Mannanases

Information

  • Patent Application
  • 20030203466
  • Publication Number
    20030203466
  • Date Filed
    February 20, 2003
    23 years ago
  • Date Published
    October 30, 2003
    22 years ago
Abstract
The present invention relates to mannanases comprising e.g., a sequence of amino acids 32-330 of SEQ ID NO: 2 or their homologues may be derived from e.g., Bacillus sp. I633, or may be encoded by polynucleotide molecules comprising a sequence of nucleotides 94-990 of SEQ ID NO: 1 from, polynucleotide molecules that encode a polypeptide that is at least 65% identical to the sequence of amino acids 32-330 of SEQ ID NO: 2, or degenerate nucleotide sequences thereof. The mannanases are alkaline and are useful e.g. in cleaning compositions, in a fracturing fluid useful to fracture a subterranean formation, for modifying plant material, and for treatment of cellulosic fibers.
Description


BACKGROUND OF THE INVENTION

[0002] 1. Field of the Invention


[0003] The present invention relates to microbial mannanases, more specifically to microbial enzymes exhibiting mannanase activity as their major enzymatic activity in the neutral and alkaline pH ranges; to a method of producing such enzymes; and to methods for using such enzymes in the paper and pulp, textile, oil drilling, cleaning, laundering, detergent, and cellulose fiber processing industries.


[0004] 2. Description of Related Art


[0005] Mannan containing polysaccharides are a major component of the hemicellulose fraction in woods and endosperm in many leguminous seeds and in some mature seeds of non-leguminous plants. Essentially unsubstituted linear beta-1,4-mannan is found in some non-leguminous plants. Unsubstituted beta-1,4-mannan which is present e.g. in ivory nuts resembles cellulose in the conformation of the individual polysaccharide chains, and is water-insoluable. In leguminous seeds, water-soluble galactomannan is the main storage carbohydrate comprising up to 20% of the total dry weight. Galactomannans have a linear beta-1,4-mannan backbone substituted with single alpha-1,6-galactose, optionally substituted with acetyl groups. Mannans are also found in several monocotyledonous plants and are the most abundant polysaccharides in the cell wall material in palm kernel meal. Glucomannans are linear polysaccharides with a backbone of beta-1,4-linked mannose and glucose alternating in a more or less regular manner, the backbone optionally being substituted with galactose and/or acetyl groups. Mannans, galactomannans, glucomannans and galactoglucomannans (i.e. glucomannan backbones with branched galactose) contribute to more than 50% of the softwood hemicellulose. Moreover, the cellulose of many red algae contains a significant amount of mannose.


[0006] Mannanases have been identified in several Bacillus organisms. For example, Talbot et al. (Appl. Environ. Microbiol., 1990, 56(11): 3505-3510) describe a beta-mannanase derived from Bacillus stearothermophilus in dimer form having a molecular weight of 162 kDa and a pH optimum of 5.5-7.5. Mendoza et al. (World J. Microbiol. Biotech., 1994, 10(5):: 551-555) describe a beta-mannanase derived from Bacillus subtilis having a molecular weight of 38 kDa, an optimum activity at pH 5.0 and 55° C. and a pl of 4.8. JP-A-03047076 discloses a beta-mannanase derived from Bacillus sp., having a molecular weight of 37±3 kDa measured by gel filtration, a pH optimum of 8-10 and a pl of 5.3-5.4. JP-A-63056289 describes the production of an alkaline, thermostable beta-mannanase which hydrolyzes beta-1,4-D-mannopyranoside bonds of e.g. mannans and produces manno-oligosaccharides. JP-A-63036775 relates to the Bacillus microorganism FERM P-8856 which produces beta-mannanase and beta-mannosidase at an alkaline pH. JP-A-08051975 discloses alkaline beta-mannanases from alkalophilic Bacillus sp. AM-001 having molecular weights of 43±3 kDa and 57±3 kDa and a pH optimum of 8-10. A purified mannanase from Bacillus amyloliquefaciens useful in the bleaching of pulp and paper and a method of preparation thereof is disclosed in WO 97/11164. WO 91/18974 describes a hemicellulase such as a glucanase, xylanase or mannanase active at an extreme pH and temperature. WO 94/25576 discloses an enzyme from Aspergillus aculeatus, CBS 101.43, exhibiting mannanase activity which may be useful for degradation or modification of plant or algae cell wall material. WO 93/24622 discloses a mannanase isolated from Trichoderma reseei useful for bleaching lignocellulosic pulps.


[0007] WO 95/35362 discloses cleaning compositions containing plant cell wall degrading enzymes having pectinase and/or hemicellulase and optionally cellulase activity for the removal of stains of vegetable origin and further discloses an alkaline mannanase from the strain C11SB.G17.


[0008] It is an object of the present invention to provide a novel and efficient enzyme exhibiting mannanase activity also in the alkaline pH range, e.g. when applied in cleaning compositions or different industrial processes.



SUMMARY OF THE INVENTION

[0009] The inventors have found novel enzymes having substantial mannanase activity, i.e. enzymes exhibiting mannanase activity which may be obtained from a bacterial strain of the genus Bacillus and have succeeded in identifying DNA sequences encoding such enzymes. The DNA sequences are set forth in SEQ ID NOS: 1, 5, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29 and 31; and the deduced amino acid sequences are set forth in SEQ ID NOS: 2, 6, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30 and 32, respectively. It is believed that the enzymes will be classified according to the Enzyme Nomenclature in the Enzyme Class EC 3.2.1.78.


[0010] In a first aspect, the present invention relates to a mannanase which is i) a polypeptide produced by Bacillus sp. I633, ii) a polypeptide comprising an amino acid sequence as shown in positions 32-330 of SEQ ID NO: 2, or iii) an analogue of the polypeptide defined in i) or ii) which is at least 65% homologous with said polypeptide, is derived from said polypeptide by substitution, deletion or addition of one or several amino acids, or is immunologically reactive with a polyclonal antibody raised against said polypeptide in purified form.


[0011] Within one aspect, the present invention provides an isolated polynucleotide molecule selected from the group consisting of (a) polynucleotide molecules encoding a polypeptide having mannanase activity and comprising a sequence of nucleotides as shown in SEQ ID NO: 1 from nucleotide 94 to nucleotide 990; (b) species homologs of (a); (c) polynucleotide molecules that encode a polypeptide having mannanase activity that is at least 65% identical to the sequence of amino acids 32-330 of SEQ ID NO: 2; (d) molecules complementary to (a), (b) or (c); and (e) degenerate nucleotide sequences of (a), (b), (c) or (d).


[0012] The plasmid pBXM3 comprising the polynucleotide molecule (the DNA sequence) encoding a mannanase of the present invention has been transformed into a strain of the Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig, Federal Republic of Germany, May 29, 1998 under the deposition number DSM 12197.


[0013] Another aspect of the invention relates to an expression vector comprising the following operably linked elements: a transcription promoter; a DNA segment selected from the group consisting of (a) polynucleotide molecules encoding a polypeptide having mannanase activity and comprising a sequence of nucleotides 94-990 of SEQ ID NO: 1; (b) species homologs of (a); (c) polynucleotide molecules that encode a polypeptide having mannanase activity that is at least 65% identical to the sequence of amino acids 32-330 of SEQ ID NO: 2; and (d) degenerate nucleotide sequences of (a), (b), or (c); and a transcription terminator.


[0014] In another embodiment, the present invention relates to a cultured cell into which has been introduced an expression vector as disclosed above, wherein said cell expresses the polypeptide encoded by the DNA segment.


[0015] Further aspects of the present invention provide an isolated polypeptide having mannanase activity selected from the group consisting of (a) polypeptide molecules comprising a sequence of amino acids 32-330 of SEQ ID NO: 2; (b) species homologs of (a); and a fusion protein having mannanase activity comprising a first polypeptide part exhibiting mannanase activity and a second polypeptide part exhibiting cellulose binding function, the second polypeptide preferably being a cellulose binding domain (CBD), such as a fusion protein represented by SEQ ID NO: 4.


[0016] In another embodiment, the present invention relates to a composition comprising a purified polypeptide according to the invention in combination with other polypeptides.


[0017] In another embodiment, the present invention relates to methods for producing a polypeptide according to the invention comprising culturing a cell into which has been introduced an expression vector as disclosed above, whereby said cell expresses a polypeptide encoded by the DNA segment and recovering the polypeptide.


[0018] The enzymes of the present invention are useful for the treatment of cellulosic material, especially cellulose-containing fiber, yarn, woven or non-woven fabric, treatment of mechanical paper-making pulps, kraft pulps or recycled waste paper, and for retting of fibers. The treatment can be carried out during the processing of cellulosic material into a material ready for manufacture of paper or of garment or fabric, the latter e.g. in the desizing or scouring step; or during industrial or household laundering of such fabric or garment.


[0019] Accordingly, in another embodiment, the present invention relates to a cleaning or detergent composition comprising the enzyme of the invention; and to use of the enzyme of the invention for the treatment, eg cleaning, of cellulose-containing fibers, yarn, woven or non-woven fabric, as well as synthetic or partly synthetic fabric.


[0020] It is contemplated that the enzyme of the invention is useful in an enzymatic scouring process and/or desizing (removal of mannan size) in the preparation of cellulosic material e.g. for proper response in subsequent dyeing operations. The enzyme is also useful for removal of mannan containing print paste. Further, detergent compositions comprising the novel enzyme are capable of removing or bleaching certain soils or stains present on laundry, especially soils and spots resulting from mannan containing food, plants, and the like. Further, treatment with cleaning or detergent compositions comprising the novel enzyme can improve whiteness as well as prevent binding of certain soils to the cellulosic material.


[0021] Accordingly, the present invention also relates to cleaning compositions, including laundry, dishwashing, hard surface cleaner, personal cleansing and oral/dental compositions, comprising the mannanase of the invention. Further, the present invention relates to such cleaning compositions comprising a mannanase and an enzyme selected from cellulases, proteases, lipases, amylases, pectin degrading enzymes and xyloglucanases, such compositions providing superior cleaning performance, i.e. superior stain removal, dingy cleaning or whiteness maintenance.







BRIEF DESCRIPTION OF THE DRAWINGS

[0022]
FIG. 1 shows a phylogenic tree generated from ARP program relating closest species to Bacillus sp. I633.


[0023]
FIG. 2 shows a phylogenic tree generated from ARP program relating closest species to Bacillus halodurans.


[0024]
FIG. 3 shows a phylogenic tree generated from ARP program relating closest species to Bacillus sp. AAI12.







DEFINITIONS

[0025] Prior to discussing this invention in further detail, the following terms will first be defined.


[0026] The term “ortholog” (or “species homolog”) denotes a polypeptide or protein obtained from one species that has homology to an analogous polypeptide or protein from a different species.


[0027] The term “paralog” denotes a polypeptide or protein obtained from a given species that has homology to a distinct polypeptide or protein from that same species.


[0028] The term “expression vector” denotes a DNA molecule, linear or circular, that comprises a segment encoding a polypeptide of interest operably linked to additional segments that provide for its transcription. Such additional segments may include promoter and terminator sequences, and may optionally include one or more origins of replication, one or more selectable markers, an enhancer, a polyadenylation signal, and the like. Expression vectors are generally derived from plasmid or viral DNA, or may contain elements of both. The expression vector of the invention may be any expression vector that is conveniently subjected to recombinant DNA procedures, and the choice of vector will often depend on the host cell into which the vector is to be introduced. Thus, the vector may be an autonomously replicating vector, i.e. a vector which exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g. a plasmid. Alternatively, the vector may be one which, when introduced into a host cell, is integrated into the host cell genome and replicated together with the chromosome(s) into which it has been integrated.


[0029] The term “recombinant expressed” or “recombinantly expressed” used herein in connection with expression of a polypeptide or protein is defined according to the standard definition in the art. Recombinantly expression of a protein is generally performed by using an expression vector as described immediately above.


[0030] The term “isolated”, when applied to a polynucleotide molecule, denotes that the polynucleotide has been removed from its natural genetic milieu and is thus free of other extraneous or unwanted coding sequences, and is in a form suitable for use within genetically engineered protein production systems. Such isolated molecules are those that are separated from their natural environment and include cDNA and genomic clones. Isolated DNA molecules of the present invention are free of other genes with which they are ordinarily associated, but may include naturally occurring 5′ and 3′ untranslated regions such as promoters and terminators. The identification of associated regions will be evident to one of ordinary skill in the art (see for example, Dynan and Tijan, 1985, Nature, 316:774-78). The term “an isolated polynucleotide” may alternatively be termed “a cloned polynucleotide”.


[0031] When applied to a protein/polypeptide, the term “isolated” indicates that the protein is found in a condition other than its native environment. In a preferred form, the isolated protein is substantially free of other proteins, particularly other homologous proteins (i.e., “homologous impurities” (see below)). It is preferred to provide the protein in a greater than 40% pure form, more preferably greater than 60% pure form.


[0032] Even more preferably it is preferred to provide the protein in a highly purified form, i.e., greater than 80% pure, more preferably greater than 95% pure, and even more preferably greater than 99% pure, as determined by SDS-PAGE.


[0033] The term “isolated protein/polypeptide may alternatively be termed “purified protein/polypeptide”.


[0034] The term “homologous impurities” means any impurity (e.g. another polypeptide than the polypeptide of the invention) which originate from the homologous cell where the polypeptide of the invention is originally obtained from.


[0035] The term “obtained from” as used herein in connection with a specific microbial source, means that the polynucleotide and/or polypeptide is produced by the specific source (homologous expression), or by a cell in which a gene from the source have been inserted (heterologous expression).


[0036] The term “operably linked”, when referring to DNA segments, denotes that the segments are arranged so that they function in concert for their intended purposes, e.g. transcription initiates in the promoter and proceeds through the coding segment to the terminator.


[0037] The term “polynucleotide” denotes a single- or double-stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5′ to the 3′ end. Polynucleotides include RNA and DNA, and may be isolated from natural sources, synthesized in vitro, or prepared from a combination of natural and synthetic molecules.


[0038] The term “complements of polynucleotide molecules” denotes polynucleotide molecules having a complementary base sequence and reverse orientation as compared to a reference sequence. For example, the sequence 5′-ATGCACGGG-3′ is complementary to 5′-CCCGTGCAT-3′.


[0039] The term “degenerate nucleotide sequence” denotes a sequence of nucleotides that includes one or more degenerate codons (as compared to a reference polynucleotide molecule that encodes a polypeptide). Degenerate codons contain different triplets of nucleotides, but encode the same amino acid residue (i.e., GAU and GAC triplets each encode Asp).


[0040] The term “promoter” denotes a portion of a gene containing DNA sequences that provide for the binding of RNA polymerase and initiation of transcription. Promoter sequences are commonly, but not always, found in the 5′ non-coding regions of genes.


[0041] The term “secretory signal sequence” denotes a DNA sequence that encodes a polypeptide (a “secretory peptide”) that, as a component of a larger polypeptide, directs the larger polypeptide through a secretory pathway of a cell in which it is synthesized. The larger peptide is commonly cleaved to remove the secretory peptide during transit through the secretory pathway.


[0042] The term “enzyme core” denotes a single domain enzyme which may or may not have been modified or altered, but which has retained its original activity; the catalytic domain as known in the art has remained intact and functional.


[0043] By the term “linker” or “spacer” is meant a polypeptide comprising at least two amino acids which may be present between the domains of a multidomain protein, for example an enzyme comprising an enzyme core and a binding domain such as a cellulose binding domain (CBD) or any other enzyme hybrid, or between two proteins or polypeptides expressed as a fusion polypeptide, for example a fusion protein comprising two core enzymes. For example, the fusion protein of an enzyme core with a CBD is provided by fusing a DNA sequence encoding the enzyme core, a DNA sequence encoding the linker and a DNA sequence encoding the CBD sequentially into one open reading frame and expressing this construct.


[0044] The term “mannanase” or “galactomannanase” denotes a mannanase defined according to the art as officially named mannan endo-1,4-beta-mannosidase and having the alternative names beta-mannanase and endo-1,4-mannanase and catalysing hydrolyses of 1,4-beta-D-mannosidic linkages in mannans, galactomannans, glucomannans, and galactoglucomannans which enzyme is classified according to the Enzyme Nomenclature as EC 3.2.1.78 (http://www.expasy.ch/enzyme).



DETAILED DESCRIPTION OF THE INVENTION

[0045] How to Use a Sequence of the Invention to Obtain Other Related Sequences:


[0046] The disclosed sequence information herein relating to a polynucleotide sequence encoding a mannanase of the invention can be used as a tool to identify other homologous mannanases. For instance, polymerase chain reaction (PCR) can be used to amplify sequences encoding other homologous mannanases from a variety of microbial sources, in particular of different Bacillus species.


[0047] Assay for Activity Test


[0048] A polypeptide of the invention having mannanase activity may be tested for mannanase activity according to standard test procedures known in the art, such as by applying a solution to be tested to 4 mm diameter holes punched out in agar plates containing 0.2% AZCL galactomannan (carob), i.e. substrate for the assay of endo-1,4-beta-D-mannanase available as CatNo.I-AZGMA from the company Megazyme (Megazyme's Internet address: http://www.megazyme.com/Purchase/index.html).


[0049] Polynucleotides


[0050] Within preferred embodiments of the invention an isolated polynucleotide of the invention will hybridize to similar sized regions of SEQ ID NO: 1 or a sequence complementary thereto, under at least medium stringency conditions.


[0051] In particular polynucleotides of the invention will hybridize to a denatured double-stranded DNA probe comprising either the full sequence of SEQ ID NO: 1 or a partial sequence comprising the segment of nucleotides 94-990 of SEQ ID NO: 1 which segment encodes for the catalytically active domain or enzyme core of the mannanase of the invention or any probe comprising a subsequence of nucleotides 94-990 of SEQ ID NO: 1 which subsequence has a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail below. Suitable experimental conditions for determining hybridization at medium, or high stringency between a nucleotide probe and a homologous DNA or RNA sequence involves presoaking of the filter containing the DNA fragments or RNA to hybridize in 5×SSC (Sodium chloride/Sodium citrate, Sambrook et al. 1989) for 10 min, and prehybridization of the filter in a solution of 5×SSC, 5×Denhardt's solution (Sambrook et al., 1989), 0.5% SDS and 100 micrograms/ml of denatured sonicated salmon sperm DNA (Sambrook et al. 1989), followed by hybridization in the same solution containing a concentration of 10 ng/ml of a random-primed (Feinberg, A. P. and Vogelstein, B., 1983, Anal. Biochem., 132: 6-13), 32P-dCTP-labeled (specific activity higher than 1×109 cpm/microgram) probe for 12 hours at ca. 45° C. The filter is then washed twice for 30 minutes in 2×SSC, 0.5% SDS at least 60° C. (medium stringency), still more preferably at least 65° C. (medium/high stringency), even more preferably at least 70° C. (high stringency), and even more preferably at least 75° C. (very high stringency).


[0052] Molecules to which the oligonucleotide probe hybridizes under these conditions are detected using a x-ray film.


[0053] Other useful isolated polynucleotides are those which will hybridize to similar sized regions of SEQ ID NO: 5, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 21, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 29 or SEQ ID NO: 31, respectively, or a sequence complementary thereto, under at least medium stringency conditions.


[0054] Particularly useful are polynucleotides which will hybridize to a denatured double-stranded DNA probe comprising either the full sequence of SEQ ID NO: 5 or a partial sequence comprising the segment of nucleotides 94-1032 of SEQ ID NO: 5 which segment encodes for the catalytically active domain or enzyme core of the mannanase of the invention or any probe comprising a subsequence of nucleotides 94-1032 of SEQ ID NO: 5 which subsequence has a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail above; as well as polynucleotides which will hybridize to a denatured double-stranded DNA probe comprising either the full sequence of SEQ ID NO: 9 or a partial sequence comprising the segment of nucleotides 94-1086 of SEQ ID NO: 9 which segment encodes for the catalytically active domain or enzyme core of the mannanase of the invention or any probe comprising a subsequence of nucleotides 94-1086 of SEQ ID NO: 9 which subsequence has a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail above; as well as polynucleotides which will hybridize to a denatured double-stranded DNA probe comprising either the full sequence of SEQ ID NO: 11 or a partial sequence comprising the segment of nucleotides 97-993 of SEQ ID NO: 11 which segment encodes for the catalytically active domain or enzyme core of the mannanase of the invention or any probe comprising a subsequence of nucleotides 97-993 of SEQ ID NO: 11 which subsequence has a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail above; as well as polynucleotides which will hybridize to a denatured double-stranded DNA probe comprising either the full sequence of SEQ ID NO: 13 or a partial sequence comprising the segment of nucleotides 498-1464 of SEQ ID NO: 13 which segment encodes for the catalytically active domain or enzyme core of the mannanase of the invention or any probe comprising a subsequence of nucleotides 498-1464 of SEQ ID NO: 13 which subsequence has a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail above; as well as polynucleotides which will hybridize to a denatured double-stranded DNA probe comprising either the full sequence of SEQ ID NO: 15 or a partial sequence comprising the segment of nucleotides 204-1107 of SEQ ID NO: 15 which segment encodes for the catalytically active domain or enzyme core of the mannanase of the invention or any probe comprising a subsequence of nucleotides 204-1107 of SEQ ID NO: 15 which subsequence has a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail above; as well as polynucleotides which will hybridize to a denatured double-stranded DNA probe comprising either the sequence of SEQ ID NO: 17 or any probe comprising a subsequence of SEQ ID NO: 17 which subsequence has a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail above; as well as polynucleotides which will hybridize to a denatured double-stranded DNA probe comprising either the sequence of SEQ ID NO: 19 or any probe comprising a subsequence of SEQ ID NO: 19 which subsequence has a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail above; as well as polynucleotides which will hybridize to a denatured double-stranded DNA probe comprising either the full sequence of SEQ ID NO: 21 or a partial sequence comprising the segment of nucleotides 88-960 of SEQ ID NO: 21 which segment encodes for the catalytically active domain or enzyme core of the mannanase of the invention or any probe comprising a subsequence of nucleotides 88-960 of SEQ ID NO: 21 which subsequence has a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail above; as well as polynucleotides which will hybridize to a denatured double-stranded DNA probe comprising either the full sequence of SEQ ID NO: 23 or any probe comprising a subsequence of SEQ ID NO: 23 which subsequence has a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail above; as well as polynucleotides which will hybridize to a denatured double-stranded DNA probe comprising either the full sequence of SEQ ID NO: 25 or a partial sequence comprising the segment of nucleotides 904-1874 of SEQ ID NO: 25 which segment encodes for the catalytically active domain or enzyme core of the mannanase of the invention or any probe comprising a subsequence of nucleotides 904-1874 of SEQ ID NO: 25 which subsequence has a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail above; as well as polynucleotides which will hybridize to a denatured double-stranded DNA probe comprising either the full sequence of SEQ ID NO: 27 or a partial sequence comprising the segment of nucleotides 498-1488 of SEQ ID NO: 27 which segment encodes for the catalytically active domain or enzyme core of the mannanase of the invention or any probe comprising a subsequence of nucleotides 498-1488 of SEQ ID NO: 27 which subsequence has a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail above; as well as polynucleotides which will hybridize to a denatured double-stranded DNA probe comprising either the full sequence of SEQ ID NO: 29 or a partial sequence comprising the segment of nucleotides 79-1083 of SEQ ID NO: 29 which segment encodes for the catalytically active domain or enzyme core of the mannanase of the invention or any probe comprising a subsequence of nucleotides 79-1083 of SEQ ID NO: 29 which subsequence has a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail above; as well as polynucleotides which will hybridize to a denatured double-stranded DNA probe comprising either the full sequence of SEQ ID NO: 31 or a partial sequence comprising the segment of nucleotides 1779-2709 of SEQ ID NO: 31 which segment encodes for the catalytically active domain or enzyme core of the mannanase of the invention or any probe comprising a subsequence of nucleotides 1779-2709 of SEQ ID NO: 31 which subsequence has a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail above.


[0055] As previously noted, the isolated polynucleotides of the present invention include DNA and RNA. Methods for isolating DNA and RNA are well known in the art. DNA and RNA encoding genes of interest can be cloned in Gene Banks or DNA libraries by means of methods known in the art.


[0056] Polynucleotides encoding polypeptides having mannanase activity of the invention are then identified and isolated by, for example, hybridization or PCR.


[0057] The present invention further provides counterpart polypeptides and polynucleotides from different bacterial strains (orthologs or paralogs). Of particular interest are mannanase polypeptides from gram-positive alkalophilic strains, including species of Bacillus such as Bacillus sp., Bacillus agaradhaerens, Bacillus clausii, Bacillus halodurans, and Bacillus licheniformis; and mannanase polypeptides from Thermoanaerobacter group, including species of Caldicellulosiruptor. Also mannanases from the fungus Humicola or Scytalidium, in particular the species Humicola insolens or Scytalidium thermophilum, are of interest.


[0058] Species homologues of a polypeptide with mannanase activity of the invention can be cloned using information and compositions provided by the present invention in combination with conventional cloning techniques. For example, a DNA sequence of the present invention can be cloned using chromosomal DNA obtained from a cell type that expresses the protein. Suitable sources of DNA can be identified by probing Northern or Southern blots with probes designed from the sequences disclosed herein. A library is then prepared from chromosomal DNA of a positive cell line. A DNA sequence of the invention encoding an polypeptide having mannanase activity can then be isolated by a variety of methods, such as by probing with probes designed from the sequences disclosed in the present specification and claims or with one or more sets of degenerate probes based on the disclosed sequences. A DNA sequence of the invention can also be cloned using the polymerase chain reaction, or PCR (Mullis, U.S. Pat. No. 4,683,202), using primers designed from the sequences disclosed herein. Within an additional method, the DNA library can be used to transform or transfect host cells, and expression of the DNA of interest can be detected with an antibody (monoclonal or polyclonal) raised against the mannanase cloned from B. sp., expressed and purified as described in Materials and Methods and Example 1, or by an activity test relating to a polypeptide having mannanase activity.


[0059] The mannanase encoding part of the DNA sequence (SEQ ID NO: 1) cloned into plasmid pBXM3 present in Escherichia coli DSM 12197 and/or an analogue DNA sequence of the invention may be cloned from a strain of the bacterial species Bacillus sp. I633, or another or related organism as described herein.


[0060] The mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 5) was transformed into a strain of Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zelikulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig, Federal Republic of Germany, on May 18, 1998 under the deposition number DSM 12180; this mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 5) and/or an analogue DNA sequence thereof may be cloned from a strain of the bacterial species Bacillus agaradhaerens, for example from the type strain DSM 8721, or another or related organism as described herein.


[0061] The mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 9) was transformed into a strain of Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig, Federal Republic of Germany, on Oct. 7, 1998 under the deposition number DSM 12433; this mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 9) and/or an analogue DNA sequence thereof may be cloned from a strain of the bacterial species Bacillus sp. AAI12 or another or related organism as described herein.


[0062] The mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 11) was transformed into a strain of Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig, Federal Republic of Germany, on Oct. 9, 1998 under the deposition number DSM 12441; this mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 11) and/or an analogue DNA sequence thereof may be cloned from a strain of the bacterial species Bacillus halodurans or another or related organism as described herein.


[0063] The mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 13) was transformed into a strain of Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig, Federal Republic of Germany, on May 11, 1995 under the deposition number DSM 9984; this mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 13) and/or an analogue DNA sequence thereof may be cloned from a strain of the fungal species Humicola insolens or another or related organism as described herein.


[0064] The mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 15) was transformed into a strain of Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig, Federal Republic of Germany, on Oct. 5, 1998 under the deposition number DSM 12432; this mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 15) and/or an analogue DNA sequence thereof may be cloned from a strain of the bacterial species Bacillus sp. AA349 or another or related organism as described herein.


[0065] The mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 17) was transformed into a strain of Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig, Federal Republic of Germany, on Jun. 4, 1999 under the deposition number DSM 12847; this mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 17) and/or an analogue DNA sequence thereof may be cloned from a strain of the bacterial species Bacillus sp. or another or related organism as described herein.


[0066] The mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 19) was transformed into a strain of Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig, Federal Republic of Germany, on Jun. 4, 1999 under the deposition number DSM 12848; this mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 19) and/or an analogue DNA sequence thereof may be cloned from a strain of the bacterial species Bacillus sp. or another or related organism as described herein.


[0067] The mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 21) was transformed into a strain of Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig, Federal Republic of Germany, on Jun. 4, 1999 under the deposition number DSM 12849; this mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 21) and/or an analogue DNA sequence thereof may be cloned from a strain of the bacterial species Bacillus clausii or another or related organism as described herein.


[0068] The mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 23) was transformed into a strain of Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig, Federal Republic of Germany, on Jun. 4, 1999 under the deposition number DSM 12850; this mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 23) and/or an analogue DNA sequence thereof may be cloned from a strain of the bacterial species Bacillus sp. or another or related organism as described herein.


[0069] The mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 25) was transformed into a strain of Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig, Federal Republic of Germany, on Jun. 4, 1999 under the deposition number DSM 12846; this mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 25) and/or an analogue DNA sequence thereof may be cloned from a strain of the bacterial species Bacillus sp. or another or related organism as described herein.


[0070] The mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 27) was transformed into a strain of Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig, Federal Republic of Germany, on Jun. 4, 1999 under the deposition number DSM 12851; this mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 27) and/or an analogue DNA sequence thereof may be cloned from a strain of the bacterial species Bacillus sp. or another or related organism as described herein.


[0071] The mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 29) was transformed into a strain of Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig, Federal Republic of Germany, on Jun. 4, 1999 under the deposition number DSM 12852; this mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 29) and/or an analogue DNA sequence thereof may be cloned from a strain of the bacterial species Bacillus licheniformis or another or related organism as described herein.


[0072] The mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 31) was transformed into a strain of Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig, Federal Republic of Germany, on Oct. 5, 1998 under the deposition number DSM 12436; this mannanase encoding part of the polynucleotide molecule (the DNA sequence of SEQ ID NO: 31) and/or an analogue DNA sequence thereof may be cloned from a strain of the bacterial species Caldicellulosiruptor sp. or another or related organism as described herein.


[0073] Alternatively, the analogous sequence may be constructed on the basis of the DNA sequence obtainable from the plasmid present in Escherichia coli DSM 12197 (which is believed to be identical to SEQ ID NO: 1), the plasmid present in Escherichia coli DSM 12180 (which is believed to be identical to SEQ ID NO: 5), the plasmid present in Escherichia coli DSM 12433 (which is believed to be identical to SEQ ID NO: 9), the plasmid present in Escherichia coli DSM 12441 (which is believed to be identical to SEQ ID NO: 11), the plasmid present in Escherichia coli DSM 9984 (which is believed to be identical to SEQ ID NO: 13), the plasmid present in Escherichia coli DSM 12432 (which is believed to be identical to SEQ ID NO: 15), the plasmid present in Escherichia coli DSM 12847 (which is believed to be identical to SEQ ID NO: 17), the plasmid present in Escherichia coli DSM 12848 (which is believed to be identical to SEQ ID NO: 19), the plasmid present in Escherichia coli DSM 12849 (which is believed to be identical to SEQ ID NO: 21), the plasmid present in Escherichia coli DSM 12850 (which is believed to be identical to SEQ ID NO: 23), the plasmid present in Escherichia coli DSM 12846 (which is believed to be identical to SEQ ID NO: 25), the plasmid present in Escherichia coli DSM 12851 (which is believed to be identical to SEQ ID NO: 27), the plasmid present in Escherichia coli DSM 12852 (which is believed to be identical to SEQ ID NO: 29) or the plasmid present in Escherichia coli DSM 12436 (which is believed to be identical to SEQ ID NO: 31), e.g., a subsequence thereof, and/or by introduction of nucleotide substitutions which do not give rise to another amino acid sequence of the mannanase encoded by the DNA sequence, but which corresponds to the codon usage of the host organism intended for production of the enzyme, or by introduction of nucleotide substitutions which may give rise to a different amino acid sequence (i.e. a variant of the mannan degrading enzyme of the invention).


