucella Genome Annotation with Literature Mining and Curation.” BMC Bioinformatics 7: 347. doi:10.1186/1471-2105-7-347.


Zweygarth, Erich, Antoinette I. Josemans, M. Fransie Van Strijp, Laura Lopez-Rebollar, Mirinda Van Kleef, and Basil A. Allsopp. 2005. “An Attenuated Ehrlichia ruminantium (Welgevonden Stock) Vaccine Protects Small Ruminants against Virulent Heartwater Challenge.” Vaccine 23 (14): 1695-1702. doi:10.1016/j.vaccine.2004.09.030.

Claims
  • 1. A vaccine composition comprising a bacterial strain with a deleted or inactive ntrX gene.
  • 2. The vaccine composition according to claim 1, wherein said ntrX gene: encodes a NtrX protein having the amino acid sequence of SEQ ID NO: 1oris an active homologue thereof encoding a NtrX protein having an amino acid sequence with at least 50% of identity with SEQ ID NO: 1.
  • 3. The vaccine composition according to claim 1 wherein: the inactive ntrX gene is an inactive mutant: of a ntrX gene encoding a NtrX protein having the amino acid sequence of SEQ ID NO: 1orof an active homologue thereof encoding a NtrX protein having a amino acid sequence with at least 50% of identity with SEQ ID NO: 1;orthe ntrX gene which is: a ntrX gene encoding a NtrX protein having the amino acid sequence of SEQ ID NO: 1or an active homologue thereof encoding a NtrX protein having an amino acid sequence with at least 50% of identity with SEQ ID NO: 1is deleted.
  • 4. The vaccine composition according to claim 1 wherein: the inactive ntrX gene is an inactive mutant of a ntrX gene encoding a NtrX protein having the amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9 and SEQ ID NO:10orthe ntrX gene encoding a NtrX protein having the amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9 and SEQ ID NO:10 is deleted.
  • 5. The vaccine composition according to claim 1, wherein said vaccine composition comprises a pharmaceutically acceptable excipient.
  • 6-9. (canceled)
  • 10. The vaccine composition according to claim 1, wherein the bacterial strain is an Alphaproteobacteria strain.
  • 11. The vaccine composition according to claim 1, wherein the bacterial strain is selected from the group consisting of an Ehrlichia strain, an Anaplasma strain, a Rickettsia strain, an Orientia strain, a Bartonella strain and a Brucella strain.
  • 12. The vaccine composition according to claim 1, wherein the bacterial strain is selected from the group consisting of: E. canis, E. chaffeensis, E. ewingii, E. muris, and E. ruminantium.
  • 13. A method for producing a vaccine composition for use against a bacterial strain comprising: inactivating or deleting the ntrX gene of the bacterial strain, thereby obtaining an attenuated bacterial strain.
  • 14. The method for producing a vaccine composition according to claim 13, wherein the bacterial strain is is an Alphaproteobacteria strain.
  • 15. The method for producing a vaccine composition according to claim 14, wherein the Alphaproteobacteria strain is a Rickettsiales strain.
  • 16. The method for producing a vaccine composition according to claim 14, wherein the Alphaproteobacteria strain is a Anaplasmataceae strain.
  • 17. The method for producing a vaccine composition according to claim 13, wherein the bacterial strain is selected from the group consisting of an Ehrlichia strain, an Anaplasma strain, a Rickettsia strain, an Orientia strain, a Bartonella strain and a Brucella strain.
  • 18. The method for producing a vaccine composition according to claim 13, wherein the bacterial strain is selected from the group consisting of: E. canis, E. chaffeensis, E. ewingii, E. muris, and E. ruminantium.
  • 19. The vaccine composition according to claim 10, wherein the Alphaproteobacteria strain is a Rickettsiales strain.
  • 20. The vaccine composition according to claim 10, wherein the Alphaproteobacteria strain is a Anaplasmataceae strain.
  • 21. A method of inducing an immune response against a bacterial strain, comprising administering the vaccine composition of claim 1 to a subject in need thereof.
  • 22. The method of claim 21, wherein administering the vaccine composition prevents and/or treats an infection caused by the bacterial strain.
  • 23. The method of claim 21, wherein the bacterial strain is an Ehrlichia strain and the infection caused by the bacterial strain is ehrlichiosis
  • 24. The method of claim 21, wherein the bacterial strain is an Alphaproteobacteria strain.
Priority Claims (1)
Number Date Country Kind
17306235.7 Sep 2017 EP regional
PCT Information
Filing Document Filing Date Country Kind
PCT/EP2018/075634 9/21/2018 WO 00