[0074] Polypeptides


[0075] The sequence of amino acids 32-490 of SEQ ID NO: 2 is a mature mannanase sequence. The sequence of amino acids 1-31 of SEQ ID NO: 2 is the signal peptide. It is believed that the sequence of amino acids 32-330 of SEQ ID NO: 2 is the catalytic domain of the mannanase and that the mature enzyme additionally comprises a linker at positions 331-342 and at least one C-terminal domain of unknown function at positions 343-490. Since the object of the present invention is to obtain a polypeptide which exhibits mannanase activity, the present invention relates to any mannanase comprising the sequence of amino acids 32-330 of SEQ ID NO: 2, i.e., a catalytical domain, optionally operably linked, either to the N-terminal or C-terminal, to one, two or more other domains of a different functionality. The domain having the sequence of amino acids 343-490 of SEQ ID NO: 2 is a domain of the mannanase of unknown function, which is highly homologous with similar domains in known mannanases, cf. Example 1.


[0076] The sequence of amino acids 32-494 of SEQ ID NO: 6 is a mature mannanase sequence. The sequence of amino acids 1-31 of SEQ ID NO: 6 is the signal peptide. It is believed that the subsequence of amino acids 32-344 of SEQ ID NO: 6 is the catalytic domain of the mannanase and that the mature enzyme additionally comprises at least one C-terminal domain of unknown function at positions 345-494. Since the object of the present invention is to obtain a polypeptide which exhibits mannanase activity, the present invention relates to any mannanase comprising the sequence of amino acids 32-344 of SEQ ID NO: 6, i.e., a catalytical domain, optionally operably linked, either to the N-terminal or C-terminal, to one, two or more other domains of a different functionality.


[0077] The sequence of amino acids 32-586 of SEQ ID NO: 10 is a mature mannanase sequence. The sequence of amino acids 1-31 of SEQ ID NO: 10 is the signal peptide. It is believed that the subsequence of amino acids 32-362 of SEQ ID NO: 10 is the catalytic domain of the mannanase and that the mature enzyme additionally comprises at least one C-terminal domain of unknown function in positions 363-586. Since the object of the present invention is to obtain a polypeptide which exhibits mannanase activity, the present invention relates to any mannanase comprising the sequence of amino acids 32-362 of SEQ ID NO: 10, i.e., a catalytical domain, optionally operably linked, either to the N-terminal or C-terminal, to one, two or more other domains of a different functionality.


[0078] The sequence of amino acids 33-331 of SEQ ID NO: 12 is a mature mannanase sequence. The sequence of amino acids 1-32 of SEQ ID NO: 12 is the signal peptide. It is believed that the subsequence of amino acids 33-331 of SEQ ID NO: 12 is the catalytic domain of the mannanase. This mannanase enzyme core comprising the sequence of amino acids 33-331 of SEQ ID NO: 12, i.e., a catalytical domain, may or may not be operably linked, either to the N-terminal or C-terminal, to one, two or more other domains of a different functionality, i.e. it is part of a fusion protein.


[0079] The sequence of amino acids 22-488 of SEQ ID NO: 14 is a mature mannanase sequence. The sequence of amino acids 1-21 of SEQ ID NO: 14 is the signal peptide. It is believed that the subsequence of amino acids 166-488 of SEQ ID NO: 14 is the catalytic domain of the mannanase and that the mature enzyme additionally comprises at least one N-terminal domain of unknown function at positions 22-164. Since the object of the present invention is to obtain a polypeptide which exhibits mannanase activity, the present invention relates to any mannanase comprising the sequence of amino acids 166-488 of SEQ ID NO: 14, i.e., a catalytical domain, optionally operably linked, either to the N-terminal or C-terminal, to one, two or more other domains of a different functionality.


[0080] The sequence of amino acids 26-369 of SEQ ID NO: 16 is a mature mannanase sequence. The sequence of amino acids 1-25 of SEQ ID NO: 16 is the signal peptide. It is believed that the subsequence of amino acids 68-369 of SEQ ID NO: 16 is the catalytic domain of the mannanase and that the mature enzyme additionally comprises at least one N-terminal domain of unknown function at positions 26-67. Since the object of the present invention is to obtain a polypeptide which exhibits mannanase activity, the present invention relates to any mannanase comprising the sequence of amino acids 68-369 of SEQ ID NO: 16, i.e., a catalytical domain, optionally operably linked, either to the N-terminal or C-terminal, to one, two or more other domains of a different functionality.


[0081] The sequence of SEQ ID NO: 18 is a partial sequence forming part of a mature mannanase sequence. The present invention relates to any mannanase comprising the sequence of amino acids 1-305 of SEQ ID NO: 18.


[0082] The sequence of SEQ ID NO: 20 is a partial sequence forming part of a mature mannanase sequence. The present invention relates to any mannanase comprising the sequence of amino acids 1-132 of SEQ ID NO: 20.


[0083] The sequence of amino acids 29-320 of SEQ ID NO: 22 is a mature mannanase sequence. The sequence of amino acids 1-28 of SEQ ID NO: 22 is the signal peptide. It is believed that the subsequence of amino acids 29-320 of SEQ ID NO: 22 is the catalytic domain of the mannanase. This mannanase enzyme core comprising the sequence of amino acids 29-320 of SEQ ID NO: 22, i.e., a catalytical domain, may or may not be operably linked, either to the N-terminal or C-terminal, to one, two or more other domains of a different functionality, i.e., it is part of a fusion protein.


[0084] The sequence of SEQ ID NO: 24 is a partial sequence forming part of a mature mannanase sequence. The present invention relates to any mannanase comprising the sequence of amino acids 29-188 of SEQ ID NO: 24.


[0085] The sequence of amino acids in positions 30-815 of SEQ ID NO: 26 is a mature mannanase sequence. The sequence of amino acids 1-29 of SEQ ID NO: 26 is the signal peptide. It is believed that the subsequence of amino acids 301-625 of SEQ ID NO: 26 is the catalytic domain of the mannanase and that the mature enzyme additionally comprises at least two N-terminal domains of unknown function at positions 44-166 and 195-300, respectively, and a C-terminal domain of unknown function at positions 626-815. Since the object of the present invention is to obtain a polypeptide which exhibits mannanase activity, the present invention relates to any mannanase comprising the sequence of amino acids 301-625 of SEQ ID NO: 26, i.e., a catalytical domain, optionally operably linked, either to the N-terminal or C-terminal, to one, two or more other domains of a different functionality.


[0086] The sequence of amino acids 38-496 of SEQ ID NO: 28 is a mature mannanase sequence. The sequence of amino acids 1-37 of SEQ ID NO: 28 is the signal peptide. It is believed that the subsequence of amino acids 166-496 of SEQ ID NO: 28 is the catalytic domain of the mannanase and that the mature enzyme additionally comprises at least one N-terminal domain of unknown function at positions 38-165. Since the object of the present invention is to obtain a polypeptide which exhibits mannanase activity, the present invention relates to any mannanase comprising the sequence of amino acids 166-496 of SEQ ID NO: 28, i.e., a catalytical domain, optionally operably linked, either to the N-terminal or C-terminal, to one, two or more other domains of a different functionality.


[0087] The sequence of amino acids 26-361 of SEQ ID NO: 30 is a mature mannanase sequence. The sequence of amino acids 1-25 of SEQ ID NO: 30 is the signal peptide. It is believed that the subsequence of amino acids 26-361 of SEQ ID NO: 30 is the catalytic domain of the mannanase. This mannanase enzyme core comprising the sequence of amino acids 26-361 of SEQ ID NO: 30, i.e., a catalytical domain, may or may not be optionally operably linked, either to the N-terminal or C-terminal, to one, two or more other domains of a different functionality.


[0088] The sequence of amino acids 23-903 of SEQ ID NO: 32 is a mature mannanase sequence. The sequence of amino acids 1-22 of SEQ ID NO: 32 is the signal peptide. It is believed that the subsequence of amino acids 593-903 of SEQ ID NO: 32 is the catalytic domain of the mannanase and that the mature enzyme additionally comprises at least three N-terminal domains of unknown function in positions 23-214, 224-424 and 434-592, respectively. Since the object of the present invention is to obtain a polypeptide which exhibits mannanase activity, the present invention relates to any mannanase comprising the sequence of amino acids 593-903 of SEQ ID NO: 32, i.e., a catalytical domain, optionally operably linked, either to the N-terminal or C-terminal, to one, two or more other domains of a different functionality.


[0089] The present invention also provides mannanases that are substantially homologous to the polypeptides of SEQ ID NO: 2, SEQ ID NO: 6, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 24, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30 and SEQ ID NO: 32, respectively, and species homologs (paralogs or orthologs) thereof. The term “substantially homologous” is used herein to denote polypeptides having 65%, preferably at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, and even more preferably at least 90%, sequence identity to the sequence of amino acids 32-330 or 32-490 of SEQ ID NO: 2 or their orthologs or paralogs; or to the sequence of amino acids 32-344 or 32-494 of SEQ ID NO: 6 or their orthologs or paralogs; or to the sequence of amino acids 32-362 or 32-586 of SEQ ID NO: 10 or their orthologs or paralogs; or to the sequence of amino acids 33-331 of SEQ ID NO: 12 or its orthologs or paralogs; or to the sequence of amino acids 22-488 or 166-488 of SEQ ID NO: 14 or their orthologs or paralogs; or to the sequence of amino acids 32-369 or 68-369 of SEQ ID NO: 16 or their orthologs or paralogs; or to the sequence of amino acids 1-305 of SEQ ID NO: 18 or its orthologs or paralogs; or to the sequence of amino acids 1-132 of SEQ ID NO: 20 or its orthologs or paralogs; or to the sequence of amino acids 29-320 of SEQ ID NO: 22 or its orthologs or paralogs; or to the sequence of amino acids 29-188 of SEQ ID NO: 24 or its orthologs or paralogs; or to the sequence of amino acids 30-625 or 301-625 of SEQ ID NO: 26 or their orthologs or paralogs; or to the sequence of amino acids 38-496 or 166-496 of SEQ ID NO: 28 or their orthologs or paralogs; or to the sequence of amino acids 26-361 of SEQ ID NO: 30 or its orthologs or paralogs; or to the sequence of amino acids 23-903 or 593-903 of SEQ ID NO: 32 or their orthologs or paralogs.


[0090] Such polypeptides will more preferably be at least 95% identical, and most preferably 98% or more identical to the sequence of amino acids 32-330 or 32-490 of SEQ ID NO: 2 or its orthologs or paralogs; or to the sequence of amino acids 32-344 or 32-494 of SEQ ID NO: 6 or its orthologs or paralogs; or to the sequence of amino acids 32-362 or 32-586 of SEQ ID NO: 10 or its orthologs or paralogs; or to the sequence of amino acids 33-331 of SEQ ID NO: 12 or its orthologs or paralogs; or to the sequence of amino acids 166-488 or 22-488 of SEQ ID NO: 14 or its orthologs or paralogs; or to the sequence of amino acids 68-369 or 32-369 of SEQ ID NO: 16 or its orthologs or paralogs; or to the sequence of amino acids 1-305 of SEQ ID NO: 18 or its orthologs or paralogs; or to the sequence of amino acids 1-132 of SEQ ID NO: 20 or its orthologs or paralogs; or to the sequence of amino acids 29-320 of SEQ ID NO: 22 or its orthologs or paralogs; or to the sequence of amino acids 29-188 of SEQ ID NO: 24 or its orthologs or paralogs; or to the sequence of amino acids 301-625 or 30-625 of SEQ ID NO: 26 or its orthologs or paralogs; or to the sequence of amino acids 166-496 or 38-496 of SEQ ID NO: 28 or its orthologs or paralogs; or to the sequence of amino acids 26-361 of SEQ ID NO: 30 or its orthologs or paralogs; or to the sequence of amino acids 593-903 or 23-903 of SEQ ID NO: 32 or its orthologs or paralogs.


[0091] Percent sequence identity is determined by conventional methods, by means of computer programs known in the art such as GAP provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wis., USA 53711) as disclosed in Needleman, S. B. and Wunsch, C. D., (1970), Journal of Molecular Biology, 48, 443-453, which is hereby incorporated by reference in its entirety. GAP is used with the following settings for polypeptide sequence comparison: a GAP creation penalty of 3.0 and a GAP extension penalty of 0.1.


[0092] Sequence identity of polynucleotide molecules is determined by similar methods using GAP with the following settings for DNA sequence comparison: a GAP creation penalty of 5.0 and a GAP extension penalty of 0.3.


[0093] The enzyme preparation of the invention is preferably derived from a microorganism, preferably from a bacterium, an archea or a fungus, especially from a bacterium such as a bacterium belonging to Bacillus, preferably to a Bacillus strain which may be selected from the group consisting of the species Bacillus sp. and highly related Bacillus species in which all species preferably are at least 95%, even more preferably at least 98%, homologous to Bacillus sp. I633, Bacillus halodurans or Bacillus sp. AAI12 based on aligned 16rDNA sequences.


[0094] These species are claimed based on phylogenic relationships identifed from aligned 16S rDNA sequences from RDP (Ribosomal Database Project) (Bonne L. Maidak, Neils Larson, Michael J. McCaughey, Ross Overbeek, Gary J. Olsen, Karl Fogel, James Blandy, and Carl R. Woese, Nucleic Acids Reasearch, 1994, 22(17): 3485-3487, The Ribosomal Database Project). The alignment was based on secondary structure. Calculation of sequence simularities were established using the “Full matrix calculation” with default settings of the neighbor joining method integrated in the ARB program package (Oliver Strunk and Wolfgang Ludwig, Technical University of Munich, Germany).


[0095] Information derived from table II are the basis for the claim for all family 5 mannanases from the highly related Bacillus species in which all species over 93% homologous to Bacillus sp. I633 are claimed. These include: Bacillus acalophilus, Bacillus clausii, Bacillus pseudoalcalophilus, and Bacillus sporothermodurans. See FIG. 1: Phylogenic tree generated from ARP program relating closest species to Bacillus sp. I633. The 16S RNA is shown in SEQ ID NO: 33.
1TABLE II16S ribosomal RNA homology index for select Bacillus speciesBaiSpor2BaiAlcalBaiSpec3BaiSpec5B. sp. l633BaiSpor292.75%92.98%92.41%93.43%BaiAlcal98.11%94.69%97.03%BaiSpec394.49%96.39%BaiSpec593.67%BaiSpor2 = B. sporothermodurans, u49079 BaiAlcal = B. alcalophilus, x76436 BaiSpec3 = B. pseudoalcalophilus, x76449 BaiSpec5 = B clausii, x76440


[0096] Other useful family 5 mannanases are those derived from the highly related Bacillus species in which all species show more than 93% homology to Bacillus halodurans based on aligned 16S sequences. These Bacillus species include: Sporolactobacillus laevis, Bacillus agaradhaerens and Marinococcus halophilus. See FIG. 2: Phylogenic tree generated from ARP program relating closest species to Bacillus halodurans. 2TABLE III16S ribosomal RNA homologyindex for selected Bacillus speciesSplLaev3BaiSpec6BaiSpe11MaoHalo2NNSplLaev390.98%87.96%85.94%91.32%BaiSpec691.63%87.96%99.46%BaiSpe1189.04%92.04%MaoHalo288.17%SplLaev3 = Sporolactobacillus laevis, D16287 BaiSpec6 = B. halodurans, X76442 BaiSpe11 = B. agaradhaerens, X76445 MaoHalo2 = Marinococcus halophilus, X62171 NN = donor organism of the invention (B. halodurans)


[0097] Other useful family 5 mannanases are those derived from a strain selected from the group consisting of the species Bacillus agaradhaerens and highly related Bacillus species in which all species preferably are at least 95%, even more preferably at least 98%, homologous to Bacillus agaradhaerens, DSM 8721, based on aligned 16S rDNA sequences.


[0098] Useful family 26 mannanases are for example those derived from the highly related Bacillus species in which all species over 93% homologous to Bacillus sp. AAI12 are claimed. These include: Bacillus sporothermodurans, Bacillus acalophilus, Bacillus pseudoalcalophilus and Bacillus clausii. See FIG. 3: Phylogenic tree generated from ARP program relating closest species to Bacillus sp. AAI 12. The 16S RNA is shown in SEQ ID NO: 34.
3TABLE IV16S ribosomal RNA homology indexfor selected Bacillus speciesBaiSpor2BaiAlcalBaiSpec3BaiSpec5B. sp. AAl12BaiSpor292.75%92.98%92.41%92.24%BaiAlcal98.11%94.69%97.28%BaiSpec394.49%96.10%BaiSpec593.83%BaiSpor2 = B sporothermodurans, u49079 BaiAlcal = B. alcalophilus, x76436 BaiSpec3 = B. pseudoalcalophilus, x76449 BaiSpec5 = B clausii, x76440


[0099] Other useful family 26 mannanases are those derived from a strain selected from the group consisting of the species Bacillus licheniformis and highly related Bacillus species in which all species preferably are at least 95%, even more preferably at least 98%, homologous to Bacillus licheniformis based on aligned 16S rDNA sequences.


[0100] Substantially homologous proteins and polypeptides are characterized as having one or more amino acid substitutions, deletions or additions. These changes are preferably of a minor nature, that is conservative amino acid substitutions (see Table 2) and other substitutions that do not significantly affect the folding or activity of the protein or polypeptide; small deletions, typically of one to about 30 amino acids; and small amino- or carboxyl-terminal extensions, such as an amino-terminal methionine residue, a small linker peptide of up to about 20-25 residues, or a small extension that facilitates purification (an affinity tag), such as a poly-histidine tract, protein A (Nilsson et al., EMBO J., 1985, 4: 1075; Nilsson et al., Methods Enzymol., 1991, 198: 3. See, in general Ford et al., Protein Expression and Purification, 1991, 2: 95-107, which is incorporated herein by reference. DNAs encoding affinity tags are available from commercial suppliers (e.g., Pharmacia Biotech, Piscataway, N.J.; New England Biolabs, Beverly, Mass.).


[0101] However, even though the changes described above preferably are of a minor nature, such changes may also be of a larger nature such as fusion of larger polypeptides of up to 300 amino acids or more both as amino- or carboxyl-terminal extensions to a Mannanase polypeptide of the invention.
4TABLE 1Conservative amino acid substitutionsBasic:argininelysinehistidineAcidic:glutamic acidaspartic acidPolar:glutamineasparagineHydrophobic:leucineisoleucinevalineAromatic:phenylalaninetryptophantyrosineSmall:glycinealanineserinethreoninemethionine


[0102] In addition to the 20 standard amino acids, non-standard amino acids (such as 4-hydroxyproline, 6-N-methyl lysine, 2-aminoisobutyric acid, isovaline and a-methyl serine) may be substituted for amino acid residues of a polypeptide according to the invention. A limited number of non-conservative amino acids, amino acids that are not encoded by the genetic code, and unnatural amino acids may be substituted for amino acid residues. “Unnatural amino acids” have been modified after protein synthesis, and/or have a chemical structure in their side chain(s) different from that of the standard amino acids. Unnatural amino acids can be chemically synthesized, or preferably, are commercially available, and include pipecolic acid, thiazolidine carboxylic acid, dehydroproline, 3- and 4-methylproline, and 3,3-dimethylproline.


[0103] Essential amino acids in the mannanase polypeptides of the present invention can be identified according to procedures known in the art, such as site-directed mutagenesis or alanine-scanning mutagenesis (Cunningham and Wells, 1989, Science, 244: 1081-1085). In the latter technique, single alanine mutations are introduced at every residue in the molecule, and the resultant mutant molecules are tested for biological activity (i.e., mannanase activity) to identify amino acid residues that are critical to the activity of the molecule. See also, Hilton et al., 19966, J. Biol. Chem., 271: 4699-4708. The active site of the enzyme or other biological interaction can also be determined by physical analysis of structure, as determined by such techniques as nuclear magnetic resonance, crystallography, electron diffraction or photoaffinity labeling, in conjunction with mutation of putative contact site amino acids. See, for example, de Vos et al., 1992, Science, 255: 306-312; Smith et al., 1992, J. Mol. Biol., 224: 899-904; Wlodaver et al., 1992, FEBS Lett., 309: 59-64. The identities of essential amino acids can also be inferred from analysis of homologies with polypeptides which are related to a polypeptide according to the invention.


[0104] Multiple amino acid substitutions can be made and tested using known methods of mutagenesis, recombination and/or shuffling followed by a relevant screening procedure, such as those disclosed by Reidhaar-Olson and Sauer (Science, 1988, 241: 53-57), Bowie and Sauer (Proc. Natl. Acad. Sci. USA, 1989, 86(2): 152-2156), WO 95/17413, or WO 95/22625. Briefly, these authors disclose methods for simultaneously randomizing two or more positions in a polypeptide, or recombination/shuffling of different mutations (WO 95/17413, WO 95/22625), followed by selecting for functional a polypeptide, and then sequencing the mutagenized polypeptides to determine the spectrum of allowable substitutions at each position. Other methods that can be used include phage display (e.g., Lowman et al., 1991, Biochem., 30: 10832-10837; U.S. Pat. No. 5,223,409; WO 92/06204) and region-directed mutagenesis (Derbyshire et al., 1986, Gene, 46: 145; Ner et al., 1988, DNA, 7: 127).


[0105] Mutagenesis/shuffling methods as disclosed above can be combined with high-throughput, automated screening methods to detect activity of cloned, mutagenized polypeptides in host cells. Mutagenized DNA molecules that encode active polypeptides can be recovered from the host cells and rapidly sequenced using modern equipment. These methods allow the rapid determination of the importance of individual amino acid residues in a polypeptide of interest, and can be applied to polypeptides of unknown structure.


[0106] Using the methods discussed above, one of ordinary skill in the art can identify and/or prepare a variety of polypeptides that are substantially homologous to amino acids 32-330 or 32-490 of SEQ ID NO: 2; or to amino acids 32-344 or 32-494 of SEQ ID NO: 6; or to amino acids 32-362 or 32-586 of SEQ ID NO: 10; or to amino acids 33-331 of SEQ ID NO: 12; or to amino acids 166-488 or 22-488 of SEQ ID NO: 14; or to amino acids 68-369 or 32-369 of SEQ ID NO: 16; or to amino acids 1-305 of SEQ ID NO: 18; or to amino acids 1-132 of SEQ ID NO: 20; or to amino acids 29-320 of SEQ ID NO: 22; or to amino acids 29-188 of SEQ ID NO: 24; or to amino acids 301-625 or 30-625 of SEQ ID NO: 26; or to amino acids 166-496 or 38-496 of SEQ ID NO: 28; or to amino acids 26-361 of SEQ ID NO: 30; or to amino acids 593-903 or 23-903 of SEQ ID NO: 32 and retain the mannanase activity of the wild-type protein.


[0107] The mannanase of the invention may, in addition to the enzyme core comprising the catalytically domain, also comprise a cellulose binding domain (CBD), the cellulose binding domain and enzyme core (the catalytically active domain) of the enzyme being operably linked. The cellulose binding domain (CBD) may exist as an integral part of the encoded enzyme, or a CBD from another origin may be introduced into the mannan degrading enzyme thus creating an enzyme hybrid. In this context, the term “cellulose-binding domain” is intended to be understood as defined by Peter Tomme et al. “Cellulose-Binding Domains: Classification and Properties” in “Enzymatic Degradation of Insoluble Carbohydrates”, John N. Saddler and Michael H. Penner (Eds.), ACS Symposium Series, No. 618, 1996. This definition classifies more than 120 cellulose-binding domains into 10 families (I-X), and demonstrates that CBDs are found in various enzymes such as cellulases, xylanases, mannanases, arabinofuranosidases, acetyl esterases and chitinases. CBDs have also been found in algae, e.g. the red alga Porphyra purpurea as a non-hydrolytic polysaccharide-binding protein, see Tomme et al., op.cit. However, most of the CBDs are from cellulases and xylanases, CBDs are found at the N and C termini of proteins or are internal. Enzyme hybrids are known in the art, see e.g. WO 90/00609 and WO 95/16782, and may be prepared by transforming into a host cell a DNA construct comprising at least a fragment of DNA encoding the cellulose-binding domain ligated, with or without a linker, to a DNA sequence encoding the mannan degrading enzyme and growing the host cell to express the fused gene. Enzyme hybrids may be described by the following formula:


CBD-MR-X


[0108] wherein CBD is the N-terminal or the C-terminal region of an amino acid sequence corresponding to at least the cellulose-binding domain; MR is the middle region (the linker), and may be a bond, or a short linking group preferably of from about 2 to about 100 carbon atoms, more preferably of from 2 to 40 carbon atoms; or is preferably from about 2 to to about 100 amino acids, more preferably of from 2 to 40 amino acids; and X is an N-terminal or C-terminal region of the mannanase of the invention. SEQ ID NO: 4 is the amino acid sequence of an enzyme hybrid of a mannanase enzyme core and a CBD.


[0109] Preferably, the mannanase of the present invention has its maximum catalytic activity at a pH of at least 7, more preferably of at least 8, more preferably of at least 8.5, more preferably of at least 9, more preferably of at least 9.5, more preferably of at least 10, even more preferably of at least 10.5, especially of at least 11; and preferably the maximum activity of the enzyme is obtained at a temperature of at least 40° C., more preferably of at least 50° C., even more preferably of at least 55° C.


[0110] Preferably, the cleaning composition of the present invention provides, e.g., when used for treating fabric during a washing cycle of a machine washing process, a washing solution having a pH typically between about 8 and about 10.5. Typically, such a washing solution is used at temperatures between about 20° C. and about 95° C., preferably between about 20° C. and about 60° C., preferably between about 20° C. and about 50° C.


[0111] Protein Production:


[0112] The proteins and polypeptides of the present invention, including full-length proteins, fragments thereof and fusion proteins, can be produced in genetically engineered host cells according to conventional techniques. Suitable host cells are those cell types that can be transformed or transfected with exogenous DNA and grown in culture, and include bacteria, fungal cells, and cultured higher eukaryotic cells. Bacterial cells, particularly cultured cells of gram-positive organisms, are preferred. Gram-positive cells from the genus of Bacillus are especially preferred, such as from the group consisting of Bacillus agaradhaerens, Bacillus alkalophilus, Bacillus amyloliquefaciens, Bacillus brevis, Bacillus circulans, Bacillus clausii, Bacillus coagulans, Bacillus lautus, Bacillus lentus, Bacillus licheniformis, Bacillus stearothermophilus, Bacillus subtilis, Bacillus thuringiensis, and Bacillus sp., in particular Bacillus sp. I633, Bacillus sp. AAI112, Bacillus agaradhaerens Bacillus clausii, and Bacillus licheniformis.


[0113] In another preferred embodiment, the host cell is a fungal cell. “Fungi” as used herein includes the phyla Ascomycota, Basidiomycota, Chytridiomycota, and Zygomycota (as defined by Hawksworth et al., In, Ainsworth and Bisby's Dictionary of The Fungi, 8th edition, 1995, CAB International, University Press, Cambridge, UK) as well as the Oomycota (as cited in Hawksworth et al., 1995, supra, page 171) and all mitosporic fungi (Hawksworth et al., 1995, supra). Representative groups of Ascomycota include, e.g., Neurospora, Eupenicillium (=Penicillium), Emericella (=Aspergillus), Eurotium (=Aspergillus), and the true yeasts listed above. Examples of Basidiomycota include mushrooms, rusts, and smuts. Representative groups of Chytridiomycota include, e.g., Allomyces, Blastocladiella, Coelomomyces, and aquatic fungi. Representative groups of Oomycota include, e.g., Saprolegniomycetous aquatic fungi (water molds) such as Achlya. Examples of mitosporic fungi include Aspergillus, Penicillium, Candida, and Alternaria. Representative groups of Zygomycota include, e.g., Mucor and Rhizopus.


[0114] In yet another preferred embodiment, the fungal host cell is a filamentous fungal cell. “Filamentous fungi” include all filamentous forms of the subdivision Eumycota and Oomycota (as defined by Hawksworth et al., 1995, supra). In a more preferred embodiment, the filamentous fungal host cell is a cell of a species of, but not limited to, Acremonium, Aspergillus, Fusarium, Humicola, Mucor, Myceliophthora, Neurospora, Penicillium, Thielavia, Tolypocladium, and Trichoderma or a teleomorph or synonym thereof.


[0115] In particular, the cell may belong to a species of Trichoderma, preferably Trichoderma harzianum or Trichoderma reesei, or a species of Aspergillus, most preferably Aspergillus oryzae or Aspergillus niger, or a species of Fusarium, most preferably a Fusarium sp. having the identifying characteristic of Fusarium ATCC 20334, as further described in PCT/US95/07743.


[0116] Fungal cells may be transformed by a process involving protoplast formation, transformation of the protoplasts, and regeneration of the cell wall in a manner known per se. Suitable procedures for transformation of Aspergillus host cells are described in EP 238 023 and Yelton et al., 1984, Proceedings of the National Academy of Sciences USA, 81: 1470-1474. A suitable method of transforming Fusarium species is described by Malardier et al., 1989, Gene, 78: 147-156 or in copending U.S. application Ser. No. 08/269,449. Yeast may be transformed using the procedures described by Becker and Guarente, In Abelson, J. N. and Simon, M. I., editors, Guide to Yeast Genetics and Molecular Biology, Methods in Enzymology, 194: 182-187, Academic Press, Inc., New York; Ito et al., 1983, Journal of Bacteriology, 153: 163; and Hinnen et al., 1978, Proceedings of the National Academy of Sciences USA, 75: 1920. Mammalian cells may be transformed by direct uptake using the calcium phosphate precipitation method of Graham and Van der Eb, 1978, Virology, 52: 546).


[0117] Techniques for manipulating cloned DNA molecules and introducing exogenous DNA into a variety of host cells are disclosed by Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989; Ausubel et al. (eds.), Current Protocols in Molecular Biology, John Wiley and Sons, Inc., NY, 1987; and “Bacillus subtilis and Other Gram-Positive Bacteria”, Sonensheim et al., 1993, American Society for Microbiology, Washington D.C., which are incorporated herein by reference.


[0118] In general, a DNA sequence encoding a mannanase of the present invention is operably linked to other genetic elements required for its expression, generally including a transcription promoter and terminator within an expression vector. The vector will also commonly contain one or more selectable markers and one or more origins of replication, although those skilled in the art will recognize that within certain systems selectable markers may be provided on separate vectors, and replication of the exogenous DNA may be provided by integration into the host cell genome. Selection of promoters, terminators, selectable markers, vectors and other elements is a matter of routine design within the level of ordinary skill in the art. Many such elements are described in the literature and are available through commercial suppliers.


[0119] To direct a polypeptide into the secretory pathway of a host cell, a secretory signal sequence (also known as a leader sequence, prepro sequence or pre sequence) is provided in the expression vector. The secretory signal sequence may be that of the polypeptide, or may be derived from another secreted protein or synthesized de novo. Numerous suitable secretory signal sequences are known in the art and reference is made to “Bacillus subtilis and Other Gram-Positive Bacteria”, Sonensheim et al., 1993, American Society for Microbiology, Washington D.C.; and Cutting, S. M. (eds.) “Molecular Biological Methods for Bacillus”, John Wiley and Sons, 1990, for further description of suitable secretory signal sequences especially for secretion in a Bacillus host cell. The secretory signal sequence is joined to the DNA sequence in the correct reading frame. Secretory signal sequences are commonly positioned 5′ to the DNA sequence encoding the polypeptide of interest, although certain signal sequences may be positioned elsewhere in the DNA sequence of interest (see, e.g., U.S. Pat. Nos. 5,037,743 and 5,143,830.


[0120] The expression vector of the invention may be any expression vector that is conveniently subjected to recombinant DNA procedures, and the choice of vector will often depend on the host cell into which the vector it is to be introduced. Thus, the vector may be an autonomously replicating vector, i.e., a vector which exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g., a plasmid. Alternatively, the vector may be one which, when introduced into a host cell, is integrated into the host cell genome and replicated together with the chromosome(s) into which it has been integrated.


[0121] Examples of suitable promoters for use in filamentous fungus host cells are, e.g. the ADH3 promoter (McKnight et al., 1985, The EMBO J., 4: 2093-2099) or the tpiA promoter. Examples of other useful promoters are those derived from the gene encoding Aspergillus oryzae TAKA amylase, Rhizomucor miehei aspartic proteinase, Aspergillus niger neutral alpha-amylase, Aspergillus niger acid stable alpha-amylase, Aspergillus niger or Aspergillus awamori glucoamylase (gluA), Rhizomucor miehei lipase, Aspergillus oryzae alkaline protease, Aspergillus oryzae triose phosphate isomerase or Aspergillus nidulans acetamidase.


[0122] Transformed or transfected host cells are cultured according to conventional procedures in a culture medium containing nutrients and other components required for the growth of the chosen host cells. A variety of suitable media, including defined media and complex media, are known in the art and generally include a carbon source, a nitrogen source, essential amino acids, vitamins and minerals. Media may also contain such components as growth factors or serum, as required. The growth medium will generally select for cells containing the exogenously added DNA by, for example, drug selection or deficiency in an essential nutrient which is complemented by the selectable marker carried on the expression vector or co-transfected into the host cell.


[0123] Protein Isolation


[0124] When the expressed recombinant polypeptide is secreted the polypeptide may be purified from the growth media. Preferably the expression host cells are removed from the media before purification of the polypeptide (e.g., by centrifugation).


[0125] When the expressed recombinant polypeptide is not secreted from the host cell, the host cell are preferably disrupted and the polypeptide released into an aqueous “extract” which is the first stage of such purification techniques. Preferably the expression host cells are collected from the media before the cell disruption (e.g., by centrifugation).


[0126] The cell disruption may be performed by conventional techniques such as by lysozyme digestion or by forcing the cells through high pressure. See Robert K. Scobes, Protein Purification, Second edition, Springer-Verlag for further description of such cell disruption techniques.


[0127] Whether or not the expressed recombinant polypeptides (or chimeric polypeptides) are secreted or not, they can be purified using fractionation and/or conventional purification methods and media.


[0128] Ammonium sulfate precipitation and acid or chaotrope extraction may be used for fractionation of samples. Exemplary purification steps may include hydroxyapatite, size exclusion, FPLC and reverse-phase high performance liquid chromatography. Suitable anion exchange media include derivatized dextrans, agarose, cellulose, polyacrylamide, specialty silicas, and the like. PEI, DEAE, QAE and Q derivatives are preferred, with DEAE Fast-Flow Sepharose (Pharmacia, Piscataway, N.J.) being particularly preferred. Exemplary chromatographic media include those media derivatized with phenyl, butyl, or octyl groups, such as Phenyl-Sepharose FF (Pharmacia), Toyopearl butyl 650 (Toso Haas, Montgomeryville, Pa.), Octyl-Sepharose (Pharmacia) and the like; or polyacrylic resins, such as Amberchrom CG 71 (Toso Haas) and the like. Suitable solid supports include glass beads, silica-based resins, cellulosic resins, agarose beads, cross-linked agarose beads, polystyrene beads, cross-linked polyacrylamide resins and the like that are insoluble under the conditions in which they are to be used. These supports may be modified with reactive groups that allow attachment of proteins by amino groups, carboxyl groups, sulfhydryl groups, hydroxyl groups and/or carbohydrate moieties. Examples of coupling chemistries include cyanogen bromide activation, N-hydroxysuccinimide activation, epoxide activation, sulfhydryl activation, hydrazide activation, and carboxyl and amino derivatives for carbodiimide coupling chemistries. These and other solid media are well known and widely used in the art, and are available from commercial suppliers.


[0129] Selection of a particular method is a matter of routine design and is determined in part by the properties of the chosen support. See, for example, Affinity Chromatography: Principles & Methods, Pharmacia LKB Biotechnology, Uppsala, Sweden, 1988.


[0130] Polypeptides of the invention or fragments thereof may also be prepared through chemical synthesis. Polypeptides of the invention may be monomers or multimers; glycosylated or non-glycosylated; pegylated or non-pegylated; and may or may not include an initial methionine amino acid residue.


[0131] Based on the sequence information disclosed herein a full length DNA sequence encoding a mannanase of the invention and comprising the DNA sequence shown in SEQ ID NO: 1, at least the DNA sequence of nucleotides 94-990, or, alternatively, the DNA sequence of nucleotides 94-1470, may be cloned. Likewise may be cloned a full length DNA sequence encoding a mannanase of the invention and comprising the DNA sequence of SEQ ID NO: 5, at least the DNA sequence of nucleotides 94-1032, or, alternatively, the DNA sequence of nucleotides 94-1482; and a full length DNA sequence encoding a mannanase of the invention and comprising the DNA sequence of SEQ ID NO: 9, at least the DNA sequence of nucleotides 94-1086, or, alternatively, the DNA sequence of nucleotides 94-1761; and a full length DNA sequence encoding a mannanase of the invention and comprising the DNA sequence of SEQ ID NO: 11, at least the DNA sequence of nucleotides 97-993; and a full length DNA sequence encoding a mannanase of the invention and comprising the DNA sequence of SEQ ID NO: 13, at least the DNA sequence of nucleotides 498-1464, or, alternatively, the DNA sequence of nucleotides 64-1464; and a full length DNA sequence encoding a mannanase of the invention and comprising the DNA sequence of SEQ ID NO: 15, at least the DNA sequence of nucleotides 204-1107, or, alternatively, the DNA sequence of nucleotides 76-1107; and a DNA sequence partially encoding a mannanase of the invention and comprising the DNA sequence of SEQ ID NO: 17; and a DNA sequence partially encoding a mannanase of the invention and comprising the DNA sequence of SEQ ID NO: 19; and a full length DNA sequence encoding a mannanase of the invention and comprising the DNA sequence of SEQ ID NO: 21, at least the DNA sequence of nucleotides 88-960; and a DNA sequence partially encoding a mannanase of the invention and comprising the DNA sequence of SEQ ID NO: 23; and a full length DNA sequence encoding a mannanase of the invention and comprising the DNA sequence of SEQ ID NO: 25, at least the DNA sequence of nucleotides 904-1875, or, alternatively, the DNA sequence of nucleotides 88-2445; and a full length DNA sequence encoding a mannanase of the invention and comprising the DNA sequence of SEQ ID NO: 27, at least the DNA sequence of nucleotides 498-1488, or, alternatively, the DNA sequence of nucleotides 112-1488; and a full length DNA sequence encoding a mannanase of the invention and comprising the DNA sequence of SEQ ID NO: 29, at least the DNA sequence from position 79 to position 1083; and a full length DNA sequence encoding a mannanase of the invention and comprising the DNA sequence of SEQ ID NO: 31, at least the DNA sequence of nucleotides 1779-2709, or, alternatively, the DNA sequence of nucleotides 67-2709.


[0132] Cloning is performed by standard procedures known in the art such as by,


[0133] (a) preparing a genomic library from a Bacillus strain, especially a strain selected from B. sp. I633, B. sp. AAI12, B. sp. AA349. Bacillus agaradhaerens, Bacillus halodurans, Bacillus clausii and Bacillus licheniformis, or from a fungal strain, especially the strain Humicola insolens;


[0134] (b) plating such a library on suitable substrate plates;


[0135] (c) identifying a clone comprising a polynucleotide sequence of the invention by standard hybridization techniques using a probe based on any of the sequences SEQ ID NOS: 1, 5, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29 or 31; or


[0136] (d) identifying a clone from said genomic library by an Inverse PCR strategy using primers based on sequence information from SEQ ID NO: 1, 5, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29 or 31. Reference is made to M. J. MCPherson et al. (“PCR A practical approach” Information Press Ltd, Oxford England) for further details relating to Inverse PCR.


[0137] Based on the sequence information disclosed herein (SEQ ID NOS: 1, 2, 5, 6, 9,10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, and 32), it is routine for a person skilled in the art to isolate homologous polynucleotide sequences encoding homologous mannanase of the invention by a similar strategy using genomic libraries from related microbial organisms, in particular from genomic libraries from other strains of the genus Bacillus such as alkalophilic species of Bacillus sp., or from fungal strains such as species of Humicola.


[0138] Alternatively, the DNA encoding the mannan or galactomannan-degrading enzyme of the invention may, in accordance with well-known procedures, conveniently be cloned from a suitable source, such as any of the above mentioned organisms, by use of synthetic oligonucleotide probes prepared on the basis of the DNA sequence obtainable from the plasmid present any of the strains Escherichia coli DSM 12197, DSM 12180, DSM 12433, DSM 12441, DSM 9984, DSM 12432, DSM 12436, DSM 12846, DSM 12847, DSM 12848, DSM 12849, DSM 12850, DSM 12851 and DSM 12852.


[0139] Accordingly, the polynucleotide molecule of the invention may be isolated from any of Escherichia coli, DSM 12197, DSM 12180, DSM 12433, DSM 12441, DSM 9984, DSM 12432, DSM 12436, DSM 12846, DSM 12847, DSM 12848, DSM 12849, DSM 12850, DSM 12851 and DSM 12852, in which the plasmid obtained by cloning such as described above is deposited. Also, the present invention relates to an isolated substantially pure biological culture of any of the strains Escherichia coli, DSM 12197, DSM 12180, DSM 12433, DSM 12441, DSM 9984, DSM 12432, DSM 12436, DSM 12846, DSM 12847, DSM 12848, DSM 12849, DSM 12850, DSM 12851 and DSM 12852.


[0140] In the present context, the term “enzyme preparation” is intended to mean either a conventional enzymatic fermentation product, possibly isolated and purified, from a single species of a microorganism, such preparation usually comprising a number of different enzymatic activities; or a mixture of monocomponent enzymes, preferably enzymes derived from bacterial or fungal species by using conventional recombinant techniques, which enzymes have been fermented and possibly isolated and purified separately and which may originate from different species, preferably fungal or bacterial species; or the fermentation product of a microorganism which acts as a host cell for expression of a recombinant mannanase, but which microorganism simultaneously produces other enzymes, e.g., pectin degrading enzymes, proteases, or cellulases, being naturally occurring fermentation products of the microorganism, i.e., the enzyme complex conventionally produced by the corresponding naturally occurring microorganism.


[0141] The mannanase preparation of the invention may further comprise one or more enzymes selected from the group consisting of proteases, cellulases (beta-1,4-endoglucanases), beta-glucanases (beta-1,3(4)-endoglucanases), lipases, cutinases, peroxidases, laccases, amylases, glucoamylases, pectinases, reductases, oxidases, phenoloxidases, ligninases, pullulanases, hemicellulases, pectate lyases, xyloglucanases, xylanases, pectin acetyl esterases, rhamnogalacturonan acetyl esterases, polygalacturonases, rhamnogalacturonases, pectin lyases, pectin methylesterases, cellobiohydrolases, transglutaminases; or mixtures thereof. In a preferred embodiment, one or more or all enzymes in the preparation is produced by using recombinant techniques, i.e. the enzyme(s) is/are mono-component enzyme(s) which is/are mixed with the other enzyme(s) to form an enzyme preparation with the desired enzyme blend.


[0142] In another aspect, the present invention also relates to a method of producing the enzyme preparation of the invention, the method comprising culturing a microorganism, e.g., a wild-type strain, capable of producing the mannanase under conditions permitting the production of the enzyme, and recovering the enzyme from the culture. Culturing may be carried out using conventional fermentation techniques, e.g. culturing in shake flasks or fermentors with agitation to ensure sufficient aeration on a growth medium inducing production of the mannanase. The growth medium may contain a conventional N-source such as peptone, yeast extract or casamino acids, a reduced amount of a conventional C-source such as dextrose or sucrose, and an inducer such as guar gum or locust bean gum. The recovery may be carried out using conventional techniques, e.g. separation of bio-mass and supernatant by centrifugation or filtration, recovery of the supernatant or disruption of cells if the enzyme of interest is intracellular, perhaps followed by further purification as described in EP 0 406 314 or by crystallization as described in WO 97/15660.


[0143] Examples of useful bacteria producing the enzyme or the enzyme preparation of the invention are gram-positive bacteria, preferably from the Bacillus/Lactobacillus subdivision, preferably a strain from the genus Bacillus, more preferably a strain of Bacillus sp.


[0144] In yet another aspect, the present invention relates to an isolated mannanase having the properties described above and which is free from homologous impurities, and is produced using conventional recombinant techniques.


[0145] Immunological Cross-Reactivity:


[0146] Polyclonal antibodies to be used in determining immunological cross-reactivity may be prepared by use of a purified mannanase. More specifically, antiserum against the mannanase of the invention may be raised by immunizing rabbits (or other rodents) according to the procedure described by N. Axelsen et al. in: A Manual of Quantitative Immunoelectrophoresis, Blackwell Scientific Publications, 1973, Chapter 23, or A. Johnstone and R. Thorpe, Immunochemistry in Practice, Blackwell Scientific Publications, 1982 (more specifically p. 27-31). Purified immunoglobulins may be obtained from the antisera, for example by salt precipitation ((NH4)2SO4), followed by dialysis and ion exchange chromatography, e.g., on DEAE-Sephadex. Immunochemical characterization of proteins may be done either by Outcherlony double-diffusion analysis (O. Ouchterlony in: Handbook of Experimental Immunology (D. M. Weir, Ed.), Blackwell Scientific Publications, 1967, pp. 655-706), by crossed immunoelectrophoresis (N. Axelsen et al., supra, Chapters 3 and 4), or by rocket immunoelectrophoresis (N. Axelsen et al., Chapter 2).


[0147] Use in the Detergent Industry


[0148] In further aspects, the present invention relates to a detergent composition comprising the mannanase or mannanase preparation of the invention, to a process for machine treatment of fabrics comprising treating fabric during a washing cycle of a machine washing process with a washing solution containing the mannanase or mannanase preparation of the invention, and to cleaning compositions, including laundry, dishwashing, hard surface cleaner, personal cleansing and oral/dental compositions, comprising a mannanase and optionally another enzyme selected among cellulases, amylases, pectin degrading enzymes and xyloglucanases and providing superior cleaning performance, i.e., superior stain removal, dingy cleaning and whiteness maintenance.


[0149] Without being bound to this theory, it is believed that the mannanase of the present invention is capable of effectively degrading or hydrolysing any soiling or spots containing galactomannans and, accordingly, of cleaning laundry comprising such soilings or spots.


[0150] The cleaning compositions of the invention must contain at least one additional detergent component. The precise nature of these additional components, and levels of incorporation thereof will depend on the physical form of the composition, and the nature of the cleaning operation for which it is to be used.


[0151] The cleaning compositions of the present invention preferably further comprise a detergent ingredient selected from a selected surfactant, another enzyme, a builder and/or a bleach system.


[0152] The cleaning compositions according to the invention can be liquid, paste, gels, bars, tablets, spray, foam, powder or granular. Granular compositions can also be in “compact” form and the liquid compositions can also be in a “concentrated” form.


[0153] The compositions of the invention may for example, be formulated as hand and machine dishwashing compositions, hand and machine laundry detergent compositions including laundry additive compositions and compositions suitable for use in the soaking and/or pretreatment of stained fabrics, rinse added fabric softener compositions, and compositions for use in general household hard surface cleaning operations. Compositions containing such carbohydrases can also be formulated as sanitization products, contact lens cleansers and health and beauty care products such as oral/dental care and personal cleaning compositions.


[0154] When formulated as compositions for use in manual dishwashing methods the compositions of the invention preferably contain a surfactant and preferably other detergent compounds selected from organic polymeric compounds, suds enhancing agents, group II metal ions, solvents, hydrotropes and additional enzymes.


[0155] When formulated as compositions suitable for use in a laundry machine washing method, the compositions of the invention preferably contain both a surfactant and a builder compound and additionally one or more detergent components preferably selected from organic polymeric compounds, bleaching agents, additional enzymes, suds suppressors, dispersants, lime-soap dispersants, soil suspension and anti-redeposition agents and corrosion inhibitors. Laundry compositions can also contain softening agents, as additional detergent components. Such compositions containing carbohydrase can provide fabric cleaning, stain removal, whiteness maintenance, softening, colour appearance, dye transfer inhibition and sanitization when formulated as laundry detergent compositions.


[0156] The compositions of the invention can also be used as detergent additive products in solid or liquid form. Such additive products are intended to supplement or boost the performance of conventional detergent compositions and can be added at any stage of the cleaning process.


[0157] If needed the density of the laundry detergent compositions herein ranges from 400 to 1200 g/liter, preferably 500 to 950 g/liter of composition measured at 20° C.


[0158] The “compact” form of the compositions herein is best reflected by density and, in terms of composition, by the amount of inorganic filler salt; inorganic filler salts are conventional ingredients of detergent compositions in powder form; in conventional detergent compositions, the filler salts are present in substantial amounts, typically 17-35% by weight of the total composition. In the compact compositions, the filler salt is present in amounts not exceeding 15% of the total composition, preferably not exceeding 10%, most preferably not exceeding 5% by weight of the composition. The inorganic filler salts, such as meant in the present compositions are selected from the alkali and alkaline-earth-metal salts of sulphates and chlorides. A preferred filler salt is sodium sulphate.


[0159] Liquid detergent compositions according to the present invention can also be in a “concentrated form”, in such case, the liquid detergent compositions according the present invention will contain a lower amount of water, compared to conventional liquid detergents. Typically the water content of the concentrated liquid detergent is preferably less than 40%, more preferably less than 30%, most preferably less than 20% by weight of the detergent composition.


[0160] Cleaning Compositions


[0161] Surfactant System


[0162] The cleaning or detergent compositions according to the present invention comprise a surfactant system, wherein the surfactant can be selected from nonionic and/or anionic and/or cationic and/or ampholytic and/or zwitterionic and/or semi-polar surfactants.


[0163] The surfactant is typically present at a level from 0.1% to 60% by weight. The surfactant is preferably formulated to be compatible with enzyme hybrid and enzyme components present in the composition. In liquid or gel compositions the surfactant is most preferably formulated in such a way that it promotes, or at least does not degrade, the stability of any enzyme hybrid or enzyme in these compositions.


[0164] Suitable systems for use according to the present invention comprise as a surfactant one or more of the nonionic and/or anionic surfactants described herein.


[0165] Polyethylene, polypropylene, and polybutylene oxide conden-sates of alkyl phenols are suitable for use as the nonionic surfactant of the surfactant systems of the present invention, with the polyethylene oxide condensates being preferred. These compounds include the condensation products of alkyl phenols having an alkyl group containing from about 6 to about 14 carbon atoms, preferably from about 8 to about 14 carbon atoms, in either a straight chain or branched-chain configuration with the alkylene oxide. In a preferred embodiment, the ethylene oxide is present in an amount equal to from about 2 to about 25 moles, more preferably from about 3 to about 15 moles, of ethylene oxide per mole of alkyl phenol. Commercially available nonionic surfactants of this type include Igepal™ CO-630, marketed by the GAF Corporation; and Triton™ X-45, X-114, X-100 and X-102, all marketed by the Rohm & Haas Company. These surfactants are commonly referred to as alkylphenol alkoxylates (e.g., alkyl phenol ethoxylates).


[0166] The condensation products of primary and secondary aliphatic alcohols with about 1 to about 25 moles of ethylene oxide are suitable for use as the nonionic surfactant of the nonionic surfactant systems of the present invention. The alkyl chain of the aliphatic alcohol can either be straight or branched, primary or secondary, and generally contains from about 8 to about 22 carbon atoms. Preferred are the condensation products of alcohols having an alkyl group containing from about 8 to about 20 carbon atoms, more preferably from about 10 to about 18 carbon atoms, with from about 2 to about 10 moles of ethylene oxide per mole of alcohol. About 2 to about 7 moles of ethylene oxide and most preferably from 2 to 5 moles of ethylene oxide per mole of alcohol are present in said condensation products. Examples of commercially available nonionic surfactants of this type include Tergitol™ 15-S-9 (The condensation product of C11-C15 linear alcohol with 9 moles ethylene oxide), Tergitol™ 24-L-6 NMW (the condensation product of C12-C14 primary alcohol with 6 moles ethylene oxide with a narrow molecular weight distribution), both marketed by Union Carbide Corporation; Neodol™ 45-9 (the condensation product of C14-C15 linear alcohol with 9 moles of ethylene oxide), Neodol™ 23-3 (the condensation product of C12-C13 linear alcohol with 3.0 moles of ethylene oxide), Neodol™ 45-7 (the condensation product of C14-C15 linear alcohol with 7 moles of ethylene oxide), Neodol™ 45-5 (the condensation product of C14-C15 linear alcohol with 5 moles of ethylene oxide) marketed by Shell Chemical Company, Kyro™ EOB (the condensation product of C13-C15 alcohol with 9 moles ethylene oxide), marketed by The Procter & Gamble Company, and Genapol LA 050 (the condensation product of C12-C14 alcohol with 5 moles of ethylene oxide) marketed by Hoechst. Preferred range of HLB in these products is from 8-11 and most preferred from 8-10.


[0167] Also useful as the nonionic surfactant of the surfactant systems of the present invention are alkylpolysaccharides disclosed in U.S. Pat. No. 4,565,647, having a hydrophobic group containing from about 6 to about 30 carbon atoms, preferably from about 10 to about 16 carbon atoms and a polysaccharide, e.g., a polyglycoside, hydrophilic group containing from about 1.3 to about 10, preferably from about 1.3 to about 3, most preferably from about 1.3 to about 2.7 saccharide units. Any reducing saccharide containing 5 or 6 carbon atoms can be used, e.g., glucose, galactose and galactosyl moieties can be substituted for the glucosyl moieties (optionally the hydrophobic group is attached at the 2-, 3-, 4-, etc. positions thus giving a glucose or galactose as opposed to a glucoside or galactoside). The intersaccharide bonds can be, e.g., between the one position of the additional saccharide units and the 2-, 3-, 4-, and/or 6-positions on the preceding saccharide units.


[0168] The preferred alkylpolyglycosides have the formula


R2O(CnH2nO)t(glycosyl)x


[0169] wherein R2 is selected from the group consisting of alkyl, alkylphenyl, hydroxyalkyl, hydroxyalkylphenyl, and mixtures thereof in which the alkyl groups contain from about 10 to about 18, preferably from about 12 to about 14, carbon atoms; n is 2 or 3, preferably 2; t is from 0 to about 10, preferably 0; and x is from about 1.3 to about 10, preferably from about 1.3 to about 3, most preferably from about 1.3 to about 2.7. The glycosyl is preferably derived from glucose. To prepare these compounds, the alcohol or alkylpolyethoxy alcohol is formed first and then reacted with glucose, or a source of glucose, to form the glucoside (attachment at the 1-position). The additional glycosyl units can then be attached between their 1-position and the preceding glycosyl units 2-, 3-, 4-, and/or 6-position, preferably predominantly the 2- position.


[0170] The condensation products of ethylene oxide with a hydrophobic base formed by the condensation of propylene oxide with propylene glycol are also suitable for use as the additional nonionic surfactant systems of the present invention. The hydrophobic portion of these compounds will preferably have a molecular weight from about 1500 to about 1800 and will exhibit water insolubility. The addition of polyoxyethylene moieties to this hydrophobic portion tends to increase the water solubility of the molecule as a whole, and the liquid character of the product is retained up to the point where the polyoxyethylene content is about 50% of the total weight of the condensation product, which corresponds to condensation with up to about 40 moles of ethylene oxide. Examples of compounds of this type include certain of the commercially available Pluronic™ surfactants, marketed by BASF.


[0171] Also suitable for use as the nonionic surfactant of the nonionic surfactant system of the present invention, are the condensation products of ethylene oxide with the product resulting from the reaction of propylene oxide and ethylenediamine. The hydrophobic moiety of these products consists of the reaction product of ethylenediamine and excess propylene oxide, and generally has a molecular weight of from about 2500 to about 3000. This hydrophobic moiety is condensed with ethylene oxide to the extent that the condensation product contains from about 40% to about 80% by weight of polyoxyethylene and has a molecular weight of from about 5,000 to about 11,000. Examples of this type of nonionic surfactant include certain of the commercially available Tetronic™ compounds, marketed by BASF.


[0172] Preferred for use as the nonionic surfactant of the surfactant systems of the present invention are polyethylene oxide condensates of alkyl phenols, condensation products of primary and secondary aliphatic alcohols with from about 1 to about 25 moles of ethyleneoxide, alkylpolysaccharides, and mixtures hereof. Most preferred are C8-C14 alkyl phenol ethoxylates having from 3 to 15 ethoxy groups and C8-C18 alcohol ethoxylates (preferably C10 avg.) having from 2 to 10 ethoxy groups, and mixtures thereof.


[0173] Highly preferred nonionic surfactants are polyhydroxy fatty acid amide surfactants of the formula
1


[0174] wherein R1 is H, or R1 is C1-4 hydrocarbyl, 2-hydroxyethyl, 2-hydroxypropyl or a mixture thereof, R2 is C5-31 hydrocarbyl, and Z is a polyhydroxyhydrocarbyl having a linear hydrocarbyl chain with at least 3 hydroxyls directly connected to the chain, or an alkoxylated derivative thereof. Preferably, R1 is methyl, R2 is straight C11-15 alkyl or C16-18 alkyl or alkenyl chain such as coconut alkyl or mixtures thereof, and Z is derived from a reducing sugar such as glucose, fructose, maltose or lactose, in a reductive amination reaction.


[0175] Highly preferred anionic surfactants include alkyl alkoxylated sulfate surfactants. Examples hereof are water soluble salts or acids of the formula RO(A)mSO3M wherein R is an unsubstituted C10-C24 alkyl or hydroxyalkyl group having a C10-C24 alkyl component, preferably a C12-C20 alkyl or hydroxyalkyl, more preferably C12-C18 alkyl or hydroxyalkyl, A is an ethoxy or propoxy unit, m is greater than zero, typically between about 0.5 and about 6, more preferably between about 0.5 and about 3, and M is H or a cation which can be, for example, a metal cation (e.g., sodium, potassium, lithium, calcium, magnesium, etc.), ammonium or substituted-ammonium cation. Alkyl ethoxylated sulfates as well as alkyl propoxylated sulfates are contemplated herein. Specific examples of substituted ammonium cations include methyl, dimethyl, and trimethyl-ammonium cations and quaternary ammonium cations such as tetramethyl-ammonium and dimethyl piperdinium cations and those derived from alkylamines such as ethylamine, diethylamine, triethylamine, mixtures thereof, and the like. Exemplary surfactants are C12-C18 alkyl polyethoxylate (1.0) sulfate (C12-C18E(1.0)M), C12-C18 alkyl polyethoxylate (2.25) sulfate (C12-C18(2.25)M, and C12-C18 alkyl polyethoxylate (3.0) sulfate (C12-C18E(3.0)M, and C12-C18 alkyl polyethoxylate (4.0) sulfate (C12-C18E(4.0)M), wherein M is conveniently selected from sodium and potassium.


[0176] Suitable anionic surfactants to be used are alkyl ester sulfonate surfactants including linear esters of C8-C20 carboxylic acids (i.e., fatty acids) which are sulfonated with gaseous SO3 according to “The Journal of the American Oil Chemists Society”, 52 (1975), pp. 323-329. Suitable starting materials would include natural fatty substances as derived from tallow, palm oil, etc.


[0177] The preferred alkyl ester sulfonate surfactant, especially for laundry applications, is an alkyl ester sulfonate surfactant of the formula:
2


[0178] wherein R3 is a C8-C20 hydrocarbyl, preferably an alkyl, or combination thereof, R4 is a C1-C6 hydrocarbyl, preferably an alkyl, or combination thereof, and M is a cation which forms a water soluble salt with the alkyl ester sulfonate. Suitable salt-forming cations include metals such as sodium, potassium, and lithium, and substituted or unsubstituted ammonium cations, such as monoethanolamine, diethonolamine, and triethanolamine. Preferably, R3 is C10-C16 alkyl, and R4 is methyl, ethyl or isopropyl. Especially preferred are the methyl ester sulfonates wherein R3 is C10-C16 alkyl.


[0179] Other suitable anionic surfactants include the alkyl sulfate surfactants which are water soluble salts or acids of the formula ROSO3M wherein R preferably is a C10-C24 hydrocarbyl, preferably an alkyl or hydroxyalkyl having a C10-C20 alkyl component, more preferably a C12-C18 alkyl or hydroxyalkyl, and M is H or a cation, e.g., an alkali metal cation (e.g. sodium, potassium, lithium), or ammonium or substituted ammonium (e.g. methyl, dimethyl, and trimethyl ammonium cations and quaternary ammonium cations such as tetramethyl-ammonium and dimethyl piperdinium cations and quaternary ammonium cations derived from alkylamines such as ethylamine, diethylamine, triethylamine, and mixtures thereof, and the like). Typically, alkyl chains of C12-C16 are preferred for lower wash temperatures (e.g. below about 50° C.) and C16-C18 alkyl chains are preferred for higher wash temperatures (e.g. above about 50° C.).


[0180] Other anionic surfactants useful for detersive purposes can also be included in the laundry detergent compositions of the present invention. Theses can include salts (including, for example, sodium, potassium, ammonium, and substituted ammonium salts such as mono, di, and triethanolamine salts) of soap, C8-C22 primary or secondary alkanesulfonates, C8-C24 olefinsulfonates, sulfonated polycarboxylic acids prepared by sulfonation of the pyrolyzed product of alkaline earth metal citrates, e.g., as described in British patent specification No. 1,082,179, C8-C24 alkylpolyglycolethersulfates (containing up to 10 moles of ethylene oxide); alkyl glycerol sulfonates, fatty acyl glycerol sulfonates, fatty oleyl glycerol sulfates, alkyl phenol ethylene oxide ether sulfates, paraffin sulfonates, alkyl phosphates, isethionates such as the acyl isethionates, N-acyl taurates, alkyl succinamates and sulfosuccinates, monoesters of sulfosuccinates (especially saturated and unsaturated C12-C18 monoesters) and diesters of sulfosuccinates (especially saturated and unsaturated C6-C12 diesters), acyl sarcosinates, sulfates of alkylpolysaccharides such as the sulfates of alkylpolyglucoside (the nonionic nonsulfated compounds being described below), branched primary alkyl sulfates, and alkyl polyethoxy carboxylates such as those of the formula RO(CH2CH2O)k—CH2C00−M+ wherein R is a C8-C22 alkyl, k is an integer from 1 to 10, and M is a soluble salt forming cation. Resin acids and hydrogenated resin acids are also suitable, such as rosin, hydrogenated rosin, and resin acids and hydrogenated resin acids present in or derived from tall oil.


[0181] Alkylbenzene sulfonates are highly preferred. Especially preferred are linear (straight-chain) alkyl benzene sulfonates (LAS) wherein the alkyl group preferably contains from 10 to 18 carbon atoms.


[0182] Further examples are described in “Surface Active Agents and Detergents” (Vol. I and II by Schwartz, Perrry and Berch). A variety of such surfactants are also generally disclosed in U.S. Pat. No. 3,929,678, (column 23, line 58 through column 29, line 23, which is herein incorporated by reference).


[0183] When included therein, the laundry detergent compositions of the present invention typically comprise from about 1% to about 40%, preferably from about 3% to about 20% by weight of such anionic surfactants.


[0184] The cleaning or laundry detergent compositions of the present invention may also contain cationic, ampholytic, zwitterionic, and semi-polar surfactants, as well as the nonionic and/or anionic surfactants other than those already described herein.


[0185] Cationic detersive surfactants suitable for use in the laundry detergent compositions of the present invention are those having one long-chain hydrocarbyl group. Examples of such cationic surfactants include the ammonium surfactants such as alkyltrimethylammonium halogenides, and those surfactants having the formula:


[R2(OR3)y][R4(OR3)y]2R5N+X−


[0186] wherein R2 is an alkyl or alkyl benzyl group having from about 8 to about 18 carbon atoms in the alkyl chain, each R3 is selected form the group consisting of —CH2CH2—, —CH2CH(CH3)—, —CH2CH(CH2OH)—, —CH2CH2CH2—, and mixtures thereof; each R4 is selected from the group consisting of C1-C4 alkyl, C1-C4 hydroxyalkyl, benzyl ring structures formed by joining the two R4 groups, —CH2CHOHCHOHCOR6CHOHCH2OH, wherein R6 is any hexose or hexose polymer having a molecular weight less than about 1000, and hydrogen when y is not 0; R5 is the same as R4 or is an alkyl chain,wherein the total number of carbon atoms or R2 plus R5 is not more than about 18; each y is from 0 to about 10,and the sum of the y values is from 0 to about 15; and X is any compatible anion.


[0187] Highly preferred cationic surfactants are the water soluble quaternary ammonium compounds useful in the present composition having the formula:


R1R2R3R4N+X−  (i)


[0188] wherein R1 is C8-C16 alkyl, each of R2, R3 and R4 is independently C1-C4 alkyl, C1-C4 hydroxy alkyl, benzyl, and —(C2H40)xH where x has a value from 2 to 5, and X is an anion. Not more than one of R2, R3 or R4 should be benzyl.


[0189] The preferred alkyl chain length for R1 is C12-C15, particularly where the alkyl group is a mixture of chain lengths derived from coconut or palm kernel fat or is derived synthetically by olefin build up or OXO alcohols synthesis.


[0190] Preferred groups for R2, R3 and R4 are methyl and hydroxyethyl groups and the anion X may be selected from halide, methosulphate, acetate and phosphate ions.


[0191] Examples of suitable quaternary ammonium compounds of formulae (i) for use herein are:


[0192] coconut trimethyl ammonium chloride or bromide;


[0193] coconut methyl dihydroxyethyl ammonium chloride or bromide;


[0194] decyl triethyl ammonium chloride;


[0195] decyl dimethyl hydroxyethyl ammonium chloride or bromide;


[0196] C12-15 dimethyl hydroxyethyl ammonium chloride or bromide;


[0197] coconut dimethyl hydroxyethyl ammonium chloride or bromide;


[0198] myristyl trimethyl ammonium methyl sulphate;


[0199] lauryl dimethyl benzyl ammonium chloride or bromide;


[0200] lauryl dimethyl (ethenoxy)4 ammonium chloride or bromide;


[0201] choline esters (compounds of formula (i) wherein R1 is
3


[0202] di-alkyl imidazolines [compounds of formula (i)].


[0203] Other cationic surfactants useful herein are also described in U.S. Pat. No. 4,228,044 and in EP 000 224.


[0204] When included therein, the laundry detergent compositions of the present invention typically comprise from 0.2% to about 25%, preferably from about 1% to about 8% by weight of such cationic surfactants.


[0205] Ampholytic surfactants are also suitable for use in the laundry detergent compositions of the present invention. These surfactants can be broadly described as aliphatic derivatives of secondary or tertiary amines, or aliphatic derivatives of heterocyclic secondary and tertiary amines in which the aliphatic radical can be straight or branched-chain. One of the aliphatic substituents contains at least about 8 carbon atoms, typically from about 8 to about 18 carbon atoms, and at least one contains an anionic water-solubilizing group, e.g. carboxy, sulfonate, sulfate. See U.S. Pat. No. 3,929,678 (column 19, lines 18-35) for example of ampholytic surfactants.


[0206] When included therein, the laundry detergent compositions of the present invention typically comprise from 0.2% to about 15%, preferably from about 1% to about 10% by weight of such ampholytic surfactants.


[0207] Zwitterionic surfactants are also suitable for use in laundry detergent compositions. These surfactants can be broadly described as derivatives of secondary and tertiary amines, derivatives of heterocyclic secondary and tertiary amines, or derivatives of quaternary ammonium, quaternary phosphonium or tertiary sulfonium compounds. See U.S. Pat. No. 3,929,678 (column 19, line 38 through column 22, line 48) for example of zwitterionic surfactants.


[0208] When included therein, the laundry detergent compositions of the present invention typically comprise from 0.2% to about 15%, preferably from about 1% to about 10% by weight of such zwitterionic surfactants.


[0209] Semi-polar nonionic surfactants are a special category of nonionic surfactants which include water-soluble amine oxides containing one alkyl moiety of from about 10 to about 18 carbon atoms and 2 moieties selected from the group consisting of alkyl groups and hydroxyalkyl groups containing from about 1 to about 3 carbon atoms; watersoluble phosphine oxides containing one alkyl moiety of from about 10 to about 18 carbon atoms and 2 moieties selected from the group consisting of alkyl groups and hydroxyalkyl groups containing from about 1 to about 3 carbon atoms; and water-soluble sulfoxides containing one alkyl moiety from about 10 to about 18 carbon atoms and a moiety selected from the group consisting of alkyl and hydroxyalkyl moieties of from about 1 to about 3 carbon atoms.


[0210] Semi-polar nonionic detergent surfactants include the amine oxide surfactants having the formula:
4


[0211] wherein R3 is an alkyl, hydroxyalkyl, or alkyl phenyl group or mixtures thereof containing from about 8 to about 22 carbon atoms; R4 is an alkylene or hydroxyalkylene group containing from about 2 to about 3 carbon atoms or mixtures thereof; x is from 0 to about 3: and each R5 is an alkyl or hydroxyalkyl group containing from about 1 to about 3 carbon atoms or a polyethylene oxide group containing from about 1 to about 3 ethylene oxide groups. The R5 groups can be attached to each other, e.g., through an oxygen or nitrogen atom, to form a ring structure.


[0212] These amine oxide surfactants in particular include C10-C18 alkyl dimethyl amine oxides and C8-C12 alkoxy ethyl dihydroxy ethyl amine oxides.


[0213] When included therein, the laundry detergent compositions of the present invention typically comprise from 0.2% to about 15%, preferably from about 1% to about 10% by weight of such semi-polar nonionic surfactants.


[0214] Builder System


[0215] The compositions according to the present invention may further comprise a builder system. Any conventional builder system is suitable for use herein including aluminosilicate materials, silicates, polycarboxylates and fatty acids, materials such as ethylenediamine tetraacetate, metal ion sequestrants such as aminopolyphosphonates, particularly ethylenediamine tetramethylene phosphonic acid and diethylene triamine pentamethylenephosphonic acid. Though less preferred for obvious environmental reasons, phosphate builders can also be used herein.


[0216] Suitable builders can be an inorganic ion exchange material, commonly an inorganic hydrated aluminosilicate material, more particularly a hydrated synthetic zeolite such as hydrated zeolite A, X, B, HS or MAP.


[0217] Another suitable inorganic builder material is layered silicate, e.g. SKS-6 (Hoechst). SKS-6 is a crystalline layered silicate consisting of sodium silicate (Na2Si2O5).


[0218] Suitable polycarboxylates containing one carboxy group include lactic acid, glycolic acid and ether derivatives thereof as disclosed in Belgian Patent Nos. 831,368, 821,369 and 821,370. Polycarboxylates containing two carboxy groups include the water-soluble salts of succinic acid, malonic acid, (ethylenedioxy) diacetic acid, maleic acid, diglycollic acid, tartaric acid, tartronic acid and fumaric acid, as well as the ether carboxylates described in German Offenleenschrift 2,446,686, and 2,446,487, U.S. Pat. No. 3,935,257 and the sulfinyl carboxylates described in Belgian Patent No. 840,623. Polycarboxylates containing three carboxy groups include, in particular, water-soluble citrates, aconitrates and citraconates as well as succinate derivatives such as the carboxymethyloxysuccinates described in British Patent No. 1,379,241, lactoxysuccinates described in Netherlands Application 7205873, and the oxypolycarboxylate materials such as 2-oxa-1,1,3-propane tricarboxylates described in British Patent No. 1,387,447.


[0219] Polycarboxylates containing four carboxy groups include oxydisuccinates disclosed in British Patent No. 1,261,829, 1,1,2,2,-ethane tetracarboxylates, 1,1,3,3-propane tetracarboxylates containing sulfo substituents include the sulfosuccinate derivatives disclosed in British Patent Nos. 1,398,421 and 1,398,422 and in U.S. Pat. No. 3,936,448, and the sulfonated pyrolyzed citrates described in British Patent No. 1,082,179, while polycarboxylates containing phosphone substituents are disclosed in British Patent No. 1,439,000.


[0220] Alicyclic and heterocyclic polycarboxylates include cyclopentane-cis, cis-cis-tetracarboxylates, cyclopentadienide pentacarboxylates, 2,3,4,5-tetrahydro-furan-cis,cis, cis-tetracarboxylates, 2,5-tetrahydrofuran-cis-dicarboxylates, 2,2,5,5-tetrahydrofuran-tetracarboxylates, 1,2,3,4,5,6-hexane-hexacarboxylates and carboxymethyl derivatives of polyhydric alcohols such as sorbitol, mannitol and xylitol. Aromatic polycarboxylates include mellitic acid, pyromellitic acid and the phthalic acid derivatives disclosed in British Patent No. 1,425,343.


[0221] Of the above, the preferred polycarboxylates are hydroxy-carboxylates containing up to three carboxy groups per molecule, more particularly citrates.


[0222] Preferred builder systems for use in the present compositions include a mixture of a water-insoluble aluminosilicate builder such as zeolite A or of a layered silicate (SKS-6), and a water-soluble carboxylate chelating agent such as citric acid.


[0223] A suitable chelant for inclusion in the detergent composi-ions in accordance with the invention is ethylenediamine-N,N′-disuccinic acid (EDDS) or the alkali metal, alkaline earth metal, ammonium, or substituted ammonium salts thereof, or mixtures thereof. Preferred EDDS compounds are the free acid form and the sodium or magnesium salt thereof. Examples of such preferred sodium salts of EDDS include Na2EDDS and Na4EDDS. Examples of such preferred magnesium salts of EDDS include MgEDDS and Mg2EDDS. The magnesium salts are the most preferred for inclusion in compositions in accordance with the invention.


[0224] Preferred builder systems include a mixture of a water-insoluble aluminosilicate builder such as zeolite A, and a water soluble carboxylate chelating agent such as citric acid.


[0225] Other builder materials that can form part of the builder system for use in granular compositions include inorganic materials such as alkali metal carbonates, bicarbonates, silicates, and organic materials such as the organic phosphonates, amino polyalkylene phosphonates and amino polycarboxylates.


[0226] Other suitable water-soluble organic salts are the homo- or co-polymeric acids or their salts, in which the polycarboxylic acid comprises at least two carboxyl radicals separated form each other by not more than two carbon atoms.


[0227] Polymers of this type are disclosed in GB-A-1,596,756. Examples of such salts are polyacrylates of MW 2000-5000 and their copolymers with maleic anhydride, such copolymers having a molecular weight of from 20,000 to 70,000, especially about 40,000.


[0228] Detergency builder salts are normally included in amounts of from 5% to 80% by weight of the composition. Preferred levels of builder for liquid detergents are from 5% to 30%.


[0229] Enzymes:


[0230] Mannanase is incorporated into the cleaning or detergent compositions in accordance with the invention preferably at a level of from 0.0001% to 2%, more preferably from 0.0005% to 0.5%, most preferred from 0.001% to 0.1% pure enzyme by weight of the composition.


[0231] The cleaning compositions of the present invention may further comprise as an essential element a carbohydrase selected from the group consisting of cellulases, amylases, pectin degrading enzymes and xyloglucanases. Preferably, the cleaning compositions of the present invention will comprise a mannanase, an amylase and another bioscouring-type of enzyme selected from the group consisting of cellulases, pectin degrading enzymes and xyloglucanases.


[0232] The cellulases usable in the present invention include both bacterial or fungal cellulases. Preferably, they will have a pH optimum of between 5 and 12 and a specific activity above 50 CEVU/mg (Cellulose Viscosity Unit). Suitable cellulases are disclosed in U.S. Pat. No. 4,435,307, JP 61078384 and WO 96/02653 which discloses fungal cellulase produced from Humicola insolens, Trichoderma, Thielavia, and Sporotrichum, respectively. EP 739 982 describes cellulases isolated from Bacillus species. Suitable cellulases are also disclosed in GB-A-2075028; GB-A-2095275; DE-OS-22 47 832 and WO 95/26398.


[0233] Examples of such cellulases are cellulases produced by a strain of Humicola insolens (Humicola grisea var. thermoidea), particularly the strain Humicola insolens, DSM 1800. Other suitable cellulases are cellulases originated from Humicola insolens having a molecular weight of about 50 kD, an isoelectric point of 5.5 and containing 415 amino acids; and a ˜43 kD endo-beta-1,4-glucanase derived from Humicola insolens, DSM 1800; a preferred cellulase has the amino acid sequence disclosed in WO 91/17243. Also suitable cellulases are the EGIII cellulases from Trichoderma longibrachiatum described in WO 94/21801. Especially suitable cellulases are the cellulases having color care benefits. Examples of such cellulases are the cellulases described in WO 96/29397, EP-A-0495257, WO 91/17243, WO 91/17244 and WO 91/21801. Other suitable cellulases for fabric care and/or cleaning properties are described in WO 96/34092, WO 96/17994 and WO 95/24471.


[0234] Said cellulases are normally incorporated in the detergent composition at levels from 0.0001% to 2% of pure enzyme by weight of the detergent composition.


[0235] Preferred cellulases for the purpose of the present invention are alkaline cellulases, i.e., enzyme having at least 25%, more preferably at least 40% of their maximum activity at a pH ranging from 7 to 12. More preferred cellulases are enzymes having their maximum activity at a pH ranging from 7 to 12. A preferred alkaline cellulase is the cellulase sold under the tradename Carezyme® by Novo Nordisk A/S.


[0236] Amylases (alpha and/or beta) can be included for removal of carbohydrate-based stains. WO 94/02597 (Novo Nordisk A/S) describes cleaning compositions which incorporate mutant amylases. See also WO 95/10603 (Novo Nordisk A/S). Other amylases known for use in cleaning compositions include both alpha- and beta-amylases. Alpha-amylases are known in the art and include those disclosed in U.S. Pat. No. 5,003,257; EP 252,666; WO 91/00353; FR 2,676,456; EP 285,123; EP 525,610; EP 368,341; and British Patent specification no. 1,296,839 (Novo). Other suitable amylases are stability-enhanced amylases described in WO 94/18314 and WO 96/05295 (Genencor) and amylase variants having additional modification in the immediate parent available from Novo Nordisk A/S, disclosed in WO 95/10603. Also suitable are amylases described in EP 277 216, WO 95/26397 and WO 96/23873 (all by Novo Nordisk).


[0237] Examples of commercial alpha-amylases products are Purafect Ox Am® from Genencor and Termamyl®, Ban®, Fungamyl® and Duramyl®, all available from Novo Nordisk A/S (Denmark). WO 95/26397 describes other suitable amylases: alpha-amylases characterized by having a specific activity at least 25% higher than the specific activity of Termamyl® at a temperature range of 25° C. to 55° C. and at a pH value in the range of 8 to 10, measured by the Phadebase® alpha-amylase activity assay. Suitable are variants of the above enzymes, described in WO 96/23873 (Novo Nordisk). Other amylolytic enzymes with improved properties with respect to the activity level and the combination of thermostability and a higher activity level are described in WO 95/35382.


[0238] Preferred amylases for the purpose of the present invention are the amylases sold under the tradenames Termamyl, Duramyl and Maxamyl and or the alpha-amylase variant demonstrating increased thermostability disclosed as SEQ ID NO: 2 in WO 96/23873.


[0239] Preferred amylases for specific applications are alkaline amylases, ie enzymes having an enzymatic activity of at least 10%, preferably at least 25%, more preferably at least 40% of their maximum activity at a pH ranging from 7 to 12. More preferred amylases are enzymes having their maximum activity at a pH ranging from 7 to 12.


[0240] The amylolytic enzymes are incorporated in the detergent compositions of the present invention a level of from 0.0001% to 2%, preferably from 0.00018% to 0.06%, more preferably from 0.00024% to 0.048% pure enzyme by weight of the composition.


[0241] The term “pectin degrading enzyme” is intended to encompass arabinanase (EC 3.2.1.99), galactanases (EC 3.2.1.89), polygalacturonase (EC 3.2.1.15) exo-polygalacturonase (EC 3.2.1.67), exo-poly-alpha-galacturonidase (EC 3.2.1.82), pectin lyase (EC 4.2.2.10), pectin esterase (EC 3.2.1.11), pectate lyase (EC 4.2.2.2), exo-polygalacturonate lyase (EC 4.2.2.9)and hemicellulases such as beta-1,3-endoxylosidase (EC 3.2.1.32), xylan-beta-1,4-xylosidase (EC 3.2.1.37)and alpha-L-arabinofuranosidase (EC 3.2.1.55). The pectin degrading enzymes are natural mixtures of the above mentioned enzymatic activities. Pectin enzymes therefore include the pectin methylesterases which hydrolyse the pectin methyl ester linkages, polygalacturonases which cleave the glycosidic bonds between galacturonic acid molecules, and the pectin transeliminases or lyases which act on the pectic acids to bring about non-hydrolytic cleavage of alpha-1→4 glycosidic linkages to form unsaturated derivatives of galacturonic acid.


[0242] Pectin degrading enzymes are incorporated into the compositions in accordance with the invention preferably at a level of from 0.0001% to 2%, more preferably from 0.0005% to 0.5%, most preferred from 0.001% to 0.1% pure enzyme by weight of the total composition.


[0243] Preferred pectin degrading enzymes for specific applications are alkaline pectin degrading enzymes, i.e., enzymes having an enzymatic activity of at least 10%, preferably at least 25%, more preferably at least 40% of their maximum activity at a pH ranging from 7 to 12. More preferred pectin degrading enzymes are enzymes having their maximum activity at a pH ranging from 7 to 12. Alkaline pectin degrading enzymes are produced by alkalophilic microorganisms e.g., bacterial, fungal and yeast microorganisms such as Bacillus species.


[0244] Preferred microorganisms are Bacillus circulans, Bacillus firmus, and Bacillus subtilis as described in JP 56131376 and JP 56068393. Alkaline pectin decomposing enzymes include galacturan-alpha-1,4-galacturonase (EC 3.2.1.67), poly-galacturonase activities (EC 3.2.1.15, pectin esterase (EC 3.1.1.11), pectate lyase (EC 4.2.2.2) and their iso enzymes and they can be produced by the Erwinia species. Preferred are E. amylovora, E. carotovora, E. chrysanthemi, E. dissolvens, and E. herbicola, as described in JP 59066588, JP 63042988 and in World J. Microbiol. Microbiotechnol., 1992, 8(2): 115-120. Said alkaline pectin enzymes can also be produced by Bacillus species as disclosed in JP 73006557 and Agr. Biol. Chem., 1972, 36(2): 285-93.


[0245] The term xyloglucanase encompasses the family of enzymes described by Vincken and Voragen at Wageningen University (Vincken et al., 1994, Plant Physiol., 104: 99-107) and are able to degrade xyloglucans as described in Hayashi et al., 1989, Plant. Physiol. Plant Mol. Biol., 40: 139-168. Vincken et al. demonstrated the removal of xyloglucan coating from cellulose of the isolated apple cell wall by a xyloglucanase purified from Trichoderma viride (endo-IV-glucanase). This enzyme enhances the enzymatic degradation of cell wall-embedded cellulose and work in synergy with pectic enzymes. Rapidase LIQ+ from Gist-Brocades contains a xyloglucanase activity.


[0246] This xyloglucanase is incorporated into the cleaning compositions in accordance with the invention preferably at a level of from 0.0001% to 2%, more preferably from 0.0005% to 0.5%, most preferred from 0.001% to 0.1% pure enzyme by weight of the composition.


[0247] Preferred xyloglucanases for specific applications are alkaline xyloglucanases, i.e. enzymes having an enzymatic activity of at least 10%, preferably at least 25%, more preferably at least 40% of their maximum activity at a pH ranging from 7 to 12. More preferred xyloglucanases are enzymes having their maximum activity at a pH ranging from 7 to 12.


[0248] The above-mentioned enzymes may be of any suitable origin, such as vegetable, animal, bacterial, fungal and yeast origin. Origin can further be mesophilic or extremophilic (psychrophilic, psychrotrophic, thermophilic, barophilic, alkalophilic, acidophilic, halophilic, etc.). Purified or non-purified forms of these enzymes may be used. Nowadays, it is common practice to modify wild-type enzymes via protein/genetic engineering techniques in order to optimise their performance efficiency in the cleaning compositions of the invention. For example, the variants may be designed such that the compatibility of the enzyme to commonly encountered ingredients of such compositions is increased. Alternatively, the variant may be designed such that the optimal pH, bleach or chelant stability, catalytic activity and the like, of the enzyme variant is tailored to suit the particular cleaning application.


[0249] In particular, attention should be focused on amino acids sensitive to oxidation in the case of bleach stability and on surface charges for the surfactant compatibility. The isoelectric point of such enzymes may be modified by the substitution of some charged amino acids, e.g., an increase in isoelectric point may help to improve compatibility with anionic surfactants. The stability of the enzymes may be further enhanced by the creation of e.g,. additional salt bridges and enforcing metal binding sites to increase chelant stability.


[0250] Bleaching Agents:


[0251] Additional optional detergent ingredients that can be included in the detergent compositions of the present invention include bleaching agents such as PB1, PB4 and percarbonate with a particle size of 400-800 microns. These bleaching agent components can include one or more oxygen bleaching agents and, depending upon the bleaching agent chosen, one or more bleach activators. When present, oxygen bleaching compounds will typically be present at levels of from about 1% to about 25%. In general, bleaching compounds are optional added components in non-liquid formulations, e.g., granular detergents.


[0252] A bleaching agent component for use herein can be any of the bleaching agents useful for detergent compositions including oxygen bleaches, as well as others known in the art.


[0253] A bleaching agent suitable for the present invention can be an activated or non-activated bleaching agent.


[0254] One category of oxygen bleaching agent that can be used encompasses percarboxylic acid bleaching agents and salts thereof. Suitable examples of this class of agents include magnesium monoperoxyphthalate hexahydrate, the magnesium salt of meta-chloro perbenzoic acid, 4-nonylamino-4-oxoperoxybutyric acid and diperoxydodecanedioic acid. Such bleaching agents are disclosed in U.S. Pat. No. 4,483,781, U.S. Pat. No. 4,740,446, EP 0 133 354 and U.S. Pat. No. 4,412,934. Highly preferred bleaching agents also include 6-nonylamino-6-oxoperoxycaproic acid as described in U.S. Pat. No. 4,634,551.


[0255] Another category of bleaching agents that can be used encompasses the halogen bleaching agents. Examples of hypohalite bleaching agents, for example, include trichloro isocyanuric acid and the sodium and potassium dichloroisocyanurates and N-chloro and N-bromo alkane sulphonamides. Such materials are normally added at 0.5-10% by weight of the finished product, preferably 1-5% by weight.


[0256] The hydrogen peroxide releasing agents can be used in combination with bleach activators such as tetra-acetylethylenediamine (TAED), nonanoyloxybenzenesulfonate (NOBS, described in U.S. Pat. No. 4,412,934), 3,5-trimethyl-hexsanoloxybenzenesulfonate (ISONOBS, described in EP 120 591) or pentaacetylglucose (PAG), which are perhydrolyzed to form a peracid as the active bleaching species, leading to improved bleaching effect. In addition, very suitable are the bleach activators C8 (6-octanamido-caproyl) oxybenzene-sulfonate, C9 (6-nonanamido caproyl) oxybenzenesulfonate and C10 (6-decanamido caproyl) oxybenzenesulfonate or mixtures thereof. Also suitable activators are acylated citrate esters such as disclosed in European Patent Application No. 91870207.7.


[0257] Useful bleaching agents, including peroxyacids and bleaching systems comprising bleach activators and peroxygen bleaching compounds for use in cleaning compositions according to the invention are described in application U.S. application Ser. No. 08/136,626.


[0258] The hydrogen peroxide may also be present by adding an enzymatic system (i.e. an enzyme and a substrate therefore) which is capable of generation of hydrogen peroxide at the beginning or during the washing and/or rinsing process. Such enzymatic systems are disclosed in European Patent Application EP 0 537 381.


[0259] Bleaching agents other than oxygen bleaching agents are also known in the art and can be utilized herein. One type of non-oxygen bleaching agent of particular interest includes photoactivated bleaching agents such as the sulfonated zinc and/or aluminium phthalocyanines. These materials can be deposited upon the substrate during the washing process. Upon irradiation with light, in the presence of oxygen, such as by hanging clothes out to dry in the daylight, the sulfonated zinc phthalocyanine is activated and, consequently, the substrate is bleached. Preferred zinc phthalocyanine and a photoactivated bleaching process are described in U.S. Pat. No. 4,033,718. Typically, detergent composition will contain about 0.025% to about 1.25%, by weight, of sulfonated zinc phthalocyanine.


[0260] Bleaching agents may also comprise a manganese catalyst. The manganese catalyst may, e.g., be one of the compounds described in “Efficient manganese catalysts for low-temperature bleaching”, Nature, 1994, 369: 637-639.


[0261] Suds Suppressors:


[0262] Another optional ingredient is a suds suppressor, exemplified by silicones, and silica-silicone mixtures. Silicones can generally be represented by alkylated polysiloxane materials, while silica is normally used in finely divided forms exemplified by silica aerogels and xerogels and hydrophobic silicas of various types. Theses materials can be incorporated as particulates, in which the suds suppressor is advantageously releasably incorporated in a water-soluble or water-dispersible, substantially non surface-active detergent impermeable carrier. Alternatively the suds suppressor can be dissolved or dispersed in a liquid carrier and applied by spraying on to one or more of the other components.


[0263] A preferred silicone suds controlling agent is disclosed in U.S. Pat. No. 3,933,672. Other particularly useful suds suppressors are the self-emulsifying silicone suds suppressors, described in German Patent Application DTOS 2,646,126. An example of such a compound is DC-544, commercially available form Dow Corning, which is a siloxane-glycol copolymer. Especially preferred suds controlling agent are the suds suppressor system comprising a mixture of silicone oils and 2-alkyl-alkanols. Suitable 2-alkyl-alkanols are 2-butyl-octanol which is commercially available under the trade name Isofol 12 R.


[0264] Such suds suppressor system are described in European Patent Application EP 0 593 841.


[0265] Especially preferred silicone suds controlling agents are described in European Patent Application No. 92201649.8. Said compositions can comprise a silicone/ silica mixture in combination with fumed nonporous silica such as Aerosil®.


[0266] The suds suppressors described above are normally employed at levels of from 0.001% to 2% by weight of the composition, preferably from 0.01% to 1% by weight.


[0267] Other Components:


[0268] Other components used in detergent compositions may be employed, such as soil-suspending agents, soil-releasing agents, optical brighteners, abrasives, bactericides, tarnish inhibitors, coloring agents, and/or encapsulated or nonencapsulated perfumes.


[0269] Especially suitable encapsulating materials are water soluble capsules which consist of a matrix of polysaccharide and polyhydroxy compounds such as described in GB 1,464,616.


[0270] Other suitable water soluble encapsulating materials comprise dextrins derived from ungelatinized starch acid esters of substituted dicarboxylic acids such as described in U.S. Pat. No. 3,455,838. These acid-ester dextrins are, preferably, prepared from such starches as waxy maize, waxy sorghum, sago, tapioca and potato. Suitable examples of said encapsulation materials include N-Lok manufactured by National Starch. The N-Lok encapsulating material consists of a modified maize starch and glucose. The starch is modified by adding monofunctional substituted groups such as octenyl succinic acid anhydride.


[0271] Antiredeposition and soil suspension agents suitable herein include cellulose derivatives such as methylcellulose, carboxymethylcellulose and hydroxyethylcellulose, and homo- or co-polymeric polycarboxylic acids or their salts. Polymers of this type include the polyacrylates and maleic anhydride-acrylic acid copolymers previously mentioned as builders, as well as copolymers of maleic anhydride with ethylene, methylvinyl ether or methacrylic acid, the maleic anhydride constituting at least 20 mole percent of the copolymer. These materials are normally used at levels of from 0.5% to 10% by weight, more preferably form 0.75% to 8%, most preferably from 1% to 6% by weight of the composition.


[0272] Preferred optical brighteners are anionic in character, examples of which are disodium 4,4′-bis-(2-diethanolamino-4-anilino-s-triazin-6-ylamino)stilbene-2:2′-disulphonate, disodium 4,4′-bis-(2-morpholino-4-anilino-s-triazin-6-ylamino-stilbene-2:2′-disulphonate, disodium 4,4′-bis-(2,4-dianilino-s-triazin-6-ylamino)stilbene-2:2′-disulphonate, monosodium 4′, 4″-bis-(2,4-dianilino-s-triazin-6-ylamino)stilbene-2-sulphonate, disodium 4,4′-bis-(2-anilino-4-(N-methyl-N-2-hydroxyethylamino)-s-triazin-6-ylamino)stilbene-2,2′-disulphonate, disodium 4,4′-bis-(4-phenyl-2,1,3-triazol-2-yl)-stilbene-2,2′-disulphonate, disodium 4,4′-bis(2-anilino-4-(1-methyl-2-hydroxyethylamino)-s-triazin-6-ylamino)stilbene-2,2′-disulphonate, sodium 2-(stilbyl-4″-(naphtho-1′,2′:4,5)-1,2,3-triazole-2″-sulphonate and 4,4′-bis(2-sulphostyryl)biphenyl.


[0273] Other useful polymeric materials are the polyethylene glycols, particularly those of molecular weight 1000-10000, more particularly 2000 to 8000 and most preferably about 4000. These are used at levels of from 0.20% to 5% more preferably from 0.25% to 2.5% by weight. These polymers and the previously mentioned homo- or co-polymeric poly-carboxylate salts are valuable for improving whiteness maintenance, fabric ash deposition, and cleaning performance on clay, proteinaceous and oxidizable soils in the presence of transition metal impurities.


[0274] Soil release agents useful in compositions of the present invention are conventionally copolymers or terpolymers of terephthalic acid with ethylene glycol and/or propylene glycol units in various arrangements. Examples of such polymers are disclosed in U.S. Pat. Nos. 4,116,885 and 4,711,730 and EP 0 272 033. A particular preferred polymer is described in EP 0 272 033 and has the formula:


(CH3(PEG)43)0.75(POH)0.25[T−PO)2.8(T−PEG)0.4]T(POH)0.25((PEG)43CH3)0.75


[0275] where PEG is —(OC2H4)0—,PO is (OC3H6O) and T is (pOOC6H4CO).


[0276] Also very useful are modified polyesters as random copolymers of dimethyl terephthalate, dimethyl sulfoisophthalate, ethylene glycol and 1,2-propanediol, the end groups consisting primarily of sulphobenzoate and secondarily of mono esters of ethylene glycol and/or 1,2-propanediol. The target is to obtain a polymer capped at both end by sulphobenzoate groups, “primarily”, in the present context most of said copolymers herein will be endcapped by sulphobenzoate groups. However, some copolymers will be less than fully capped, and therefore their end groups may consist of monoester of ethylene glycol and/or 1,2-propanediol, thereof consist “secondarily” of such species.


[0277] The selected polyesters herein contain about 46% by weight of dimethyl terephthalic acid, about 16% by weight of 1,2-propanediol, about 10% by weight ethylene glycol, about 13% by weight of dimethyl sulfobenzoic acid and about 15% by weight of sulfoisophthalic acid, and have a molecular weight of about 3.000. The polyesters and their method of preparation are described in detail in EP 311 342.


[0278] Softening Agents:


[0279] Fabric softening agents can also be incorporated into laundry detergent compositions in accordance with the present invention. These agents may be inorganic or organic in type. Inorganic softening agents are exemplified by the smectite clays disclosed in GB-A-1 400898 and in U.S. Pat. No. 5,019,292. Organic fabric softening agents include the water insoluble tertiary amines as disclosed in GB-A1 514 276 and EP 0 011 340 and their combination with mono C12-C14 quaternary ammonium salts are disclosed in EP-B-0 026 528 and di-long chain amides as disclosed in EP 0 242 919. Other useful organic ingredients of fabric softening systems include high molecular weight polyethylene oxide materials as disclosed in EP 0 299 575 and 0 313 146.


[0280] Levels of smectite clay are normally in the range from 5% to 15%, more preferably from 8% to 12% by weight, with the material being added as a dry mixed component to the remainder of the formulation. Organic fabric softening agents such as the water-insoluble tertiary amines or dilong chain amide materials are incorporated at levels of from 0.5% to 5% by weight, normally from 1% to 3% by weight whilst the high molecular weight polyethylene oxide materials and the water soluble cationic materials are added at levels of from 0.1% to 2%, normally from 0.15% to 1.5% by weight. These materials are normally added to the spray dried portion of the composition, although in some instances it may be more convenient to add them as a dry mixed particulate, or spray them as molten liquid on to other solid components of the composition.


[0281] Polymeric Dye-Transfer Inhibiting Agents:


[0282] The detergent compositions according to the present invention may also comprise from 0.001% to 10%, preferably from 0.01% to 2%, more preferably form 0.05% to 1% by weight of polymeric dye-transfer inhibiting agents. Said polymeric dye-transfer inhibiting agents are normally incorporated into detergent compositions in order to inhibit the transfer of dyes from colored fabrics onto fabrics washed therewith. These polymers have the ability of complexing or adsorbing the fugitive dyes washed out of dyed fabrics before the dyes have the opportunity to become attached to other articles in the wash.


[0283] Especially suitable polymeric dye-transfer inhibiting agents are polyamine N-oxide polymers, copolymers of N-vinyl-pyrrolidone and N-vinylimidazole, polyvinylpyrrolidone polymers, polyvinyloxazolidones and polyvinylimidazoles or mixtures thereof.


[0284] Addition of such polymers also enhances the performance of the enzymes according the invention.


[0285] Use in the Paper and Pulp Industry


[0286] Further, it is contemplated that the mannanase of the present invention is useful in chlorine-free bleaching processes for paper pulp (chemical pulps, semichemical pulps, mechanical pulps or kraft pulps) in order to increase the brightness thereof, thus decreasing or eliminating the need for hydrogen peroxide in the bleaching process.


[0287] Use in the Textile and Cellulosic Fiber Processing Industries


[0288] The mannanase of the present invention can be used in combination with other carbohydrate degrading enzymes (for instance xyloglucanase, xylanase, various pectinases) for preparation of fibers or for cleaning of fibers in combination with detergents.


[0289] In the present context, the term “cellulosic material” is intended to mean fibers, sewn and unsewn fabrics, including knits, wovens, denims, yarns, and toweling, made from cotton, cotton blends or natural or manmade cellulosics (e.g. originating from xylan-containing cellulose fibers such as from wood pulp) or blends thereof. Examples of blends are blends of cotton or rayon/viscose with one or more companion material such as wool, synthetic fibers (e.g. polyamide fibers, acrylic fibers, polyester fibers, polyvinyl alcohol fibers, polyvinyl chloride fibers, polyvinylidene chloride fibers, polyurethane fibers, polyurea fibers, aramid fibers), and cellulose-containing fibers (e.g. rayon/viscose, ramie, hemp, flax/linen, jute, cellulose acetate fibers, lyocell).


[0290] The processing of cellulosic material for the textile industry, as for example cotton fiber, into a material ready for garment manufacture involves several steps: spinning of the fiber into a yarn; construction of woven or knit fabric from the yarn and subsequent preparation, dyeing and finishing operations. Woven goods are constructed by weaving a filling yarn between a series of warp yarns; the yarns could be two different types.


[0291] Desizing: polymeric size like e.g. mannan, starch, CMC or PVA is added before weaving in order to increase the warp speed; This material must be removed before further processing. The enzyme of the invention is useful for removal of mannan containing size.


[0292] Degradation of Thickeners


[0293] Galactomannans such as guar gum and locust bean gum are widely used as thickening agents e.g. in food and print paste for textile printing such as prints on T-shirts. The enzyme or enzyme preparation of the invention can be used for reducing the viscosity of, e.g., residual food in processing equipment and thereby facilitate cleaning after processing. Further, it is contemplated that the enzyme or enzyme preparation is useful for reducing viscosity of print paste, thereby facilitating wash out of surplus print paste after textile printins.


[0294] Degradation or Modification of Plant Material


[0295] The enzyme or enzyme preparation according to the invention is preferably used as an agent for degradation or modification of mannan, galactomannan, glucomannan or galactoglucomannan containing material originating from plants. Examples of such material are guar gum and locust bean gum.


[0296] The mannanase of the invention may be used in modifying the physical-chemical properties of plant derived material such as the viscosity. For instance, the mannanase may be used to reduce the viscosity of feed or food which contains mannan and to promote processing of viscous mannan containing material.


[0297] Coffee Extraction


[0298] The enzyme or enzyme preparation of the invention may also be used for hydrolysing galactomannans present in a liquid coffee extract, preferably in order to inhibit gel formation during freeze drying of the (instant) coffee. Preferably, the mannanase of the invention is immobilized in order to reduce enzyme consumption and avoid contamination of the coffee. This use is further disclosed in EP-A-676 145.


[0299] Use in the Fracturing of a Subterranean Formation (Oil Drilling)


[0300] Further, it is contemplated that the enzyme of the present invention is useful as an enzyme breaker as disclosed in U.S. Pat. Nos. 5,806,597, 5,562,160, 5,201,370 and 5,067,566, all of which are hereby incorporated by reference.


[0301] Accordingly, the mannanase of the present invention is useful in a method of fracturing a subterranean formation in a well bore in which a gellable fracturing fluid is first formed by blending together an aqueous fluid, a hydratable polymer, a suitable cross-linking agent for cross-linking the hydratable polymer to form a polymer gel and an enzyme breaker, ie the enzyme of the invention. The cross-linked polymer gel is pumped into the well bore under sufficient pressure to fracture the surrounding formation. The enzyme breaker is allowed to degrade the cross-linked polymer with time to reduce the viscosity of the fluid so that the fluid can be pumped from the formation back to the well surface.


[0302] The enzyme breaker may be an ingredient of a fracturing fluid or a breaker-crosslinker-polymer complex which further comprises a hydratable polymer and a crosslinking agent. The fracturing fluid or complex may be a gel or may be gellable. The complex is useful in a method for using the complex in a fracturing fluid to fracture a subterranean formation that surrounds a well bore by pumping the fluid to a desired location within the well bore under sufficient pressure to fracture the surrounding subterranean formation. The complex may be maintained in a substantially non-reactive state by maintaining specific conditions of pH and temperature, until a time at which the fluid is in place in the well bore and the desired fracture is completed. Once the fracture is completed, the specific conditions at which the complex is inactive are no longer maintained. When the conditions change sufficiently, the complex becomes active and the breaker begins to catalyze polymer degradation causing the fracturing fluid to become sufficiently fluid to be pumped from the subterranean formation to the well surface.


[0303] Materials and Methods


[0304] Assay for Activity Test


[0305] A polypeptide of the invention having mannanase activity may be tested for mannanase activity according to standard test procedures known in the art, such as by applying a solution to be tested to 4 mm diameter holes punched out in agar plates containing 0.2% AZCL galactomannan (carob), i.e. substrate for the assay of endo-1,4-beta-D-mannanase available as CatNo.I-AZGMA from Megazyme (Megazyme's Internet address: http://www.megazyme.com/Purchase/index.html).


[0306] Determination of Catalytic Activity (ManU) of Mannanase


[0307] Colorimetric Assay


[0308] Substrate: 0.2% AZCL-Galactomannan (Megazyme, Australia) from carob in 0.1 M glycine buffer, pH 10.0.


[0309] The assay is carried out in an Eppendorf Micro tube 1.5 ml on a thermomixer with stirring and temperature control of 40° C. Incubation of 0.750 ml substrate with 0.05 ml enzyme for 20 min, stop by centrifugation for 4 minutes at 15000 rpm. The colour of the supernatant is measured at 600 nm in a 1 cm cuvette.


[0310] One ManU (Mannanase units) gives 0.24 abs in 1 cm.


[0311] Strains and Donor Organism


[0312] Bacillus sp. I633 comprises the beta-1,4-mannanase encoding DNA sequence of SEQ ID NO: 1.


[0313]

E. coli
DSM 12197 comprises the plasmid containing the DNA encoding the beta-1,4-mannanase of the invention (SEQ ID NO: 1).


[0314]

Bacillus agaradhaerens
NCIMB 40482 comprises the beta-1,4-mannanase encoding DNA sequence of SEQ ID NO: 5.


[0315]

E. coli
DSM 12180 comprises the plasmid containing the DNA encoding the beta-1,4-mannanase of the invention (SEQ ID NO: 5).


[0316] Bacillus sp. AAI12 comprises the beta-1,4-mannanase encoding DNA sequence of SEQ ID NO: 9.


[0317]

E. coli
DSM 12433 comprises the plasmid containing the DNA encoding the beta-1,4-mannanase of the invention (SEQ ID NO: 9).


[0318]

Bacillus halodurans
comprises the beta-1,4-mannanase encoding DNA sequence of SEQ ID NO: 11.


[0319]

E. coli
DSM 12441 comprises the plasmid containing the DNA encoding the beta-1,4-mannanase of the invention (SEQ ID NO: 11).


[0320] The Humicola insolens mentioned above comprises the beta-1,4-mannanase encoding DNA sequence of SEQ ID NO: 13.


[0321]

E. coli
DSM 9984 comprises the plasmid containing the DNA encoding the beta-1,4-mannanase of the invention (SEQ ID NO: 13).


[0322] Bacillus sp. AA349 comprises the beta-1,4-mannanase encoding DNA sequence of SEQ ID NO: 15.


[0323]

E. coli
DSM 12432 comprises the plasmid containing the DNA encoding the beta-1,4-mannanase of the invention (SEQ ID NO: 15).


[0324]

E. coli
DSM 12847 comprises the plasmid containing the DNA encoding the beta-1,4-mannanase of the invention (SEQ ID NO: 17).


[0325]

E. coli
DSM 12848 comprises the plasmid containing the DNA encoding the beta-1,4-mannanase of the invention (SEQ ID NO: 19).


[0326]

Bacillus clausii
comprises the beta-1,4-mannanase encoding DNA sequence of SEQ ID NO: 21.


[0327]

E. coli
DSM 12849 comprises the plasmid containing the DNA encoding the beta-1,4-mannanase of the invention (SEQ ID NO: 21).


[0328]

E. coli DSM
12850 comprises the plasmid containing the DNA encoding the beta-1,4-mannanase of the invention (SEQ ID NO: 23).


[0329] Bacillus sp. comprises the beta-1,4-mannanase encoding DNA sequence of SEQ ID NO: 25.


[0330]

E. coli
DSM 12846 comprises the plasmid containing the DNA encoding the beta-1,4-mannanase of the invention (SEQ ID NO: 25).


[0331] Bacillus sp. comprises the beta-1,4-mannanase encoding DNA sequence of SEQ ID NO: 27.


[0332]

E. coli
DSM 12851 comprises the plasmid containing the DNA encoding the beta-1,4-mannanase of the invention (SEQ ID NO: 27).


[0333]

Bacillus licheniformis
comprises the beta-1,4-mannanase encoding DNA sequence of SEQ ID NO: 29.


[0334]

E. coli
DSM 12852 comprises the plasmid containing the DNA encoding the beta-1,4-mannanase of the invention (SEQ ID NO: 29).


[0335] Bacillus sp. comprises the beta-1,4-mannanase encoding DNA sequence of SEQ ID NO: 31.


[0336]

E. coli
DSM 12436 comprises the plasmid containing the DNA encoding the beta-1,4-mannanase of the invention (SEQ ID NO: 31).


[0337]

E. coli
strain: Cells of E. coli SJ2 (Diderichsen, B., Wedsted, U., Hedegaard, L., Jensen, B. R., Sjøholm, C. (1990) Cloning of aldB, which encodes alpha-acetolactate decarboxylase, an exoenzyme from Bacillus brevis, J. Bacteriol., 172: 4315-4321), were prepared for and transformed by electroporation using a Gene Pulser™ electroporator from BIO-RAD as described by the supplier.


[0338]

B. subtilis
PL2306. This strain is the B. subtilis DN1885 with disrupted apr and npr genes (Diderichsen, B., Wedsted, U., Hedegaard, L., Jensen, B. R., Sjøholm, C., 1990, Cloning of aldB, which encodes alpha-acetolactate decarboxylase, an exoenzyme from Bacillus brevis. J. Bacteriol., 172: 4315-4321) disrupted in the transcriptional unit of the known Bacillus subtilis cellulase gene, resulting in cellulase negative cells. The disruption was performed essentially as described in Eds. A. L. Sonenshein, J. A. Hoch and Richard Losick (1993) Bacillus subtilis and other Gram-Positive Bacteria, American Society for Microbiology, p. 618).


[0339] Competent cells were prepared and transformed as described by Yasbin, R. E., Wilson, G. A. and Young, F. E., 1975, Transformation and transfection in lysogenic strains of Bacillus subtilis: evidence for selective induction of prophage in competent cells. J. Bacteriol., 121: 296-304.


[0340] General Molecular Biology Methods:


[0341] Unless otherwise stated all the DNA manipulations and transformations were performed using standard methods of molecular biology (Sambrook et al. (1989) Molecular cloning: A laboratory manual, Cold Spring Harbor lab., Cold Spring Harbor, N.Y.; Ausubel, F. M. et al. (eds.) “Current protocols in Molecular Biology”. John Wiley and Sons, 1995; Harwood, C. R., and Cutting, S. M. (eds.) “Molecular Biological Methods for Bacillus”. John Wiley and Sons, 1990).


[0342] Enzymes for DNA manipulations were used according to the manufacturer's instructions (e.g., restriction endonucleases, ligases etc. are obtainable from New England Biolabs, Inc.).


[0343] Plasmids


[0344] pSJ1678: (see WO 94/19454).


[0345] pBK-CMV: (Stratagene inc., La Jolla Calif.)


[0346] pMOL944: This plasmid is a pUB110 derivative essentially containing elements making the plasmid propagatable in Bacillus subtilis, kanamycin resistance gene and having a strong promoter and signal peptide cloned from the amyL gene of B. licheniformis ATCC 14580. The signal peptide contains a SaclI site making it convenient to clone the DNA encoding the mature part of a protein in-fusion with the signal peptide. This results in the expression of a Pre-protein which is directed towards the exterior of the cell.


[0347] The plasmid was constructed by means of ordinary genetic engineering and is briefly described in the following.


[0348] Construction of pMOL944:


[0349] The pUB110 plasmid (McKenzie, T. et al., 1986, Plasmid 15: 93-103) was digested with the unique restriction enzyme NciI. A PCR fragment amplified from the amyL promoter encoded on the plasmid pDN1981 (P. L. Jørgensen et al.,1990, Gene, 96: 37-41) was digested with NciI and inserted in the NciI digested pUB110 to give the plasmid pSJ2624.


[0350] The two PCR primers used have the following sequences:
5#LWN5494(SEQ ID NO: 35)5′-GTCGCCGGGGCGGCCGCTATCAATTGGTAACTGTATCTCAGC -3′#LWN5495(SEQ ID NO: 36)5′-GTCGCCCGGGAGCTCTGATCAGGTACCAAGCTTGTCGACCTGCAGAATGAGGCAGCAAGAAGAT -3′


[0351] The primer #LWN5494 inserts a NotI site in the plasmid.


[0352] The plasmid pSJ2624 was then digested with SacI and NotI and a new PCR fragment amplified on amyL promoter encoded on the pDN1981 was digested with SacI and NotI and this DNA fragment was inserted in the SacI-NotI digested pSJ2624 to give the plasmid pSJ2670.


[0353] This cloning replaces the first amyL promoter cloning with the same promoter but in the opposite direction. The two primers used for PCR amplification have the following sequences:
6#LWN5938(SEQ ID NO: 37)5′-GTCGGCGGCCGCTGATCACGTACCAAGCTTGTCGACCTGCAGAATGAGGCAGCAAGAAGAT-3′#LWN5939(SEQ ID NO: 38)5′-GTCGGAGCTCTATCAATTGGTAACTGTATCTCAGC-3′


[0354] The plasmid pSJ2670 was digested with the restriction enzymes PstI and BclI and a PCR fragment amplified from a cloned DNA sequence encoding the alkaline amylase SP722 (WO 95/26397) was digested with PstI and BclI and inserted to give the plasmid pMOL944. The two primers used for PCR amplification have the following sequence:
7#LWN78645′-AACAGCTGATCACGACTGATCTTTTAGCTTGGCAC-3′(SEQ ID NO: 39)#LWN79015′-AACTGCAGCCGCGGCACATCATAATGGGACAAATGGG-3′(SEQ ID NO: 40)     Primer #LWN7901 inserts a SacII site in the plasmid.


[0355] Cultivation of Donor Strains and Isolation of Genomic DNA


[0356] The relevant strain of Bacillus, e.g., Bacillus sp. I633, was grown in TY with pH adjusted to approximately pH 9.7 by the addition of 50 ml of 1 M Sodium-Sesquicarbonat per 500 ml TY. After 24 hours incubation at 30° C. and 300 rpm, the cells were harvested, and genomic DNA was isolated by the method described by Pitcher et al. [Pitcher, D. G., Saunders, N. A., Owen, R. J, Rapid extraction of bacterial genomic DNA with guanidium thiocyanate, Lett. Appl. Microbiol., 1989, 8: 151-156].


[0357] Media


[0358] TY (as described in Ausubel, F. M. et al. (eds.) “Current Protocols in Molecular Biology”. John Wiley and Sons, 1995).


[0359] LB agar (as described in Ausubel, F. M. et al. (eds.) “Current Protocols in Molecular Biology”. John Wiley and Sons, 1995).


[0360] LBPG is LB agar supplemented with 0.5% glucose and 0.05 M potassium phosphate, pH 7.0


[0361] AZCL-galactomannan is added to LBPG-agar to 0.5% AZCL-galactomannan is from Megazyme, Australia.


[0362] BPX media is described in EP 0 506 780 (WO 91/09129).


[0363] NZY agar (per liter) 5 g of NaCl, 2 g of MgSO4, 5 g of yeast extract, 10 g of NZ amine (casein hydrolysate), 15 g of agar; add deionized water to 1 liter, adjust pH with NaOH to pH 7.5 and autoclave


[0364] NZY broth (per liter) 5 g of NaCl, 2 g of MgSO4, 5 g of yeast extract, 10 g of NZ amine (casein hydrolysate); add deionized water to 1 liter, adjust pH with NaOH to pH 7.5 and autoclave


[0365] NZY Top Agar (per liter) 5 g of NaCl, 2 g of MgSO4, 5 g of yeast extract, 10 g of NZ amine (casein hydrolysate), 0.7% (w/v) agarose; add deionized water to 1 liter, adjust pH with NaOH to pH 7.5 and autoclave.


[0366] The following non-limiting examples illustrate the invention.



EXAMPLE 1

[0367] Mannanase Derived from Bacillus sp (I633)


[0368] Construction of a Genomic Library from Bacillus sp. I633 in the LambdaZAPExpress Vector


[0369] Genomic DNA of Bacillus sp. I633 was partially digested with restriction enzyme Sau3A, and size-fractionated by electrophoresis on a 0.7% agarose gel (SeaKem agarose, FMC, USA). Fragments between 1.5 and 10 kb in size were isolated and concentrated to a DNA band by running the DNA fragments backwards on a 1.5% agarose gel followed by extraction of the fragments from the agarose gel slice using the Qiaquick gel extraction kit according to the manufacturer's instructions (Qiagen Inc., USA). To construct a genomic library, ca. 100 ng of purified, fractionated DNA from above was ligated with 1 ug of BamHI-cleaved, dephosphorylated lambdaZAPexpress vector arms (Stratagene, La Jolla Calif., USA) for 24 hours at 4° C. according to the manufacturer's instructions. A 3-ul aliquot of the ligation mixture was packaged directly using the GigaPackIII Gold packaging extract (Stratagene, USA) according to the manufacturer's instructions (Stratagene). The genomic lambdaZAPExpress phage library was titered using the E. coli XL1-Blue MRF-strain from Stratagene (La Jolla, USA). The unamplified genomic library comprised of 3×107 plaque-forming units (pfu) with a vector background of less than 1%.


[0370] Screening for Beta-Mannanase Clones by Functional Expression in lambdaZAPExpress


[0371] Approximately 5000 plaque-forming units (pfu) from the genomic library were plated on NZY-agar plates containing 0.1% AZCL-galactomannan (MegaZyme, Australia, cat. no. I-AZGMA), using E. coli XL1-Blue MRF′ (Stratagene, USA) as a host, followed by incubation of the plates at 37° C. for 24 hours. Mannanase-positive lambda clones were identified by the formation of blue hydrolysis halos around the positive phage clones. These were recovered from the screening plates by coring the TOP-agar slices containing the plaques of interest into 500 ul of SM buffer and 20 ul of chloroform. The mannanase-positive lambdaZAPExpress clones were plaque-purified by plating an aliquot of the cored phage stock on NZY plates containing 0.1% AZCL-galactomannan as above. Single, mannanase-positive lambda clones were cored into 500 ul of SM buffer and 20 ul of chloroform, and purified by one more plating round as described above.


[0372] Single-clone in vivo Excision of the Phagemids from the Mannanase-Positive lambdaZAPExpress Clones


[0373]

E. coli
XL1-Blue cells (Stratagene, La Jolla Calif.) were prepared and resuspended in 10 mM MgSO4 as recommended by Stratagene (La Jolla, USA). Two hundred fifty ul aliquots of the pure phage stocks from the mannanase-positive clones were combined in Falcon 2059 tubes with 200 uls of XL1-Blue MRF′ cells (OD600=1.0) and >106 pfus/ml of the ExAssist M13 helper phage (Stratagene), and the mixtures were incubated at 37° C. for 15 minutes. Three mls of NZY broth was added to each tube and the tubes were incubated at 37C. for 2.5 hours. The tubes were heated at 65° C. for 20 minutes to kill the E. coli cells and bacteriophage lambda; the phagemids being resistant to heating. The tubes were spun at 3000 rpm for 15 minutes to remove cellular debris and the supernatants were decanted into clean Falcon 2059 tubes. Aliquots of the supernatants containing the excised single-stranded phagemids were used to infect 200 uls of E. coli XLOLR cells (Stratagene, OD600=1.0 in 10 mM MgSO4) by incubation at 37° C. for 15 minutes. 350 uls of NZY broth was added to the cells and the tubes were incubated for 45 min at 37° C. Aliquots of the cells were plated onto LB kanamycin agar plates and incubated for 24 hours at 37° C. Five excised single colonies were re-streaked onto LB kanamycin agar plates containing 0.1% AZCL-galactomannan (MegaZyme, Australia). The mannanase-positive phagemid clones were characterized by the formation of blue hydrolysis halos around the positive colonies. These were further analyzed by restriction enzyme digests of the isolated plagemid DNA (QiaSpin kit, Qiagen, USA) with EcoRI, PstI, EcoRI-PstI and HindIII followed by agarose gel electrophoresis.


[0374] Nucleotide Sequence Analysis


[0375] The nucleotide sequence of the genomic beta-1,4-mannanase clone pBXM3 was determined from both strands by the dideoxy chain-termination method (Sanger, F., Nicklen, S., and Coulson, A. R., 1977, Proc. Natl. Acad. Sci. U.S.A., 74: 5463-5467) using 500 ng of Qiagen-purified template (Qiagen, USA), the Taq deoxy-terminal cycle sequencing kit (Perkin-Elmer, USA), fluorescent labeled terminators and 5 pmol of either pBK-CMV polylinker primers (Stratagene, USA) or synthetic oligonucleotide primers. Analysis of the sequence data was performed according to Devereux et al., 1984 (Devereux, J., Haeberli, P., and Smithies, O., 1984, Nucleic Acids Res., 12: 387-395).


[0376] Sequence Alignment


[0377] A multiple sequence alignment of the glycohydrolase family 5 beta-1,4-mannanase from Bacillus sp. I633 of the present invention (i.e., SEQ ID NO: 2), Bacillus circulans (GenBank/EMBL accession no. 066185), Vibrio sp. (acc. no. O69347), Streptomyces lividans (acc. no. P51529), and Caldicellulosiruptor saccharolyticus (acc. no. P22533). The multiple sequence alignment was created using the PileUp program of the GCG Wisconsin software package, version 8.1.; with a gap creation penalty of 3.00 and a gap extension penalty of 0.10.


[0378] Sequence Similarities


[0379] The deduced amino acid sequence of the family 5 beta-1,4-mannanase of the present invention cloned from Bacillus sp. I633 shows 75% similarity and 60.1% sequence identity to the beta-1,4-mannanase of Bacillus circulans (GenBank/EMBL accession no. O66185), 64.4% similarity and 44.6% identity to the beta-1,4-mannanase from Vibrio sp. (acc. no. O69347), 63% similarity and 43.2% identity to the beta-1,4-mannanase from Streptomyces lividans (acc. no. P51529), 52.5% similarity and 34.4% sequence identity to the beta-1,4-mannanase from Caldicellulosiruptor saccharolyticus (acc. no. P2253). The sequences were aligned using the GAP program of the GCG Wisconsin software package, version 8.1.; with a gap creation penalty of 3.00 and a gap extension penalty of 0.10.


[0380] Cloning of Bacillus sp (I633) Mannanase Gene


[0381] A. Subcloning and Expression of a Catalytic Core of a Mannanase in B. subtilis:


[0382] The mannanase encoding DNA sequence of the invention was PCR amplified using the PCR primer set consisting of the following two oligo nucleotides:
8BXM2.upper.SacII5′-GTT GAG AAA GCG GCC GCC TTT TTT CTA TTC TAC AAT CAC ATT ATC-3′(SEQ ID NO: 41)BXM2.core.lower. NotI5′-GAC GAC GTA CAA GCG GCC GCT CAC TAC GGA GAA GTT CCT CCA TCA G-3′(SEQ ID NO: 42)


[0383] Restriction sites SaclI and NotI are underlined.


[0384] Chromosomal DNA isolated from Bacillus sp. I633 as described above was used as template in a PCR reaction using Amplitaq DNA Polymerase (Perkin-Elmer) according to manufacturer's instructions. The PCR reaction was set up in PCR buffer (10 mM Tris-HCl, pH 8.3, 50 mM KCl, 1.5 mM MgCl2, 0.01% (w/v) gelatin) containing 200 micro-M of each dNTP, 2.5 units of AmpliTaq polymerase (Perkin-Elmer, Cetus, USA) and 100 pmol of each primer.


[0385] The PCR reactions were performed using a DNA thermal cycler (Landgraf, Germany). One incubation at 94° C. for 1 min followed by thirty cycles of PCR performed using a cycle profile of denaturation at 94° C. for 30 sec, annealing at 60° C. for 1 min, and extension at 72° C. for 2 min. Five microliter aliquots of the amplification product were analyzed by electrophoresis in 0.7% agarose gels (NuSieve, FMC). The appearance of a DNA fragment size 1.0 kb indicated proper amplification of the gene segment.


[0386] Subcloning of PCR fragment:


[0387] Forty five microliter aliquots of the PCR products generated as described above were purified using QIAquick PCR purification kit (Qiagen, USA) according to the manufacturer's instructions. The purified DNA was eluted in 50 microliters of 10 mM Tris-HCl, pH 8.5. Five micrograms of pMOL944 and twenty five microliters of the purified PCR fragment was digested with SaclI and NotI, electrophoresed in 0.8% low gelling temperature agarose (SeaPlaque GTG, FMC) gels, the relevant fragments were excised from the gels, and purified using QIAquick Gel extraction Kit (Qiagen, USA) according to the manufacturer's instructions. The isolated PCR DNA fragment was then ligated to the SaclI-NotI digested and purified pMOL944. The ligation was performed overnight at 16° C. using 0.5 micrograms of each DNA fragment, 1 U of T4 DNA ligase and T4 ligase buffer (Boehringer Mannheim, Germany).


[0388] The ligation mixture was used to transform competent B. subtilis PL2306. The transformed cells were plated onto LBPG-10 micrograms/ml of kanamycin-agar plates. After 18 hours incubation at 37° C. colonies were seen on plates. Several clones were analyzed by isolating plasmid DNA from overnight culture broth.


[0389] One such positive clone was restreaked several times on agar plates as used above, this clone was called MB748. The clone MB748 was grown overnight in TY-10 micrograms/ml kanamycin at 37° C., and next day 1 ml of cells were used to isolate plasmid from the cells using the Qiaprep Spin Plasmid Miniprep Kit #27106 according to the manufacturer's recommendations for B. subtilis plasmid preparations. This DNA was DNA sequenced and revealed the DNA sequence corresponding to the mature part of the mannanase (corresponding to positions 94-990 of SEQ ID NO: 1 and positions 32-330 of SEQ ID NO: 2) with introduced stop codon replacing the amino acid at position 331 corresponding to the base pair positions 1201-1203 in SEQ ID NO: 1.


[0390] B. Subcloning and Expression of Mature Full Length Mannanase in B. subtilis.


[0391] The mannanase-encoding DNA sequence of the invention was PCR amplified using the PCR primer set consisting of these two oligonucleotides:
9BXM2.upper.SacII5′-CAT TCT GCA GCC GCG GCA AAT TCC GGA TTT TAT GTA AGC GG-3′(SEQ ID NO: 43)BXM2.lower.NotI5′-GTT GAG AAA GCG GCC GCC TTT TTT CTA TTC TAC AAT CAC ATT ATC -3′(SEQ ID NO: 44)


[0392] Restriction Sites SaclI and NotI are Underlined


[0393] Chromosomal DNA isolated from Bacillus sp. (I633) as described above was used as template in a PCR reaction using Amplitaq DNA Polymerase (Perkin-Elmer) according to manufacturer's instructions. The PCR reaction was set up in PCR buffer (10 mM Tris-HCl, pH 8.3, 50 mM KCl, 1.5 mM MgCl2, 0.01% (w/v) gelatin) containing 200 micro-M of each dNTP, 2.5 units of AmpliTaq polymerase (Perkin-Elmer, Cetus, USA) and 100 pmol of each primer.


[0394] The PCR reactions were performed using a DNA thermal cycler (Landgraf, Germany). One incubation at 94° C. for 1 min followed by thirty cycles of PCR performed using a cycle profile of denaturation at 94° C. for 30 sec, annealing at 60° C. for 1 min, and extension at 72° C. or 2 min. Five microliter aliquots of the amplification product was analyzed by electrophoresis in 0.7% agarose gels (NuSieve, FMC). The appearance of a DNA fragment size 1.5 kb indicated proper amplification of the gene segment.


[0395] Subcloning of PCR Fragment:


[0396] Forty five microliter aliquots of the PCR products generated as described above were purified using QIAquick PCR purification kit (Qiagen, USA) according to the manufacturer's instructions. The purified DNA was eluted in 50 microliters of 10 mM Tris-HCl, pH 8.5. 5 micrograms of pMOL944 and twenty five microliters of the purified PCR fragment was digested with SaclI and NotI, electrophoresed in 0.8% low gelling temperature agarose (SeaPlaque GTG, FMC) gels, the relevant fragments were excised from the gels, and purified using QlAquick Gel extraction Kit (Qiagen, USA) according to the manufacturer's instructions. The isolated PCR DNA fragment was then ligated to the SaclI-NotI digested and purified pMOL944. The ligation was performed overnight at 16° C. using 0.5 micrograms of each DNA fragment, 1 U of T4 DNA ligase and T4 ligase buffer (Boehringer Mannheim, Germany).


[0397] The ligation mixture was used to transform competent B. subtilis PL2306. The transformed cells were plated onto LBPG-10 micrograms/ml of Kanamycin-agar plates. After 18 hours incubation at 37° C. colonies were seen on plates. Several clones were analyzed by isolating plasmid DNA from overnight culture broth.


[0398] One such positive clone was restreaked several times on agar plates as used above, this clone was called MB643. The clone MB643 was grown overnight in TY-10 micrograms/ml kanamycin at 37° C., and next day 1 ml of cells were used to isolate plasmid from the cells using the Qiaprep Spin Plasmid Miniprep Kit #27106 according to the manufacturer's recommendations for B. subtilis plasmid preparations. This DNA was sequenced and revealed that the mature mannanase corresponds to amino acids 33-490 of SEQ ID NO: 2, which is encoded by nucleotides 317-1693 of SEQ ID NO: 1.


[0399] The clone MB643 was grown in 25×200 ml BPX media with 10 micrograms/ml of kanamycin in 500 ml two baffled shakeflasks for 5 days at 37° C. at 300 rpm.


[0400] The DNA sequence encoding the C-terminal domain of unknown function from amino acids 341-490 shows high homology to a domain denoted X18 from a known mannanase. This X18 is found in EMBL entry AB007123 from: Yoshida S., Sako Y., Uchida A.: “Cloning, sequence analysis, and expression in Escherichia coli of a gene coding for an enzyme from Bacillus circulans K-1 that degrades guar gum,”Biosci. Biotechnol. Biochem., 1998, 62: 514-520. This gene codes for the signal peptide (amino acids 1-34), the catalytic core of a family 5 mannanase (amino acids 35-335), a linker (amino acids 336-362) and finally the X18 domain of unknown function (amino acids 363-516).


[0401] This X18 domain is also found in Bacillus subtilis beta-mannanase Swiss protein database entry P55278 which discloses a gene coding for a signal peptide (amino acids 1-26), a catalytic core family 26 mannanase (amino acids 27-360) and this X18 protein domain of unknown function (amino acids 361-513); (Cloning and sequencing of beta-mannanase gene from Bacillus subtilis NM-39, Mendoza N S; Arai M; Sugimoto K; Ueda M; Kawaguchi T; Joson L M, Phillippines. In Biochimica Et Biophysica Acta, 1995, 1243(3): 552-554).



EXAMPLE 2


Expression, Purification and Characterization of Mannanase from Bacillus sp. I633

[0402] The clone MB748 obtained as described in Example 1 and under Materials and Methods was grown in 25×200 ml BPX media with 10 micrograms/ml of Kanamycin in 500 ml two baffled shakeflasks for 5 days at 37° C. at 300 rpm.


[0403] 4500 ml of the shake flask culture fluid of the clone MB748 was collected and pH was adjusted to 5.6. 100 ml of cationic agent (10% C521) and 180 ml of anionic agent (A130) was added during agitation for flocculation. The flocculated material was separated by centrifugation using a Sorval RC 3B centrifuge at 9000 rpm for 20 min at 6° C. The supernatant was clarified using Whatman glass filters GF/D and C and finally concentrated on a filtron with a cut off of 10 kDa.


[0404] 700 ml of this concentrate was adjusted to pH 7.5 using sodium hydroxide. The clear solution was applied to anion-exchange chromatography using a 1000 ml Q-Sepharose column equilibrated with 50 mmol Tris pH 7.5. The mannanase activity bound was eluted in 1100 ml using a sodium chloride gradient. This was concentrated to 440 ml using a Filtron membrane. For obtaining highly pure mannanase the concentrate was passed over a Superdex 200column equilibrated with 0.1 M sodium acetate, pH 6.0.


[0405] The pure enzyme gave a single band in SDS-PAGE with a molecular weight of 34 kDa.


[0406] Steady State Kinetic Using Locust Bean Gum:


[0407] The assay was carried out using different amounts of the substrate locust bean gum, incubating for 20 min at 40° C. at pH 10 in 0.1 M glycine buffer, followed by the determination of formation of reducing sugars. Glucose was used as standard for calculation of micromole formation of reducing sugar during steady state.


[0408] The following data was obtained for the highly purified mannanase of the invention:


[0409] KCat of 467 per sec with a standard deviation of 13;


[0410] kM of 0.7 with a standard deviation of 0.07.


[0411] The computer program grafit by Leatherbarrow from Erithacus Software U. K. was used for calculations. Reducing sugar was determined using the PHBAH method (Lever, M., A new reaction for colormetric determination of carbohydrates. Anal. Biochem., 1972 47: 273-279).


[0412] The following N-terminal sequence of the purified protein was determined: ANSGFYVSGTTLYDANG (amino acids 32-48 of SEQ ID NO: 2).


[0413] Stability: The mannanase was fully stable between pH 6.0 and 11 after incubation for 2 days at room temperature. The enzyme precipitated at low pH.


[0414] The pH activity profile shows that the enzyme is more than 60% active between pH 7.5 and pH 10.


[0415] The temperature optimum was found to be 50° C. at pH 10.


[0416] DSC differential scanning calometry gave 66° C. as melting point at pH 6.0 in sodium acetate buffer indicating that this mannanase is thermostable.


[0417] Immunological properties: Rabbit polyclonal monospecific serum was raised against the highly purified cloned mannanase using conventional techniques at the Danish company DAKO. The serum formed a nice single precipitate in agarose gels with the crude non purified mannanase of the invention.



EXAMPLE 3

[0418] Use of the Enzyme of Example 2 in Detergents


[0419] Using commercial detergents instead of buffer and incubation for 20 minutes at 40° C. with 0.2% AZCL-Galactomannan (Megazyme, Australia) from carob degree as described above followed by determination of the formation of blue color, the enzyme obtained as described in Example 2 was active in European powder detergent Ariel Futur with 60% relative activity, European liquid detergent Ariel Futur with 80% relative activity, in US Tide powder with 45% relative activity and in US Tide liquid detergent with 37% relative activity to the activity measured in Glycine buffer. In these tests, the detergent concentration was as recommended on the commercial detergent packages and the wash water was tap water having 18 degrees German hardness under European (Ariel Futur) conditions and 9 degree under US conditions (US Tide).



EXAMPLE 4

[0420] Construction and Expression of Fusion Protein Between the Mannanase of Bacillus sp. I633 (Examples 1 and 2) and a Cellulose Binding Domain (CBD)


[0421] The CBD encoding DNA sequence of the CipB gene from Clostridium thermocellum strain YS (Poole D M; Morag E; Lamed R; Bayer E A; Hazlewood G P; Gilbert H J, Identification of the cellulose-binding domain of the cellulosome subunit S1 from Clostridium thermocellum YS, FEMS Microbiology Letters, 1992, 78(2-3): 181-186) had previously been introduced to a vector pMOL1578. Chromosomal DNA encoding the CBD can be obtained as described in Poole D M; Morag E; Lamed R; Bayer E A; Hazlewood G P Gilbert H J, Identification of the cellulose-binding domain of the cellulosome subunit S1 from Clostridium thermocellum YS, FEMS Microbiology Letters, 1992, 78(2-3): 181-186. A DNA sample encoding the CBD was used as template in a PCR and the CBD was cloned in an apprpopriate plasmid pMB993 based on the pMOL944 vector.


[0422] The pMB993 vector contains the CipB CBD with a peptide linker preceeding the CBD. The linker consists of the following peptide sequence ASPEPTPEPT (SEQ ID NO: 49) and is directly followed by the CipB CBD. The AS aminoacids are derived from the DNA sequence that constitute the restriction endonuclease site NheI, which in the following is used to clone the mannanse of the invention.
10Mannanase.Upper.SacII5′-CAT TCT GCA GCC GCG GCA AAT TCC GGA TTT TAT GTA AGC GG -3′(SEQ ID NO: 45)Mannanase. Lower. NheI5′-CAT CAT GCT AGC TGT AAA AAC GGT GCT TAA TCT CG -3′(SEQ ID NO: 46)


[0423] Restriction Sites NheI and SaclI Are Underlined.


[0424] Chromosomal DNA isolated from Bacillus sp. I633 as described above was used as template in a PCR reaction using Amplitaq DNA Polymerase (Perkin Elmer) according to manufacturer's instructions. The PCR reaction was set up in PCR buffer (10 mM Tris-HCl, pH 8.3, 50 mM KCl, 1.5 mM MgCl2, 0.01% (w/v) gelatin) containing 200 micro-M of each dNTP, 2.5 units of AmpliTaq polymerase (Perkin-Elmer, Cetus, USA) and 100 pmol of each primer.


[0425] The PCR reactions were performed using a DNA thermal cycler (Landgraf, Germany). One incubation at 94° C. for 1 min followed by thirty cycles of PCR performed using a cycle profile of denaturation at 94° C. for 30 sec, annealing at 60° C. for 1 min, and extension at 72° C. for 2 min. Five microliter aliquots of the amplification product was analyzed by electrophoresis in 0.7% agarose gels (NuSieve, FMC). The appearance of a DNA fragment size 0.9 kb indicated proper amplification of the gene segment.


[0426] Subcloning of PCR Fragment:


[0427] Forty five microliter aliquots of the PCR products generated as described above were purified using QIAquick PCR purification kit (Qiagen, USA) according to the manufacturer's instructions. The purified DNA was eluted in 50 microliters of 10 mM Tris-HCl, pH 8.5. Five micrograms of pMB993 and twenty five microliters of the purified PCR fragment was digested with SaclI and NheI, electrophoresed in 0.7% low gelling temperature agarose (SeaPlaque GTG, FMC) gels, the relevant fragments were excised from the gels, and purified using QIAquick Gel extraction Kit (Qiagen, USA) according to the manufacturer's instructions. The isolated PCR DNA fragment was then ligated to the SaclI-NheI digested and purified pMB993. The ligation was performed overnight at 16° C. using 0.5 micrograms of each DNA fragment, 1 U of T4 DNA ligase and T4 ligase buffer (Boeh ringer Mannheim, Germany).


[0428] The ligation mixture was used to transform competent B. subtilis PL2306. The transformed cells were plated onto LBPG-10 micrograms/ml of kanamycin-agar plates. After 18 hours incubation at 37° C., colonies were seen on plates. Several clones were analyzed by isolating plasmid DNA from overnight culture broth.


[0429] One such positive clone was restreaked several times on agar plates as used above, this clone was called MB1014. The clone MB1014 was grown overnight in TY-10 micrograms/ml kanamycin at 37° C., and next day 1 ml of cells were used to isolate plasmid from the cells using the Qiaprep Spin Plasmid Miniprep Kit #27106 according to the manufacturer's recommendations for B. subtilis plasmid preparations. This DNA was sequenced and revealed the DNA sequence encoding the mature mannanase-linker-cbd as represented in SEQ ID NOS: 3and 4.


[0430] Thus, the final construction contains the following expression relevant elements: (amyL-promoter)-(amyL-signal peptide)-mannanase-linker-CBD.


[0431] Expression and Detection of Mannanase-CBD Fusion Protein


[0432] MB1014 was incubated for 20 hours in TY-medium at 37° C. and 250 rpm. 1 ml of cell-free supernatant was mixed with 200 microliters of 10% Avicel (Merck, Darmstadt, Germany) in Millipore H2O. The mixture was left for ½ hour incubation at 0° C. After this binding of BXM2-Linker-CBD fusion protein to Avicel the Avicel with bound protein was spun 5 min at 5000 g. The pellet was resuspended in 100 microliters of SDS-page buffer, boiled at 95° C. for 5 min, spun at 5000 g for 5 min and 25 microliters was loaded on a 4-20% Laemmli Tris-Glycine, SDS-PAGE NOVEX gel (Novex, USA). The samples were electrophoresed in a Xcell™ Mini-Cell (NOVEX, USA) as recommended by the manufacturer, all subsequent handling of gels including staining with comassie, destaining and drying were performed as described by the manufacturer.


[0433] The appearance of a protein band of approx. 53 kDa, verified the expression in B. subtilis of the full length mannanase-linker-CBD fusion encoded on the plasmid pMB1014.



EXAMPLE 5

[0434] Mannanase Derived from Bacillus agaradhaerens


[0435] Cloning of the Mannanase Gene from Bacillus agaradherens


[0436] Genomic DNA Preparation


[0437]

Bacillus agaradherens
NCIMB 40482 was propagated in liquid medium as described in WO 94/01532. After 16 hours incubation at 30° C. and 300 rpm, the cells were harvested, and genomic DNA isolated by the method described by Pitcher et al. (Pitcher, D. G., Saunders, N. A., Owen, R. J., Rapid extraction of bacterial genomic DNA with guanidium thiocyanate, 1989, Lett. Appl. Microbiol., 8: 151-156).


[0438] Genomic Library Construction


[0439] Genomic DNA was partially digested with restriction enzyme Sau3A, and size-fractioned by electrophoresis on a 0.7% agarose gel. Fragments between 2 and 7 kb in size was isolated by electrophoresis onto DEAE-cellulose paper (Dretzen, G., Bellard, M., Sassone-Corsi, P., Chambon, P. (1981) A reliable method for the recovery of DNA fragments from agarose and acrylamide gels. Anal. Biochem., 112, 295-298).


[0440] Isolated DNA fragments were ligated to BamHI digested pSJ1678 plasmid DNA, and the ligation mixture was used to transform E. coli SJ2.


[0441] Identification of Positive Clones


[0442] A DNA library in E. coli, constructed as described above, was screened on LB agar plates containing 0.2% AZCL-galactomannan (Megazyme) and 9 micrograms/ml chloramphenicol and incubated overnight at 37° C. Clones expressing mannanase activity appeared with blue diffusion halos. Plasmid DNA from one of these clones was isolated by Qiagen plasmid spin preps on 1 ml of overnight culture broth (cells incubated at 37° C. in TY with 9 micrograms/ml chloramphenicol and shaking at 250 rpm).


[0443] This clone (MB525) was further characterized by DNA sequencing of the cloned Sau3A DNA fragment. DNA sequencing was carried out by primerwalking, using the Taq deoxy-terminal cycle sequencing kit (Perkin-Elmer, USA), fluorescent labelled terminators and appropriate oligonucleotides as primers.


[0444] Analysis of the sequence data was performed according to Devereux et al., 1984, Nucleic Acids Res., 12: 387-395. The DNA sequence encoding a mannanase is set forth in SEQ ID NO: 5 and the deduced amino acid sequence is set forth in SEQ ID NO: 6.


[0445] Subcloning and Expression of B. agaradhaeren Mannanase in B. subtilis


[0446] The mannanase encoding DNA sequence of the invention was PCR amplified using the PCR primer set consisting of these two oligo nucleotides:
11Mannanase.upper.SacII5′-CAT TCT GCA GCC GCG GCA GCA AGT ACA GGC TTT TAT GTT GAT GG-3′(SEQ ID NO: 47)Mannanase.lower.NotI5′-GAC GAG GTA CAA GCG GCC GCG CTA TTT CCC TAA CAT GAT GAT ATT TTC G -3′(SEQ ID NO: 48)


[0447] Restriction Sites SaclI and NotII are underlined.


[0448] Chromosomal DNA isolated from B. agaradherens NCIMB 40482 as described above was used as template in a PCR reaction using Amplitaq DNA Polymerase (Perkin Elmer) according to manufacturer's instructions. The PCR reaction was set up in PCR buffer (10 mM Tris-HCl, pH 8.3, 50 mM KCl, 1.5 mM MgCl2, 0.01% (w/v) gelatin) containing 200 micro-M of each dNTP, 2.5 units of AmpliTaq polymerase (Perkin-Elmer, Cetus, USA) and 100 pmol of each primer.


[0449] The PCR reaction was performed using a DNA thermal cycler (Landgraf, Germany). One incubation at 94° C. for 1 min followed by thirty cycles of PCR performed using a cycle profile of denaturation at 94° C. for 30 sec, annealing at 60° C. for 1 min, and extension at 72° C. for 2 min. Five microliter aliquots of the amplification product was analyzed by electrophoresis in 0.7% agarose gels (NuSieve, FMC). The appearance of a DNA fragment size 1.4 kb indicated proper amplification of the gene segment.


[0450] Subcloning of PCR Fragment


[0451] Forty five microliter aliquots of the PCR products generated as described above were purified using QIAquick PCR purification kit (Qiagen, USA) according to the manufacturer's instructions. The purified DNA was eluted in 50 microliters of 10 mM Tris-HCl, pH 8.5. Five micrograms of pMOL944 and twenty five microliters of the purified PCR fragment was digested with SaclI and NotI, electrophoresed in 0.8% low gelling temperature agarose (SeaPlaque GTG, FMC) gels, the relevant fragments were excised from the gels, and purified using QIAquick Gel extraction Kit (Qiagen, USA) according to the manufacturer's instructions. The isolated PCR DNA fragment was then ligated to the SaclI-NotI digested and purified pMOL944. The ligation was performed overnight at 16° C. using 0.5 micrograms of each DNA fragment, 1 U of T4 DNA ligase and T4 ligase buffer (Boehringer Mannheim, Germany).


[0452] The ligation mixture was used to transform competent B. subtilis PL2306. The transformed cells were plated onto LBPG-10 micrograms/ml of kanamycin plates. After 18 hours incubation at 37° C. colonies were seen on plates. Several clones were analyzed by isolating plasmid DNA from overnight culture broth.


[0453] One such positive clone was restreaked several times on agar plates as used above, this clone was called MB594. The clone MB594 was grown overnight in TY-10 micrograms/ml kanamycin at 37° C., and next day 1 ml of cells were used to isolate plasmid from the cells using the Qiaprep Spin Plasmid Miniprep Kit #27106 according to the manufacturer's recommendations for B. subtilis plasmid preparations. This DNA was sequenced, which revealed that the mature mannanase is encoded by nucleotides 94-1404 of SEQ ID NO: 7. The deduced amino acid sequence is set forth in SEQ ID NO: 8. It will appear that the 3′ end of the mannanase encoded by the sequence of SEQ ID NO: 5 was changed to the one shown in SEQ ID NO: 7 due to the design of the lower primer used in the PCR. The resulting amino acid sequence is set forth in SEQ ID NO: 8 and it is apparent that the C-terminus of SEQ ID NO: 6 (SHHVREIGVQFSMDNSSGQTALYVDNVTLR (amino acids 463-493)) is changed to the C-terminus of SEQ ID NO: 8 (IIMLGK (amino acids 463-468)).



EXAMPLE 6


Expression, Purification and Characterization of Mannanase from Bacillus agaradhaerens

[0454] The clone MB 594 obtained as described in Example 5 was grown in 25×200 ml BPX media with 10 micrograms/ml of kanamycin in 500 ml two baffled shakeflasks for 5 days at 37° C. at 300 rpm.


[0455] 6500 ml of the shake flask culture fluid of the clone MB 594 (batch #9813) was collected and pH adjusted to 5.5. 146 ml of cationic agent (C521) and 292 ml of anionic agent (A130) was added during agitation for flocculation. The flocculated material was separated by centrifugation using a Sorval RC 3B centrifuge at 9000 rpm for 20 min at 6° C. The supernatant was clarified using Whatman glass filters GF/D and C and finally concentrated on a filtron with a cut off of 10 kDa.


[0456] 750 ml of this concentrate was adjusted to pH 7.5 using sodium hydroxide. The clear solution was applied to anion-exchange chromatography using a 900 ml Q-Sepharose column equilibrated with 50 mmol Tris pH 7.5. The mannanase activity bound was eluted using a sodium chloride gradient.


[0457] The pure enzyme gave a single band in SDS-PAGE with a molecular weight of 38 kDa.


[0458] The amino acid sequence of the mannanase, i.e. the translated DNA sequence, is shown in SEQ ID NO: 6.


[0459] Determination of kinetic constants:


[0460] Substrate: Locust bean gum (carob) and reducing sugar analysis (PHBAH). Locust bean gum from Sigma (G-0753).


[0461] Kinetic determination using different concentrations of locust bean gum and incubation for 20 min at 40° C. at pH 10 gave


[0462] Kcat: 467 per sec.


[0463] Km: 0.08 gram per I


[0464] MW: 38 kDa


[0465] pI (isoelectric point): 4.2


[0466] The temperature optimum of the mannanase was found to be 60° C.


[0467] The pH activity profile showed maximum activity between pH 8 and 10.


[0468] DSC differential scanning calometry gives 77° C. as melting point at pH 7.5 in Tris buffer indicating that this enzyme is very thermostable.


[0469] Detergent compatibility using 0.2% AZCL-Galactomannan from carob as substrate and incubation as described above at 40° C. shows excellent compability with conventional liquid detergents and good compability with conventional powder detergents.



EXAMPLE 7

[0470] Use of the Enzyme of the Invention in Detergents


[0471] The purified enzyme obtained as described in Example 6 (batch #9813) showed improved cleaning performance when tested at a level of 1 ppm in a miniwash test using a conventional commercial liquid detergent. The test was carried out under conventional North American wash conditions.



EXAMPLE 8

[0472] Mannanase Derived from Bacillus sp. AAI12


[0473] Construction of a Genomic LLibrary from Bacillus sp. AAI12


[0474] Genomic DNA of Bacillus sp. was partially digested with restriction enzyme Sau3A, and size-fractionated by electrophoresis on a 0.7% agarose gel (SeaKem agarose, FMC, USA). Fragments between 1.5 and 10 kb in size were isolated and concentrated to a DNA band by running the DNA fragments backwards on a 1.5% agarose gel followed by extraction of the fragments from the agarose gel slice using the Qiaquick gel extraction kit according to the manufacturer's instructions (Qiagen Inc., USA). To construct a genomic library, ca. 100 ng of purified, fractionated DNA from above was ligated with 1 ug of BamHI-cleaved, dephosphorylated lambdaZAPexpress vector arms (Stratagene, La Jolla Calif., USA) for 24 hours at 4° C. according to the manufacturer's instructions. A 3-ul aliquot of the ligation mixture was packaged directly using the GigaPackIII Gold packaging extract (Stratagene, USA) according to the manufacturer's instructions (Stratagene). The genomic lambdaZAPExpress phage library was titered using the E. coli XL1-Blue MRF-strain from Stratagene (La Jolla, USA). The unamplified genomic library comprised of 7.8×107 plaque-forming units (pfu) with a vector background of less than 1%.


[0475] Screening for Beta-Mannanase Clones by Functional Expression in lambdaZAPExpress


[0476] Approximately 5000 plaque-forming units (pfu) from the genomic library were plated on NZY-agar plates containing 0.1% AZCL-galactomannan (MegaZyme, Australia, cat. no. I-AZGMA), using E. coli XL1-Blue MRF′ (Stratagene, USA) as a host, followed by incubation of the plates at 37° C. for 24 hours. Mannanase-positive lambda clones were identified by the formation of blue hydrolysis halos around the positive phage clones. These were recovered from the screening plates by coring the TOP-agar slices containing the plaques of interest into 500 ul of SM buffer and 20 ul of chloroform. The mannanase-positive lambdaZAPExpress clones were plaque-purified by plating an aliquot of the cored phage stock on NZY plates containing 0.1% AZCL-galactomannan as above. Single, mannanase-positive lambda clones were cored into 500 ul of SM buffer and 20 ul of chloroform, and purified by one more plating round as described above.


[0477] Single-Clone in vivo Excision of the Phagemids from the Mannanase-Positive lambdaZAPExpress Clones


[0478]

E. coli
XL1-Blue cells (Stratagene, La Jolla Calif.) were prepared and resuspended in 10 mM MgSO4 as recommended by Stratagene (La Jolla, USA). 250-ul aliquots of the pure phage stocks from the mannanase-positive clones were combined in Falcon 2059 tubes with 200 uls of XL1-Blue MRF′ cells (OD600=1.0) and >106 pfus/ml of the ExAssist M13 helper phage (Stratagene), and the mixtures were incubated at 37° C. for 15 minutes. Three mis of NZY broth was added to each tube and the tubes were incubated at 37° C. for 2.5 hours. The tubes were heated at 65° C. for 20 minutes to kill the E. coli cells and bacteriophage lambda; the phagemids being resistant to heating. The tubes were spun at 3000 rpm for 15 minutes to remove cellular debris and the supernatants were decanted into clean Falcon 2059 tubes. Aliquots of the supernatants containing the excised single-stranded phagemids were used to infect 200 uls of E. coli XLOLR cells (Stratagene, OD600=1.0 in 10 mM MgSO4) by incubation at 37° C. for 15 minutes. 350 uls of NZY broth was added to the cells and the tubes were incubated for 45 min at 37° C. Aliquots of the cells were plated onto LB kanamycin agar plates and incubated for 24 hours at 37° C. Five excised single colonies were re-streaked onto LB kanamycin agar plates containing 0.1% AZCL-galactomannan (MegaZyme, Australia). The mannanase-positive phagemid clones were characterized by the formation of blue hydrolysis halos around the positive colonies. These were further analyzed by restriction enzyme digests of the isolated plagemid DNA (QiaSpin kit, Qiagen, USA) with EcoRI, PstI, EcoRI-PstI, and HindIII followed by agarose gel electrophoresis.


[0479] Nucleotide Sequence Analysis


[0480] The nucleotide sequence of the genomic beta-1,4-mannanase clone pBXM1 was determined from both strands by the dideoxy chain-termination method (Sanger, F., Nicklen, S., and Coulson, A. R., 1977, Proc. Natl. Acad. Sci. U.S.A., 74: 5463-5467) using 500 ng of Qiagen-purified template (Qiagen, USA), the Taq deoxy-terminal cycle sequencing kit (Perkin-Elmer, USA), fluorescent labeled terminators and 5 pmol of either pBK-CMV polylinker primers (Stratagene, USA) or synthetic oligonucleotide primers. Analysis of. the sequence data was performed according to Devereux et al., 1984 (Devereux, J., Haeberli, P., and Smithies, O., 1984, Nucleic Acids Res. 12: 387-395).


[0481] Sequence Alignment


[0482] A multiple sequence alignment of the glycohydrolase family 26 beta-1,4-mannanases from Bacillus sp. AAI 12 of the present invention (i.e., SEQ ID NO: 10), Caldicellulosiruptor saccharolyticus (GenBank/EMBL accession no. P77847), Dictyoglomus thermophilum (acc. no. O30654), Rhodothermus marinus (acc. no. P49425), Piromyces sp. encoded by ManA (acc. no. P55296), Bacillus sp. (acc. no. P91007), Bacillus subtilis (acc. no. O05512) and Pseudomonas fluorescens (acc. no P49424. was created using the PileUp program of the GCG Wisconsin software package, version 8.1. (see above); with a gap creation penalty of 3.00 and a gap extension penalty of 0.10.


[0483] Sequence Similarities


[0484] The deduced amino acid sequence of the family 26 beta-1,4-mannanase of the invention cloned from Bacillus sp. AAI 12 shows 45% sequence similarity and 19.8% sequence identity to the beta-1,4-mannanase from Caldicellulosiruptor saccharolyticus (GenBank/EMBL accession no. P77847), 49% similarity and 25.1% identity to the beta-1,4-mannanase from Dictyoglomus thermophilum (acc. no. O30654), 48.2% similarity and 26.8% identity to the beta-1,4-mannanase from Rhodothermus marinus (acc. no. P49425), 46% similarity and 19.5% sequence identity to the ManA-encoded beta-1,4-mannanase from Piromyces sp. (acc. no. P55296), 47.2% similarity and 22% identity to the beta-1,4-mannanase from Bacillus sp. (acc. no. P91007), 52.4% similarity and 27.5% sequence identity to the beta-1,4-mannanase from Bacillus subtilis (acc. no. O05512) and 60.6% similarity and 37.4% identity to the beta-1,4-mannanase from Pseudomonas fluorescens (acc. no P49424). The sequences were aligned using the GAP program of the GCG Wisconsin software package, version 8.1.; with gap creation penalty of 3.00 and gap extension penalty of 0.10.


[0485] Cloning of the Bacillus sp (AAI 12) Mannanase Gene


[0486] Subcloning and Expression of Mannanase in B. subtilis


[0487] The mannanase encoding DNA sequence of the invention was PCR amplified using the
12PCR primer set consisting of these two oligo nucleotides:      BXM1.upper.SacII5′-CAT TCT GCA GCC GCG GCA TTT TCT GGA AGC GTT TCA GC-3′(SEQ ID NO: 50)      BXM1.lower.NotI5′-CAG CAG TAG CGG CCG CCA CTT CCT GCT GGT ACA TAT GC -3′(SEQ ID NO: 51)      Restriction sites SacII and NotI are underlined.


[0488] Chromosomal DNA isolated from Bacillus sp. AAI 12 as described above was used as template in a PCR reaction using Amplitaq DNA Polymerase (Perkin Elmer) according to manufacturer's instructions. The PCR reaction was set up in PCR buffer (10 mM Tris-HCl, pH 8.3, 50 mM KCl, 1.5 mM MgCl2, 0.01% (w/v) gelatin) containing 200 micro-M of each dNTP, 2.5 units of AmpliTaq polymerase (Perkin-Elmer, Cetus, USA) and 100 pmol of each primer.


[0489] The PCR reactions were performed using a DNA thermal cycler (Landgraf, Germany). One incubation at 94° C. for 1 min followed by thirty cycles of PCR performed using a cycle profile of denaturation at 94° C. for 30 sec, annealing at 60° C. for 1 min, and extension at 72° C. for 2 min. Five microliter aliquots of the amplification product was analyzed by electrophoresis in 0.7% agarose gels (NuSieve, FMC). The appearance of a DNA fragment size 1.0 kb indicated proper amplification of the gene segment.


[0490] Subcloning of PCR Fragment


[0491] Forty five microliter aliquots of the PCR products generated as described above were purified using QIAquick PCR purification kit (Qiagen, USA) according to the manufacturer's instructions. The purified DNA was eluted in 50 microliters of 10 mM Tris-HCl, pH 8.5. Five micrograms of pMOL944 and twenty five microliters of the purified PCR fragment was digested with SaclI and NotI, electrophoresed in 0.8% low gelling temperature agarose (SeaPlaque GTG, FMC) gels, the relevant fragments were excised from the gels, and purified using QIAquick Gel extraction Kit (Qiagen, USA) according to the manufacturer's instructions. The isolated PCR DNA fragment was then ligated to the SaclI-NotI digested and purified pMOL944. The ligation was performed overnight at 16° C. using 0.5 micrograms of each DNA fragment, 1 U of T4 DNA ligase and T4 ligase buffer (Boehringer Mannheim, Germany).


[0492] The ligation mixture was used to transform competent B. subtilis PL2306. The transformed cells were plated onto LBPG-10 micrograms/ml of kanamycin-agar plates. After 18 hours incubation at 37° C. colonies were seen on plates. Several clones were analyzed by isolating plasmid DNA from overnight culture broth.


[0493] One such positive clone was restreaked several times on agar plates as used above, this clone was called MB747. The clone MB747 was grown overnight in TY-10 micrograms/ml kanamycin at 37° C., and next day 1 ml of cells were used to isolate plasmid from the cells using the Qiaprep Spin Plasmid Miniprep Kit #27106 according to the manufacturer's recommendations for B. subtilis plasmid preparations. This DNA was sequenced and revealed the DNA sequence corresponding to the mature mannanase in SEQ ID NO: 9.


[0494] Expression, Purification and Characterization of Mannanase from Bacillus sp. AAI 12


[0495] The clone MB747 obtained as described above was grown in 25×200 ml BPX media with 10 micrograms/ml of kanamycin in 500 ml two baffled shakeflasks for 5 days at 37° C. at 300 rpm.


[0496] 4100 ml of the shake flask culture fluid of the clone MB747 was collected, pH was adjusted to 7.0, and EDTA was added to a final concentration of 2 mM. 185 ml of cationic agent (10% C521) and 370 ml of anionic agent (A130) was added during agitation for flocculation. The flocculated material was separated by centrifugation using a Sorval RC 3B centrifuge at 9000 rpm for 20 min at 6° C. The supernatant was clarified using Whatman glass filters GF/D and C and finally concentrated on a filtron with a cut off of 10 kDa.


[0497] 1500 ml of this concentrate was adjusted to pH 7.5 using sodium hydroxide. The clear solution was applied to anion-exchange chromatography using a 1000 ml Q-Sepharose column equilibrated with 25 mmol Tris pH 7.5. The mannanase activity bound was eluted in 1100 ml using a sodium chloride gradient. This was concentrated to 440 ml using a Filtron membrane. For obtaining highly pure mannanase the concentrate was passed over a Superdex column equilibrated with 0.1 M sodium acetate, pH 6.0.


[0498] The pure enzyme gave a single band in SDS-PAGE with a molecular weight of 62 kDa.


[0499] The amino acid sequence of the mannanase, i.e., the translated DNA sequence, is shown in SEQ ID NO: 10.


[0500] The following N-terminal sequence was determined: FSGSVSASGQELKMTDQN (amino acids 25-42 of SEQ ID NO: 10).


[0501] pI (isoelectric point): 4.5


[0502] DSC differential scanning calometry gave 64° C. as melting point at pH 6.0 in sodium acetate buffer indicating that this mannanase is thermostable.


[0503] It was found that the catalytic activity increases with ionic strength indicating that the specific activity of the enzyme may be increased by using salt of phosphate buffer with high ionic strength.


[0504] The mannanase activity of the polypeptide of the invention is inhibited by calcium ions.


[0505] Immunological properties: Rabbit polyclonal monospecific serum was raised against the highly purified mannanase of the invention using conventional techniques at the Danish company DAKO. The serum formed a nice single precipitate in agarose gels with the crude mannanase of the invention.



EXAMPLE 9

[0506] Use of the Enzyme of Example 8 in Detergents


[0507] Using commercial detergents instead of buffer and incubation for 20 minutes at 40° C. with 0.2% AZCL-Galactomannan (Megazyme, Australia) from carob degree as described above followed by determination of the formation of blue color, the enzyme obtained as described in Example 8 was active in European powder detergent Ariel Futur with 132% relative activity, in US Tide powder with 108% relative activity and in US Tide liquid detergent with 86% relative activity to the activity measured in glycine buffer. In these tests, the detergent concentration was used according to the recommendations provided on the commercial detergent packages and the wash water was tap water having 18 degrees German hardness under European (Ariel Futur) conditions and 9 degree under US conditions (US Tide).



EXAMPLE 10


Mannanase Derived from Bacillus halodurans

[0508] Construction of a Genomic Library from Bacillus halodurans in the pSJ1678 Vector


[0509] Genomic DNA of Bacillus halodurans was partially digested with restriction enzyme Sau3A, and size-fractionated by electrophoresis on a 0.7% agarose gel (SeaKem agarose, FMC, USA). DNA fragments between 2 and 10 kb in size was isolated by electrophoresis onto DEAE-cellulose paper (Dretzen, G., Bellard, M., Sassone-Corsi, P., Chambon, P., 1981, A reliable method for the recovery of DNA fragments from agarose and acrylamide gels. Anal. Biochem., 112: 295-298). Isolated DNA fragments were ligated to BamHI-digested pSJ1678 plasmid DNA, and the ligation mixture was used to transform E. coli SJ2.


[0510] Screening for Beta-Mannanase Clones by Functional Expression in Escherichia coli


[0511] Approximately 10.000 colony-forming units (cfu) from the genomic library were plated on LB-agar plates containing containing 9 micrograms/ml chloramphenicol and 0.1% AZCL-galactomannan (MegaZyme, Australia, cat. no. I-AZGMA), using E. coli SJ2 as a host, followed by incubation of the plates at 37° C. for 24 hours. Mannanase-positive E. coli colonies were identified by the formation of blue hydrolysis halos around the positive plasmid clones. The mannanase-positive clones in pSJ1678 were colony-purified by re-streaking the isolated colonies on LB plates containing 9 micrograms/ml chloramphenicol and 0.1% AZCL-galactomannan as above. Single, mannanase-positive plasmid clones were inoculated into 5 ml of LB medium containing containing 9 micrograms/ml Chloramphenicol, for purification of the plasmid DNA.


[0512] Nucleotide Sequence Analysis


[0513] The nucleotide sequence of the genomic beta-1,4-mannanase clone pBXM5 was determined from both strands by the dideoxy chain-termination method (Sanger, F., Nicklen, S., and Coulson, A. R., 1977, Proc. Natl. Acad. Sci. U.S.A. 74: 5463-5467) using 500 ng of Qiagen-purified template (Qiagen, USA), the Taq deoxy-terminal cycle sequencing kit (Perkin-Elmer, USA), fluorescent labeled terminators and 5 pmol of either pBK-CMV polylinker primers (Stratagene, USA) or synthetic oligonucleotide primers. Analysis of the sequence data was performed according to Devereux et al., 1984 (Devereux, J., Haeberli, P., and Smithies, O., 1984, Nucleic Acids Res., 12: 387-395).


[0514] Sequence Alignment


[0515] A multiple sequence alignment of the glycohydrolase family 5 beta-1,4-mannanase from Bacillus halodurans of the present invention (i.e., SEQ ID NO: 12), Bacillus circulans (GenBank/EMBL accession no. 066185), Vibrio sp. (acc. no. O69347), Streptomyces lividans (acc. no. P51529), and Caldicellulosiruptor saccharolyticus (acc. no. P22533). The multiple sequence alignment was created using the PileUp program of the GCG Wisconsin software package, version 8.1.; with a gap creation penalty of 3.00 and a gap extension penalty of 0.10.


[0516] Sequence Similarities


[0517] The deduced amino acid sequence of the family 5 beta-1,4-mannanase of the present invention cloned from Bacillus halodurans shows 77% similarity and 60% sequence identity to the beta-1,4-mannanase of Bacillus circulans (GenBank/EMBL accession no. O66185), 64.2% similarity and 46% identity to the beta-1,4-mannanase from Vibrio sp. (acc. no. O69347), 63% similarity and 41.8% identity to the beta-1,4-mannanase from Streptomyces lividans (acc. no. P51529), 60.3% similarity and 42% sequence identity to the beta-1,4-mannanase from Caldicellulosiruptor saccharolyticus (acc. no. P2253). The sequences were aligned using the GAP program of the GCG Wisconsin software package, version 8.1.; with a gap creation penalty of 3.00 and a gap extension penalty of 0.10.


[0518] Cloning of Bacillus halodurans Mannanase Gene


[0519] Subcloning and Expression of Mature Full Length Mannanase in B. subtilis


[0520] The mannanase encoding DNA sequence of the invention was PCR amplified using the PCR primer set consisting of these two oligo nucleotides:


[0521] BXM5.upper.SaclI


[0522] 5′CAT TCT GCA GCC GCG GCA CAT CAC AGT GGG TTC CAT G-3′(SEQ ID NO: 52)


[0523] BXM5.lower.NotI


[0524] 5′GCG TTG AGA CGC GCG GCC GCT TAT TGA AAC ACA CTG CTT CTT TTA G-3′ (SEQ ID NO: 53)


[0525] Restriction Sites SaclI and NotI are Underlined


[0526] Chromosomal DNA isolated from Bacillus halodurans as described above was used as template in a PCR reaction using Amplitaq DNA Polymerase (Perkin Elmer) according to manufacturer's instructions. The PCR reaction was set up in PCR buffer (10 mM Tris-HCl, pH 8.3, 50 mM KCl, 1.5 mM MgCl2, 0.01% (w/v) gelatin) containing 200 micro-M of each dNTP, 2.5 units of AmpliTaq polymerase (Perkin-Elmer, Cetus, USA) and 100 pmol of each primer.


[0527] The PCR reactions were performed using a DNA thermal cycler (Landgraf, Germany). One incubation at 94° C. for 1 min followed by thirty cycles of PCR performed using a cycle profile of denaturation at 94° C for 30 sec, annealing at 60° C. for 1 min, and extension at 72° C. for 2 min. Five microliter aliquots of the amplification product was analyzed by electrophoresis in 0.7% agarose gels (NuSieve, FMC). The appearance of a DNA fragment size 0.9 kb indicated proper amplification of the gene segment.


[0528] Subcloning of PCR Fragment:


[0529] Forty five microliter aliquots of the PCR products generated as described above were purified using QIA-quick PCR purification kit (Qiagen, USA) according to the manufacturer's instructions. The purified D-NA was eluted in 50 microliters of 10 mM Tris-HCl, pH 8.5. Five micrograms of pMOL944 and twenty five microliters of the purified PCR fragment was digested with SaclI and NotI, electrophoresed in 0.8% low gelling temperature agarose (SeaPla-que GTG, FMC) gels, the relevant fragments were excised from the gels, and purified using QIA-quick Gel extraction Kit (Qiagen, USA) according to the manufacturer's instructions. The isolated PCR DNA fragment was then ligated to the SaclI-NotI digested and purified pMOL944. The ligation was performed overnight at 16° C. using 0.5 micrograms of each DNA fragment, 1 U of T4 DNA ligase and T4 ligase buffer (Boehringer Mannheim, Germany).


[0530] The ligation mixture was used to transform competent B. subtilis PL2306. The transformed cells were plated onto LBPG-10 micrograms/ml of kanamycin-agar plates. After 18 hours incubation at 37° C., colonies were seen on plates. Several clones were analyzed by isolating plasmid DNA from overnight culture broth.


[0531] One such positive clone was restreaked several times on agar plates as used above, this clone was called MB878. The clone MB878 was grown overnight in TY-10 micrograms/ml kanamycin at 37° C., and next day 1 ml of cells were used to isolate plasmid from the cells using the Qiaprep Spin Plasmid Miniprep Kit #27106 accord-ing to the manufacturer's recommendations for B. subtilis plasmid preparations. This DNA was sequenced, which revealed that the DNA sequence encoding the mature mannanase corresponds to nucleotides 97-993 of SEQ ID NO: 11, which corresponds to amino acids 33-331 of SEQ ID NO: 12.


[0532] Expression, Purification and Characterization of Mannanase from Bacillus halodurans


[0533] The clone MB878 obtained as described above was grown in 25×200 ml BPX media with 10 micrograms/ml of kanamycin in 500 ml two baffled shakeflasks for 5 days at 37° C. at 300 rpm.


[0534] 5000 ml of the shake flask culture fluid of the clone MB878 was collected and pH was adjusted to 6.0. 125 ml of cationic agent (10% C521) and 250 ml of anionic agent (A130) was added during agitation for flocculation. The flocculated material was separated by centrifugation using a Sorval RC 3B centrifuge at 9000 rpm for 20 min at 6° C. The supernatant was adjusted to pH 8.0 using NaOH and clarified using Whatman glass filters GF/D and C. Then 50 g of DEAE A-50 Sephadex was equilibrated with 0.1 M Sodium acetate, pH 6.0, and added to the filtrate, the enzyme was bound and left overnight at room temperature. The bound enzyme was eluted with 0.5 M NaCl in the acetate buffer. Then the pH was adjusted to pH 8.0 using sodium hydroxide and then concentrated on a Filtron with a 10 kDa cut off to 450 ml and then stabilized with 20% glycerol, 20% MPG and 2% Berol. The product was used for application trials.


[0535] Two ml of this concentrate was adjusted to pH 8.5 using sodium hydroxide. For obtaining highly pure mannanase the concentrate was passed over a Superdex column equilibrated with 0.1 M sodium phosphate, pH 8.5.


[0536] The pure enzyme gave a single band in SDS-PAGE with a molecular weight of 34 kDa.


[0537] The amino acid sequence of the mannanase, i.e. the translated DNA sequence, is set forth in SEQ ID NO: 12.


[0538] The following N-terminal sequence of the purified protein was determined: AHHSGFHVNGTTLYDA (amino acids 32-47 of SEQ ID NO: 12).


[0539] The pH activity profile using the ManU assay (incubation for 20 minutes at 40° C.) shows that the enzyme has a relative activity higher than 50% between pH 7.5 and pH 10.


[0540] The temperature optimum was found (using the ManU assay; glycine buffer) to be between 60° C. and 70° C. at pH 10.


[0541] Immunological properties: Rabbit polyclonal monospecific serum was raised against the highly purified cloned mannanase using conventional techniques at the Danish company DAKO. The serum formed a nice single precipitate in agarose gels with the crude non purified mannanase of the invention.



EXAMPLE 11

[0542] Use of the Mannanase of Example 10 in Detergents


[0543] Using commercial detergents instead of buffer and incubation for 20 minutes at 40° C. with 0.2% AZCL-Galactomannan (Megazyme, Australia) from carob degree as described above followed by determination of the formation of blue color, the mannanase obtained as described in Example 10 was active with an activity higher than 40% relative to the activity in buffer in European liquid detergent Ariel Futur, in US Tide powder and in US Tide liquid detergent. In these tests, the detergent concentration was as recommended on the commercial detergent packages and the wash water was tap water having 18 degrees German hardness under European (Ariel Futur) conditions and 9 degree under US conditions (US Tide).



EXAMPLE 12

[0544] Mannanase Derived from Bacillus sp. AA349


[0545] Cloning of Bacillus sp (AA349) Mannanase Gene


[0546] Subcloning and Expression of a Catalytic Core of a Mannanase in B. subtilis:


[0547] The mannanase encoding DNA sequence of the invention was PCR amplified using the PCR primer set consisting of the following two oligonucleotides:
13BXM7.upper.SacII5′-CAT TCT GCA GCC GCG GCA AGT GGA CAT GGG CAA ATG C-3′(SEQ ID NO: 54)BXM7.lower.NotI5′-GCG TTG AGA CGC GCG GCC GCT TAT TTT TTG TAT ACA CTA ACG ATT TC-3′(SEQ ID NO: 55)


[0548] Restriction sites SaclI and NotI are underlined.


[0549] Chromosomal DNA isolated from Bacillus sp. AA349 as described above was used as template in a PCR reaction using Amplitaq DNA Polymerase (Perkin Elmer) according to manufacturer's instructions. The PCR reaction was set up in PCR buffer (10 mM Tris-HCl, pH 8.3, 50 mM KCl, 1.5 mM MgCl2, 0.01% (w/v) gelatin) containing 200 micro-M of each dNTP, 2.5 units of AmpliTaq polymerase (Perkin-Elmer, Cetus, USA) and 100 pmol of each primer.


[0550] The PCR reactions were performed using a DNA thermal cycler (Landgraf, Germany). One incubation at 94° C. for 1 min followed by thirty cycles of PCR performed using a cycle profile of denaturation at 94° C. for 30 sec, annealing at 60° C. for 1 min, and extension at 72° C. for 2 min. Five microliter aliquots of the amplification product was analyzed by electrophoresis in 0.7% agarose gels (NuSieve, FMC). The appearance of a DNA fragment approximate size of 1.0 kb indicated proper amplification of the gene segment.


[0551] Subcloning of PCR Fragment:


[0552] Forty five microliter aliquots of the PCR products generated as described above were purified using QIAquick PCR purification kit (Qiagen, USA) according to the manufacturer's instructions. The purified DNA was eluted in 50 microliters of 10 mM Tris-HCl, pH 8.5. Five micrograms of pMOL944 and twenty five microliters of the purified PCR fragment was digested with SaclI and NotI, electrophoresed in 0.8% low gelling temperature agarose (SeaPlaque GTG, FMC) gels, the relevant fragments were excised from the gels, and purified using QIAquick Gel extraction Kit (Qiagen, USA) according to the manufacturer's instructions. The isolated PCR DNA fragment was then ligated to the SaclI-NotI digested and purified pMOL944. The ligation was performed overnight at 16° C. using 0.5 micrograms of each DNA fragment, 1 U of T4 DNA ligase and T4 ligase buffer (Boehringer Mannheim, Germany).


[0553] The ligation mixture was used to transform competent B. subtilis PL2306. The transformed cells were plated onto LBPG-10 micrograms/ml of kanamycin-agar plates. After 18 hours incubation at 37° C. colonies were seen on plates. Several clones were analyzed by isolating plasmid DNA from overnight culture broth.


[0554] One such positive clone was restreaked several times on agar plates as used above, this clone was called MB879. The clone MB879 was grown overnight in TY-10 micrograms/ml kanamycin at 37° C., and next day 1 ml of cells were used to isolate plasmid from the cells using the Qiaprep Spin Plasmid Miniprep Kit #27106 according to the manufacturer's recommendations for B. subtilis plasmid preparations. This DNA was sequenced, which revealed that the DNA sequence encoding the mature mannanase ccorresponds to nucleotides 204-1107 of SEQ ID NO: 15, which corresponds to amino acids 26-369 of SEQ ID NO: 16.


[0555] Expression, Purification and Characterization of Mannanase from Bacillus sp. AA349


[0556] The clone MB879 obtained as described above was grown in 25×200 ml BPX media with 10 micrograms/ml of kanamycin in 500 ml two baffled shakeflasks for 5 days at 37° C. at 300 rpm.


[0557] 400 ml of the shake flask culture fluid of the clone MB879 was collected and pH was 6.5. Nineteen ml of cationic agent (10% C521) and 38 ml of anionic agent (A130) was added during agitation for flocculation. The flocculated material was separated by centrifugation using a Sorval RC 3B centrifuge at 5000 rpm for 25 min at 6° C. The then concentrated and washed with water to reduce the conductivity on a Filtron with a 10 kDa cut off to 150 ml. then the pH was adjusted to 4.0 and the liquid applied to S-Sepharose column cromatography in a 50 mM Sodium acetete buffer pH 4.0. The column was first eluted with a NaCl gradient to 0.5 M then the mannanase eluted using 0.1 M glycine buffer pH 10. The mannanase active fraction was pooled and they gave a single band in SDS-PAGE with a molecular weight of 38 kDa.


[0558] The amino acid sequence of the mannanase, i.e. the translated DNA sequence, is set forth in SEQ ID NO: 16.


[0559] The pH activity profile using the ManU assay (incubation for 20 minutes at 40° C.) shows that the enzyme has a relative activity higher than 30% between pH 5 and pH 10.


[0560] The temperature optimum was found (using the ManU assay; glycine buffer) to be between 60° C. and 70° C. at pH 10.


[0561] Immunological properties: Rabbit polyclonal monospecific serum was raised against the highly purified cloned mannanase using conventional techniques at the Danish company DAKO. The serum formed a nice single precipitate in agarose gels with the crude non purified mannanase of the invention.



EXAMPLE 13

[0562] Use of the Mannanase of Example 12 in Detergents


[0563] Using commercial detergents instead of buffer and incubation for 20 minutes at 40° C. with 0.2% AZCL-Galactomannan (Megazyme, Australia) from carob degree as described above followed by determination of the formation of blue color, the mannanase obtained as described in Example 12 was active with an activity higher than 65% relative to the activity in buffer in European liquid detergent Ariel Futur and in US Tide liquid detergent. The mannanase was more than 35% active in powder detergents from Europe, Ariel Futur and in US tide powder. In these tests, the detergent concentration was as recommended on the commercial detergent packages and the wash water was tap water having 18 degrees German hardness under European (Ariel Futur) conditions and 9 degree under US conditions (US Tide).



EXAMPLE 14

[0564] Mannanase derived from the Fungal Strain Humicola insolens DSM 1800


[0565] Expression Cloning of a Family 26 Beta-1,4-Mannanase from Humicola insolens


[0566] Fungal Strain and Cultivation Conditions


[0567]

Humicola insolens
strain DSM 1800 was fermented as described in WO 97/32014, the mycelium was harvested after 5 days growth at 26° C., immediately frozen in liquid N2, and stored at −80° C.


[0568] Preparation of RNase-Free Gassware, Tips and Solutions


[0569] All glassware used in RNA isolations were baked at 220° C. for at least 12 h. Eppendorf tubes, pipet tips and plastic columns were treated in 0.1% diethylpyrocarbonate (DEPC) in EtOH for 12 h, and autoclaved. All buffers and water (except Tris-containing buffers) were treated with 0.1% DEPC for 12 h at 37° C., and autoclaved.


[0570] Extraction of Total RNA


[0571] The total RNA was prepared by extraction with guanidinium thiocyanate followed by ultracentrifugation through a 5.7 M CsCl cushion (Chirgwin et al., 1979) using the following modifications. The frozen mycelia was ground in liquid N2 to fine powder with a mortar and a pestle, followed by grinding in a precooled coffee mill, and immediately suspended in 5 vols of RNA extraction buffer (4 M GuSCN, 0.5% Na-laurylsarcosine, 25 mM Na-citrate, pH 7.0, 0.1 M beta-mercaptoethanol). The mixture was stirred for 30 min. at RT° and centrifuged (30 min., 5000 rpm, RT°, Heraeus Megafuge 1.0 R) to pellet the cell debris. The supernatant was collected, carefully layered onto a 5.7 M CsCl cushion (5.7 M CsCl, 0.1 M EDTA, pH 7.5, 0.1% DEPC; autoclaved prior to use) using 26.5 ml supernatant per 12.0 ml CsCl cushion, and centrifuged to obtain the total RNA (Beckman, SW 28 rotor, 25000 rpm, RT°, 24 h). After centrifugation the supernatant was carefully removed and the bottom of the tube containing the RNA pellet was cut off and rinsed with 70% EtOH. The total RNA pellet was transferred into an Eppendorf tube, suspended in 500 ml TE, pH 7.6 (if difficult, heat occasionally for 5 min at 65° C.), phenol extracted and precipitated with ethanol for 12 h at −20° C. (2.5 vols EtOH, 0.1 vol 3 M NaAc, pH 5.2). The RNA was collected by centrifugation, washed in 70% EtOH, and resuspended in a minimum volume of DEPC-DIW. The RNA concentration was determined by measuring OD260/280.


[0572] Isolation of poly(A)+RNA


[0573] The poly(A)+RNAs were isolated by oligo(dT)-cellulose affinity chromatography (Aviv & Leder, 1972). Typically, 0.2 g of oligo(dT) cellulose (Boehringer Mannheim, check for binding capacity) was preswollen in 10 ml of 1×column loading buffer (20 mM Tris-Cl, pH 7.6, 0.5 M NaCl, 1 mM EDTA, 0.1% SDS), loaded onto a DEPC-treated, plugged plastic column (Poly Prep Chromatography Column, Bio Rad), and equilibrated with 20 ml 1×loading buffer. The total RNA was heated at 65° C. for 8 min., quenched on ice for 5 min, and after addition of 1 vol 2×column loading buffer to the RNA sample loaded onto the column. The eluate was collected and reloaded 2-3 times by heating the sample as above and quenching on ice prior to each loading. The oligo(dT) column was washed with 10 vols of 1×loading buffer, then with 3 vols of medium salt buffer (20 mM Tris-Cl, pH 7.6, 0.1 M NaCl, 1 mM EDTA, 0.1% SDS), followed by elution of the poly(A)+ RNA with 3 vols of elution buffer (10 mM Tris-Cl, pH 7.6, 1 mM EDTA, 0.05% SDS) preheated to 65° C., by collecting 500 ml fractions. The OD260 was read for each collected fraction, and the mRNA containing fractions were pooled and ethanol precipitated at −20° C. for 12 h. The poly(A)+ RNA was collected by centrifugation, resuspended in DEPC-DIW and stored in 5-10 mg aliquots at −80° C.


[0574] cDNA Synthesis


[0575] First Strand Synthesis


[0576] Double-stranded cDNA was synthesized from 5 mg of Humicola insolens poly(A)+ RNA by the RNase H method (Gubler & Hoffman 1983, Sambrook et al., 1989) using the hair-pin modification developed by F. S. Hagen (pers. comm.). The poly(A)+RNA (5 mg in 5 ml of DEPC-treated water) was heated at 70° C. for 8 min., quenched on ice, and combined in a final volume of 50 ml with reverse transcriptase buffer (50 mM Tris-Cl, pH 8.3, 75 mM KCl, 3 mM MgCl2, 10 mM DTT, Bethesda Research Laboratories) containing 1 mM each dNTP (Pharmacia), 40 units of human placental ribonuclease inhibitor (RNasin, Promega), 10 mg of oligo(dT)12-18 primer (Pharmacia) and 1000 units of SuperScript II RNase H-reverse transcriptase (Bethesda Research Laboratories). First-strand cDNA was synthesized by incubating the reaction mixture at 45° C. for 1 h.


[0577] Second Strand Synthesis


[0578] After synthesis 30 ml of 10 mM Tris-Cl, pH 7.5, 1 mM EDTA was added, and the mRNA:cDNA hybrids were ethanol precipitated for 12 h at −20° C. by addition of 40 mg glycogen carrier (Boehringer Mannheim) 0.2 vols 10 M NH4Ac and 2.5 vols 96% EtOH. The hybrids were recovered by centrifugation, washed in 70% EtOH, air dried and resuspended in 250 ml of second strand buffer (20 mM Tris-Cl, pH 7.4, 90 mM KCl, 4.6 mM MgCl2, 10 mM (NH4)2SO4, 16 mM beta-NAD+) containing 100 mM each dNTP, 44 units of E. coli DNA polymerase I (Amersham), 6.25 units of RNase H (Bethesda Research Laboratories) and 10.5 units of E. coli DNA ligase (New England Biolabs). Second strand cDNA synthesis was performed by incubating the reaction tube at 1° C. for 3 h, and the reaction was stopped by addition of EDTA to 20 mM final concentration followed by phenol extraction.


[0579] Mung Bean Nuclease Treatment


[0580] The double-stranded (ds) cDNA was ethanol precipitated at −20° C. for 12 h by addition of 2 vols of 96% EtOH, 0.1 vol 3 M NaAc, pH 5.2, recovered by centrifugation, washed in 70% EtOH, dried (SpeedVac), and resuspended in 30 ml of Mung bean nuclease buffer (30 mM NaAc, pH 4.6, 300 mM NaCl, 1 mM ZnSO4, 0.35 mM DTT, 2% glycerol) containing 36 units of Mung bean nuclease (Bethesda Research Laboratories). The single-stranded hair-pin DNA was clipped by incubating the reaction at 30° C. for 30 min, followed by addition of 70 ml 10 mM Tris-Cl, pH 7.5, 1 mM EDTA, phenol extraction, and ethanol precipitation with 2 vols of 96% EtOH and 0.1 vol 3 M NaAc, pH 5.2 at −20° C. for 12 h.


[0581] Blunt-Ending with T4 DNA Polymerase


[0582] The ds cDNA was blunt-ended with T4 DNA polymerase in 50 ml of T4 DNA polymerase buffer (20 mM Tris-acetate, pH 7.9, 10 mM MgAc, 50 mM KAc, 1 mM DTT) containing 0.5 mM each dNTP and 7.5 units of T4 DNA polymerase (Invitrogen) by incubating the reaction mixture at 37° C. for 15 min. The reaction was stopped by addition of EDTA to 20 mM final concentration, followed by phenol extraction and ethanol precipitation.


[0583] Adaptor Ligation and Size Selection


[0584] After the fill-in reaction the cDNA was ligated to non-palindromic BstX I adaptors (1 mg/ml, Invitrogen) in 30 ml of ligation buffer (50 mM Tris-Cl, pH 7.8, 10 mM MgCl2, 10 mM DTT, 1 mM ATP, 25 mg/ml bovine serum albumin) containing 600 pmol BstX I adaptors and 5 units of T4 ligase (Invitrogen) by incubating the reaction mix at 16° C. for 12 h. The reaction was stopped by heating at 70° C. for 5 min, and the adapted cDNA was size-fractionated by agarose gel electrophoresis (0.8% HSB-agarose, FMC) to separate unligated adaptors and small cDNAs. The cDNA was size-selected with a cut-off at 0.7 kb, and the cDNA was electroeluted from the agarose gel in 10 mM Tris-Cl, pH 7.5, 1 mM EDTA for 1 h at 100 volts, phenol extracted and ethanol precipitated at −20° C. for 12 h as above.


[0585] Construction of the Humicola insolens cDNA Library


[0586] The adapted, ds cDNAs were recovered by centrifugation, washed in 70% EtOH and resuspended in 25 ml DIW. Prior to large-scale library ligation, four test ligations were carried out in 10 ml of ligation buffer (same as above) each containing 1 ml ds cDNA (reaction tubes #1-#3), 2 units of T4 ligase (Invitrogen) and 50 ng (tube #1), 100 ng (tube #2) and 200 ng (tubes #3 and #4) Bst XI cleaved pYES 2.0 vector (Invitrogen). The ligation reactions were performed by incubation at 16° C. for 12 h, heated at 70° C. for 5 min, and 1 ml of each ligation electroporated (200 W, 2.5 kV, 25 mF) to 40 ml competent E. coli 1061 cells (OD600=0.9 in 1 liter LB-broth, washed twice in cold DIW, once in 20 ml of 10% glycerol, resuspended in 2 ml 10% glycerol). After addition of 1 ml SOC to each transformation mix, the cells were grown at 37° C. for 1 h, 50 ml plated on LB+ampicillin plates (100 mg/ml) and grown at 37° C. for 12 h.


[0587] Using the optimal conditions a large-scale ligation was set up in 40 ml of ligation buffer containing 9 units of T4 ligase, and the reaction was incubated at 16° C. for 12 h. The ligation reaction was stopped by heating at 70° C. for 5 min, ethanol precipitated at −20° C. for 12 h, recovered by centrifugation and resuspended in 10 ml DIW. One ml aliquots were transformed into electrocompetent E. coli 1061 cells using the same electroporation conditions as above, and the transformed cells were titered and the library plated on LB+ampicillin plates with 5000-7000 c.f.u./plate. The cDNA library, comprising of 1×106 recombinant clones, was stored as 1) individual pools (5000-7000 c.f.u./pool) in 20% glycerol at −80° C., 2) cell pellets of the same pools at −20° C., and 3) Qiagen purified plasmid DNA from individual pools at −20° C. (Qiagen Tip 100, Diagen).


[0588] Expression Cloning in Saccharomyces cerevisiae of Beta-1,4-Mannanase cDNAs from Humicola insolens


[0589] One ml aliquots of purified plasmid DNA (100 ng/ml) from individual pools were electroporated (200 W, 1.5 kV, 25 mF) into 40 ml of electrocompetent S. cerevisiae W3124 (MATa; ura 3-52; leu 2-3, 112; his 3-D200; pep 4-1137; prc1::HIS3, prb1::LEU2; cir+) cells (OD600=1.5 in 500 ml YPD, washed twice in cold DIW, once in cold 1 M sorbitol, resuspended in 0.5 ml 1 M sorbitol, Becker & Guarante, 1991). After addition of 1 ml 1 M cold sorbitol, 80 ml aliquots were plated on SC+glucose−uracil to give 250-400 colony forming units per plate and incubated at 30° C. for 3-5 days. The plates were replicated on SC+galactose−uracil plates, containing AZCl-galactomannan (MegaZyme, Australia) incorporated in the agar plates. In total, ca. 50000 yeast colonies from the H. insolens library were screened for mannanase-positive clones.


[0590] The positive clones were identified by the formation of blue hydrolysis halos around the corresponding yeast colonies. The clones were obtained as single colonies, the cDNA inserts were amplified directly from yeast cell lysates using biotinylated pYES 2.0 polylinker primers, purified by magnetic beads (Dynabead M-280, Dynal) system and characterized individually by sequencing the 5′-end of each cDNA clone using the chain-termination method (Sanger et al., 1977) and the Sequenase system (United States Biochemical).


[0591] The mannanase-positive yeast colonies were inoculated into 20 ml YPD broth in a 50 ml tubes. The tubes were shaken for 2 days at 30° C., and the cells were harvested by centrifugation for 10 min. at 3000 rpm. Total yeast DNA was isolated according to WO 94/14953, dissolved in 50 ml of autoclaved water, and transformed into E. coli by electroporation as above. The insert-containing pYES 2.0 cDNA clones were rescued by plating on LB+ampicillin agar plates, the plasmid DNA was isolated from E. coli using standard procedures, and analyzed by digesting with restriction enzymes.


[0592] Nucleotide Sequence Analysis


[0593] The nucleotide sequence of the full-length H. insolens beta-1,4-mannanase cDNA clone pC1M59 was determined from both strands by the dideoxy chain-termination method (Sanger et al. 1977), using 500 ng of Qiagen-purified template (Qiagen, USA) template, the Taq deoxy-terminal cycle sequencing kit (Perkin-Elmer, USA), fluorescent labeled terminators and 5 pmol of the pYES 2.0 polylinker primers (Invitrogen, USA). Analysis of the sequence data were performed according to Devereux et al. (1984).


[0594] Heteroloqous Expression in Aspergillus oryzae


[0595] Transformation of Aspergillus oryzae


[0596] Transformation of Aspergillus oryzae was carried out as described by Christensen et al., 1988, Biotechnology, 6: 1419-1422.


[0597] Construction of the Beta-1,4-Mannanase Expression Cassette for Asperqillus Expression


[0598] Plasmid DNA was isolated from the mannanase clone pC1M59 using standard procedures and analyzed by restriction enzyme analysis. The cDNA insert was excised using appropriate restriction enzymes and ligated into the Aspergillus expression vector pHD414, which is a derivative of the plasmid p775 (described in EP 238023). The construction of pHD414 is further described in WO 93/11249.


[0599] Transformation of Aspergillus oryzae or Aspergillus niger


[0600] General procedure: 100 ml of YPD (Sherman et al., Methods in Yeast Genetics, Cold Spring Harbor Laboratory, 1981) is inoculated with spores of A. oryzae or A. niger and incubated with shaking at 37° C. for about 2 days. The mycelium is harvested by filtration through miracloth and washed with 200 ml of 0.6 M MgSO4. The mycelium is suspended in 15 ml of 1.2 M MgSO4. 10 mM NaH2PO4, pH=5.8. The suspension is cooled on ice and 1 ml of buffer containing 120 mg of Novozym® 234 is added. After 5 minutes 1 ml of 12 mg/ml BSA is added and incubation with gentle agitation continued for 1.5-2.5 hours at 37° C. until a large number of protoplasts is visible in a sample inspected under the microscope. The suspension is filtered through miracloth, the filtrate transferred to a sterile tube and overlayered with 5 ml of 0.6 M sorbitol, 100 mM Tris-HCl, pH=7.0. Centrifugation is performed for 15 minutes at 100 g and the protoplasts are collected from the top of the MgSO4 cushion. 2 volumes of STC are added to the protoplast suspension and the mixture is centrifugated for 5 minutes at 1000 g. The protoplast pellet is resuspended in 3 ml of STC and repelleted. This is repeated. Finally the protoplasts are resuspended in 0.2-1 ml of STC. 100 microliters of protoplast suspension is mixed with 5-25 micrograms of the appropriate DNA in 10 microliters of STC. Protoplasts are mixed with p3SR2 (an A. nidulans amdS gene carrying plasmid). The mixture is left at room temperature for 25 minutes. 0.2 ml of 60% PEG 4000. 10 mM CaCl2 and 10 mM Tris-HCl, pH 7.5 is added and carefully mixed (twice) and finally 0.85 ml of the same solution is added and carefully mixed. The mixture is left at room temperature for 25 minutes, spun at 2500 g for 15 minutes and the pellet is resuspended in 2 ml of 1.2 M sorbitol. After one more sedimentation the protoplasts are spread on the appropriate plates. Protoplasts are spread on minimal plates to inhibit background growth. After incubation for 4-7 days at 37° C. spores are picked and spread for single colonies. This procedure is repeated and spores of a single colony after the second re-isolation is stored as a defined transformant.


[0601] Purification of the Aspergillus oryzae Transformants


[0602]

Aspergillus oryzae
colonies are purified through conidial spores on AmdS+-plates (+0.01% Triton X-100) and growth in YPM for 3 days at 30° C.


[0603] Identification of Mannanase-Positive Aspergillus orvzae Transformants


[0604] The supernatants from the Aspergillus oryzae transformants were assayed for beta-1,4-mannanase activity on agar plates containing 0.2% AZCl-galactomannan (MegaZyme, Australia) as substrate. Positive transformants were identified by analyzing the plates for blue hydrolysis halos after 24 hours of incubation at 30° C.


[0605] SDS-PAGE Analysis


[0606] SDS-PAGE analysis of supernatants from beta-1,4-mannanase producing Aspergillus oryzae transformants. The transformants were grown in 5 ml YPM for three days. Ten microliters of supernatant was applied to 12% SDS-polyacrylamide gel which was subsequently stained with Coomassie Brilliant Blue.


[0607] Purification and Characterization of the Humicola insolens Mannanase


[0608] The gene was transformed into A. oryzae as described above and the transformed strain was grown in a fermentor using standard medium of maltose syrup, sucrose, MgSO4 Ka2PO4 and K2SO4 and citric acid yeast extract and trace metals. Incubation for 6 days at 34° C. with air.


[0609] The fermentation broth (5000 ml) was harvested and the mycelium separated from the liquid by filtration. The clear liquid was concentrated on a filtron to 275 ml.


[0610] The mannanase was purified using Cationic chromatography. A S-Spharose column was equilibrated with 25 mM citric acid pH 4.0 and the mannanase bound to the column and was eluted using a sodium chloride gradient (0-0.5 M). The mannanase active fractions were pooled and the pH adjusted to 7.3. The 100 ml pooled mannanase was then concentrated to 5 ml with around 13 mg protein per ml and used for applications trials. For further purification 2 ml was applied to size chromatography on Superdex 200 in sodium acetate buffer pH 6.1. The mannanase active fraction showed to equal stained bands in SDS-PAGE with a MW of 45 kDa and 38 kDa, indicating proteolytic degradation of the N-terminal non-catalytic domain.


[0611] The amino acid sequence of the mannanase, i.e. the translated DNA sequence, is set forth in SEQ ID NO: 14.


[0612] The DNA sequence of SEQ ID NO: 13 codes for a signal peptide at positions 1-21, a domain of unknown function, also found in other mannanases, at positions 22-159, and a catalytic active domain at positions 160-488 of SEQ ID NO: 14.


[0613] Highest sequence homology was found to Dictyoglomus thermophilum (49% identity); Mannanase sequence EMBL; AF013989 submitted by Reeves R. A., Gibbs M. D., Bergquist P. L. submitted in July 1997.


[0614] Molecular Weight: 38 kDa.


[0615] DSC in sodium acetate buffer pH 6.0 was 65° C.


[0616] The pH activity profile using the ManU assay (incubation for 20 minutes at 40° C.) shows that the enzyme has optimum activity at pH 8.


[0617] The temperature optimum was found (using the ManU assay; Megazyme AZCL locust been gum as substrate) to be 70° C. at pH 10.


[0618] Immunological properties: Rabbit polyclonal monospecific serum was raised against the highly purified cloned mannanase using conventional techniques at the Danish company DAKO. The serum formed a nice single precipitate in agarose gels with the crude non purified mannanase of the invention.



EXAMPLE 15

[0619] Wash Evaluation of Humicola insolens Family 26 Mannanase


[0620] Wash performance was evaluated by washing locust bean gum coated swatches in a detergent solution with the mannanase of the invention. After wash the effect were visualised by soiling the swatches with iron oxide.


[0621] Preparation of locust bean gum swatches: Clean cotton swatches were soaked in a solution of 2 g/l locust bean gum and dried overnight at room temperature. The swatches were prewashed in water and dried again.


[0622] Wash: Small circular locust bean gum swatches were placed in a beaker with 6.7 g/l Ariel Futur liquid in 15° dH water and incubated for 30 min at 40° C. with magnetic stirring. The swatches were rinsed in tap water and dried.


[0623] Soiling: The swatches were placed in a beaker with 0.25 g/l Fe2O3 and stirred for 3 min. The swatches were rinsed in tap water and dried.


[0624] Evaluation: Remission of the swatches was measured at 440 nm using a MacBeth ColorEye 7000 remission spectrophotometer. The results are expressed as


delta remission=(Rafter wash−Rbefore wash)enzyme−(Rafter wash−Rbefore wash)control,


[0625] where R is the remission at 440 nm.


[0626] The mannanase of this invention is clearly effective on locust bean gum swatches with a wash performance slightly better than the control mannanase from Bacillus sp. I633.


[0627] Wash performance of Humicola insolens family 26 mannanase compared to the mannanase from Bacillus sp. I633 (Examples 1-3) given as delta remission values:
14Enzyme doseHumicola insolensBacillus sp.in mg/lmannanaseI633 mannanase0000.016.65.00.19.38.61.010.27.710.010.59.7



EXAMPLES 16-40

[0628] The following examples exemplify compositions of the present invention, but are not necessarily meant to limit or otherwise define the scope of the invention.


[0629] In the detergent compositions, the enzymes levels are expressed by pure enzyme by weight of the total composition and unless otherwise specified, the detergent ingredients are expressed by weight of the total compositions. The abbreviated component identifications therein have the following meanings:
15LASSodium linear C11-13 alkyl benzene sulphonate.TASSodium tallow alkyl sulphate.CxyASSodium C1x-C1y alkyl sulfate.CxySASSodium C1x-C1y secondary (2,3) alkyl sulfate.CxyEzC1x-C1y predominantly linear primary alcohol condensed with an average ofz moles of ethylene oxide.CxyEzSC1x-C1y sodium alkyl sulfate condensed with an average of z moles ofethylene oxide.QASR2.N+(CH3)2(C2H4OH) with R2 = C12-14.QAS 1R2.N+(CH3)2(C2H4OH) with R2 = C8-11.APAC8-10 amido propyl dimethyl amine.SoapSodium linear alkyl carboxylate derived from a 80/20 mixture of tallowand coconut fatty acids.NonionicC13-15 mixed ethoxylated/propoxylated fatty alcohol with an averagedegree of ethoxylation of 3.8 and an average degree of propoxylationof 4.5.Neodol 45-13C14-15 linear primary alcohol ethoxylate, sold by Shell Chemical CO.STSSodium toluene sulphonate.CFAAC12-14 alkyl N-methyl glucamide.TFAAC16-18 alkyl N-methyl glucamide.TPKFAC12-14 topped whole cut fatty acids.SilicateAmorphous Sodium Silicate (SiO2:Na2O ratio = 1.6-3.2).MetasilicateSodium metasilicate (SiO2:Na2O ratio = 1.0).Zeolite AHydrated Sodium Aluminosilicate of formula Na12(A1O2SiO2)12.27H2Ohaving a primary particle size in the range from 0.1 to 10 micrometers(Weight expressed on an anhydrous basis).Na-SKS-6Crystalline layered silicate of formula delta-Na2Si2O5.CitrateTri-sodium citrate dihydrate of activity 86.4% with a particle sizedistribution between 425 and 850 micrometres.CitricAnhydrous citric acid.BorateSodium borateCarbonateAnhydrous sodium carbonate with a particle size between 200 and 900micrometres.BicarbonateAnhydrous sodium hydrogen carbonate with a particle size distributionbetween 400 and 1200 micrometres.SulphateAnhydrous sodium sulphate.Mg SulphateAnhydrous magnesium sulfate.STPPSodium tripolyphosphate.TSPPTetrasodium pyrophosphate.MA/AARandom copolymer of 4:1 acrylate/maleate, average molecular weightabout 70,000-80,000.MA/AA 1Random copolymer of 6:4 acrylate/maleate, average molecular weightabout 10,000.AASodium polyacrylate polymer of average molecular weight 4,500.PA30Polyacrylic acid of average molecular weight of between about 4,500-8,000.480NRandom copolymer of 7:3 acrylate/methacrylate, average molecularweight about 3,500.Polygel/carbopolHigh molecular weight crosslinked polyacrylates.PB1Anhydrous sodium perborate monohydrate of nominal formulaNaBO2.H2O2.PB4Sodium perborate tetrahydrate of nominal formula NaBO2.3H2O.H2O2.PercarbonateAnhydrous sodium percarbonate of nominal formula 2Na2CO3.3H2O2.NaDCCSodium dichloroisocyanurate.TAEDTetraacetylethylenediamine.NOBSNonanoyloxybenzene sulfonate in the form of the sodium salt.NACA-OBS(6-nonamidocaproyl) oxybenzene sulfonate.DTPADiethylene triamine pentaacetic acid.HEDP1,1-hydroxyethane diphosphonic acid.DETPMPDiethyltriamine penta (methylene) phosphonate, marketed byMonsanto under the Trade name Dequest 2060.EDDSEthylenediamine-N,N′-disuccinic acid, (S,S) isomer in the form of itssodium saltMnTACNManganese 1,4,7-trimethyl-1,4,7-triazacyclononane.PhotoactivatedSulfonated zinc phtalocyanine encapsulated in dextrin soluble polymer.BleachPhotoactivatedSulfonated alumino phtalocyanine encapsulated in dextrin solubleBleach 1polymer.PAACPentaamine acetate cobalt (III) salt.ParaffinParaffin oil sold under the tradename Winog 70 by Wintershall.NaBzSodium benzoate.BzPBenzoyl Peroxide.MannanaseAs described hereinProteaseProteolytic enzyme sold under the tradename Savinase, Alcalase,Durazym by Novo Nordisk A/S, Maxacal, Maxapem sold by Gist-Brocades and proteases described in patents WO 91/06637 and/orWO 95/10591 and/or EP 251 446.AmylaseAmylolytic enzyme sold under the tradename Purafact Ox AmRdescribed in WO 94/18314, WO 96/05295 sold by Genencor;Termamyl ®, Fungamyl ®, and Duramyl ®, all available from NovoNordisk A/S and those described in WO 95/26397.LipaseLipolytic enzyme sold under the tradename Lipolase, Lipolase Ultra byNovo Nordisk A/S and Lipomax by Gist-Brocades.CellulaseCellulytic enzyme sold under the tradename Carezyme, Celluzymeand/or Endolase by Novo Nordisk A/S.CMCSodium carboxymethyl cellulose.PVPPolyvinyl polymer, with an average molecular weight of 60,000.PVNOPolyvinylpyridine-N-Oxide, with an average molecular weight of50,000.PVPVICopolymer of vinylimidazole and vinylpyrrolidone, with an averagemolecular weight of 20,000.Brightener 1Disodium 4,4′-bis(2-sulphostyryl)biphenyl.Brightener 2Disodium 4,4′-bis(4-anilino-6-morpholino-1.3.5-triazin-2-yl) stilbene2:2′-disulfonate.SiliconePolydimethylsiloxane foam controller with siloxane-oxyalkyleneantifoamcopolymer as dispersing agent with a ratio of said foam controller tosaid dispersing agent of 10:1 to 100:1.Suds12% Silicone/silica, 18% stearyl alcohol, 70% starch in granular form.SuppressorOpacifierWater based monostyrene latex mixture, sold by BASFAktiengesellschaft under the tradename Lytron 621.SRP 1Anionically end capped poly esters.SRP 2Diethoxylated poly (1,2 propylene terephthalate) short block polymer.QEAbis((C2H5O)(C2H4O)n)(CH3)—N+—C6H12—N+—(CH3)bis((C2H5O)—(C2H4O))n, wherein n = from 20 to 30.PEIPolyethyleneimine with an average molecular weight of 1800 and anaverage ethoxylation degree of 7 ethyleneoxy residues per nitrogen.SCSSodium cumene sulphonate.HMWPEOHigh molecular weight polyethylene oxide.PEGxPolyethylene glycol, of a molecular weight of x.PEOPolyethylene oxide, with an average molecular weight of 5,000.TEPAETetreaethylenepentaamine ethoxylate.BTABenzotriazole.PHMeasured as a 1% solution in distilled water at 20° C.



EXAMPLE 16

[0630] The following high density laundry detergent compositions were prepared according to the present invention:
16IIIIIIIVVVILAS8.08.08.02.06.06.0TAS—0.5—0.51.00.1C46(S)AS2.02.5————C25AS———7.04.55.5C68AS2.05.07.0———C25E5——3.410.04.64.6C25E73.43.41.0———C25E3S———2.05.04.5QAS—0.8————QAS 1———0.80.51.0Zeolite A18.118.014.118.120.018.1Citric———2.5—2.5Carbonate13.013.027.010.010.013.0Na-SKS-6———10.0—10.0Silicate1.41.43.00.30.50.3Citrate—1.0—3.0——Sulfate26.126.126.16.0——Mg sulphate0.3——0.2—0.2MA/AA0.30.30.34.01.01.0CMC0.20.20.20.20.40.4PB49.09.05.0———Percarbonate————18.018.0TAED1.50.41.5—3.94.2NACA-OBS—2.01.0———DETPMP0.250.250.250.25——SRP 1———0.2—0.2EDDS—0.250.4—0.50.5CFAA—1.0—2.0——HEDP0.30.30.30.30.40.4Q5EA———0.2—0.5Protease0.0090.0090.010.040.050.03Mannanase0.050.0090.030.0090.030.009Amylase0.0020.0020.0020.0060.0080.008Cellulase0.0007——0.00070.00070.0007Lipase0.006——0.010.010.01Photoactivated151515—2020bleach (ppm)PVNO/PVPVI———0.1——Brightener 10.090.090.09—0.090.09Perfume0.30.30.30.40.40.4Silicone antifoam0.50.50.5—0.30.3Density in g/liter850850850850850850Miscellaneous andUp to 100%minors



EXAMPLE 17

[0631] The following granular laundry detergent compositions of particular utility under European machine wash conditions were prepared according to the present invention:
17IIIIIIIVVVILAS5.57.55.05.06.07.0TAS1.251.9—0.80.40.3C24AS/C25AS—2.25.05.05.02.2C25E3S—0.81.01.53.01.0C45E73.25————3.0TFAA——2.0———C25E5—5.5————QAS0.8—————QAS 1—0.71.00.51.00.7STPP19.7—————Zeolite A—19.525.019.520.017.0NaSKS-6/citric—10.6—10.6——acid (79:21)Na-SKS-6——9.0—10.010.0Carbonate6.121.49.010.010.018.0Bicarbonate—2.07.05.0—2.0Silicate6.8——0.30.5—Citrate——4.04.0——Sulfate39.8——5.0—12.0Mg sulphate——0.10.20.2—MA/AA0.51.63.04.01.01.0CMC0.20.41.01.00.40.4PB45.012.7————Percarbonate————18.015.0TAED0.53.1——5.0—NACA-OBS1.03.5———2.5DETPMP0.250.20.30.4—0.2HEDP—0.3—0.30.30.3QEA——1.01.01.0—Protease0.0090.030.030.050.050.02Mannanase0.030.030.0010.030.0050.009Lipase0.0030.0030.0060.0060.0060.004Cellulase0.00060.00060.00050.00050.00070.0007Amylase0.0020.0020.0060.0060.010.003PVNO/PVPVI——0.20.2——PVP0.91.3———0.9SRP 1——0.20.20.2—Photoactivated1527——2020bleach (ppm)Photoactivated15—————bleach 1(ppm)Brightener 10.080.2——0.090.15Brightener 2—0.04————Perfume0.30.50.40.30.40.3Silicone0.52.40.30.50.32.0antifoamDensity750750750750750750in g/literMiscellaneousUp to 100%and minors



EXAMPLE 18

[0632] The following detergent compositions of particular utility under European machine wash conditions were prepared according to the present invention:
18IIIIIIIVBlown PowderLAS6.05.011.06.0T AS2.0——2.0Zeolite A24.0——20.0STPP—27.024.0—Sulfate4.06.013.0—MA/AA1.04.06.02.0Silicate1.07.03.03.0CMC1.01.00.50.6Brightener 10.20.20.20.2Silicone antifoam1.01.01.00.3DETPMP0.40.40.20.4Spray OnBrightener0.02——0.02C45E7———5.0C45E22.52.52.0—C45E32.62.52.0—Perfume0.50.30.50.2Silicone antifoam0.30.30.3—Dry additivesQEA———1.0EDDS0.3———Sulfate2.03.05.010.0Carbonate6.013.015.014.0Citric2.5——2.0QAS 10.5——0.5Na-SKS-610.0———Percarbonate18.5———PB4—18.010.021.5TAED2.02.0—2.0NACA-OBS3.02.04.0—Protease0.030.030.030.03Mannanase0.0090.010.030.001Lipase0.0080.0080.0080.004Amylase0.0030.0030.0030.006Brightener 10.05——0.05Miscellaneous and minorsUp to 100%



EXAMPLE 19

[0633] The following granular detergent compositions were prepared according to the present invention:
19IIIIIIIVVVIBlown PowderLAS23.08.07.09.07.07.0TAS————1.0—C45AS6.06.05.08.0——C45AES—1.01.01.0——C45E35————2.04.0Zeolite A10.018.014.012.010.010.0MA/AA—0.5———2.0MA/AA 17.0—————AA—3.03.02.03.03.0Sulfate5.06.314.311.015.019.3Silicate10.01.01.01.01.01.0Carbonate15.020.010.020.78.06.0PEG 40000.41.51.51.01.01.0DTPA—0.90.5——0.5Brightener 20.30.20.3—0.10.3Spray OnC45E7—2.0——2.02.0C25E93.0—————C23E9——1.52.0—2.0Perfume0.30.30.32.00.30.3AgglomeratesC45AS—5.05.02.0—5.0LAS—2.02.0——2.0Zeolite A—7.57.58.0—7.5Carbonate—4.04.05.0—4.0PEG 4000—0.50.5——0.5Misc—2.02.02.0—2.0(Water etc.)Dry additivesQAS————1.0—Citric————2.0—PB4————12.01.0PB14.01.03.02.0——Percarbonate————2.010.0Carbonate—5.31.8—4.04.0NOBS4.0—6.0——0.6Methyl0.2—————celluloseNa-SKS-68.0—————STS——2.0—1.0—Culmene—1.0———2.0sulfonic acidProtease0.020.020.020.010.020.02Mannanase0.0090.010.030.0090.010.001Lipase0.004—0.004—0.0040.008Amylase0.003—0.002—0.003—Cellulase0.00050.00050.00050.00070.00050.0005PVPVI————0.50.1PVP————0.5—PVNO——0.50.3——QEA————1.0—SRP 10.20.50.3—0.2—Silicone0.20.40.20.40.1—antifoamMg sulfate——0.2—0.2—MiscellaneousUp to 100%and minors



EXAMPLE 20

[0634] The following nil bleach-containing detergent compositions of particular use in the washing of colored clothing were prepared according to the present invention:
20IIIIIIBlown PowderZeolite A15.015.0—Sulfate—5.0—LAS3.03.0—DETPMP0.40.5—CMC0.40.4—MA/AA4.04.0—AgglomeratesC45AS——11.0LAS6.05.0—TAS3.02.0—Silicate4.04.0—Zeolite A10.015.013.0CMC——0.5MA/AA——2.0Carbonate9.07.07.0Spray-onPerfume0.30.30.5C45E74.04.04.0C25E32.02.02.0Dry additivesMA/AA——3.0Na-SKS-6——12.0Citrate10.0—8.0Bicarbonate7.03.05.0Carbonate8.05.07.0PVPVI/PVNO0.50.50.5Protease0.030.020.05Mannanase0.0010.0040.03Lipase0.0080.0080.008Amylase0.010.010.01Cellulase0.0010.0010.001Silicone antifoam5.05.05.0Sulfate—9.0—Density (g/liter)700700700Miscellaneous and minorsUp to 100%



EXAMPLE 21

[0635] The following detergent compositions were prepared according to the present invention:
21IIIIIIIVBase granuleZeolite A30.022.024.010.0Sulfate10.05.010.07.0MA/AA3.0———AA—1.62.0—MA/AA 1—12.0—6.0LAS14.010.09.020.0C45AS8.07.09.07.0C45AES—1.01.0—Silicate—1.00.510.0Soap—2.0——Brightener 10.20.20.20.2Carbonate6.09.010.010.0PEG 4000—1.01.5—DTPA—0.4——Spray OnC25E9———5.0C45E71.01.0——C23E9—1.02.5—Perfume0.20.30.3—Dry additivesCarbonate5.010.018.08.0PVPVI/PVNO0.5—0.3—Protease0.030.030.030.02Mannanase0.0020.0090.0150.03Lipase0.008——0.008Amylase0.002——0.002Cellulase0.00020.00050.00050.0002NOBS—4.0—4.5PB11.05.01.56.0Sulfate4.05.0—5.0SRP 1—0.4——Suds suppressor—0.50.5—Miscellaneous and minorsUp to 100%



EXAMPLE 22

[0636] The following granular detergent compositions were prepared according to the present invention:
22IIIIIIBlown PowderZeolite A20.0—15.0STPP—20.0—Sulfate——5.0Carbonate——5.0TAS——1.0LAS6.06.06.0C68AS2.02.0—Silicate3.08.0—MA/AA4.02.02.0CMC0.60.60.2Brightener 10.20.20.1DETPMP0.40.40.1STS——1.0Spray OnC45E75.05.04.0Silicone antifoam0.30.30.1Perfume0.20.20.3Dry additivesQEA——1.0Carbonate14.09.010.0PB11.52.0—PB418.513.013.0TAED2.02.02.0QAS——1.0Photoactivated bleach15 ppm15 ppm15 ppmNa-SKS-6——3.0Protease0.030.030.007Mannanase0.0010.0050.02Lipase0.0040.0040.004Amylase0.0060.0060.003Cellulase0.00020.00020.0005Sulfate10.020.05.0Density (g/liter)700700700Miscellaneous and minorsUp to 100%



EXAMPLE 23

[0637] The following detergent compositions were prepared according to the present invention:
23IIIIIIBlown PowderZeolite A15.015.015.0Sulfate—5.0—LAS3.03.03.0QAS—1.51.5DETPMP0.40.20.4EDDS—0.40.2CMC0.40.40.4MA/AA4.02.02.0AgglomerateLAS5.05.05.0TAS2.02.01.0Silicate3.03.04.0Zeolite A8.08.08.0Carbonate8.08.04.0Spray OnPerfume0.30.30.3C45E72.02.02.0C25E32.0——Dry AdditivesCitrate5.0—2.0Bicarbonate—3.0—Carbonate8.015.010.0TAED6.02.05.0PB114.07.010.0PEO——0.2Bentonite clay——10.0Protease0.030.030.03Mannanase0.0010.0050.01Lipase0.0080.0080.008Cellulase0.0010.0010.001Amylase0.010.010.01Silicone antifoam5.05.05.0Sulfate—3.0—Density (g/liter)850850850Miscellaneous and minorsUp to 100%



EXAMPLE 24

[0638] The following detergent compositions were prepared according to the present invention:
24IIIIIIIVLAS18.014.024.020.0QAS0.71.0—0.7TFAA—1.0——C23E56.5——1.0—C45E7—1.0——C45E3S1.02.51.0—STPP32.018.030.022.0Silicate9.05.09.08.0Carbonate11.07.510.05.0Bicarbonate—7.5——PB13.01.0——PB4—1.0——NOBS2.01.0——DETPMP—1.0——DTPA0.5—0.20.3SRP 10.30.2—0.1MA/AA1.01.52.00.5CMC0.80.40.40.2PEI——0.4—Sulfate20.010.020.030.0Mg sulfate0.2—0.40.9Mannanase0.0010.0050.010.015Protease0.030.030.020.02Amylase0.0080.007—0.004Lipase0.004—0.002—Cellulase0.0003——0.0001Photoactivated bleach30 ppm20 ppm—10 ppmPerfume0.30.30.10.2Brightener 1/20.050.020.080.1Miscellaneous and minorsup to 100%



EXAMPLE 25

[0639] The following liquid detergent formulations were prepared according to the present invention (Levels are given in parts per weight, enzyme are expressed in pure enzyme):
25IIIIIIIVVLAS11.58.8—3.9—C25E2.5S—3.018.0—16.0C45E2.25S11.53.0—15.7—C23E9—2.71.82.01.0C23E73.2————CFAA——5.2—3.1TPKFA1.6—2.00.52.0Citric (50%)6.51.22.54.42.5Ca formate0.10.060.1——Na formate0.50.060.10.050.05SCS4.01.03.01.2—Borate0.6—3.02.02.9Na hydroxide5.82.03.53.72.7Ethanol1.751.03.64.22.91,2 Propanediol3.32.08.07.95.3Monoethanolamine3.01.51.32.50.8TEPAE1.6—1.31.21.2Mannanase0.0010.010.0150.0150.001Protease0.030.010.030.020.02Lipase——0.002——Amylase———0.002—Cellulase——0.00020.00050.0001SRP 10.2—0.1——DTPA——0.3——PVNO——0.3—0.2Brightener 10.20.070.1——Silicone antifoam0.040.020.10.10.1Miscellaneous and water



EXAMPLE 26

[0640] The following liquid detergent formulations were prepared according to the present invention (Levels are given in parts per weight, enzyme are expressed in pure enzyme):
26IIIIIIIVLAS10.013.09.0—C25AS4.01.02.010.0C25E3S1.0——3.0C25E76.08.013.02.5TFAA———4.5APA—1.4——TPKFA2.0—13.07.0Citric2.03.01.01.5Dodecenyl/tetradecenyl12.010.0——succinic acidRapeseed fatty acid4.02.01.0—Ethanol4.04.07.02.01,2 Propanediol4.04.02.07.0Monoethanolamine———5.0Triethanolamine——8.0—TEPAE0.5—0.50.2DETPMP1.01.00.51.0Mannanase0.0010.0150.010.03Protease0.020.020.010.008Lipase—0.002—0.002Amylase0.0040.0040.010.008Cellulase———0.002SRP 20.3—0.30.1Boric acid0.10.21.02.0Ca chloride—0.02—0.01Brightener 1—0.4——Suds suppressor0.10.3—0.1Opacifier0.50.4—0.3NaOH up to pH8.08.07.67.7Miscellaneous and water



EXAMPLE 27

[0641] The following liquid detergent compositions were prepared according to the present invention (Levels are given in parts per weight, enzyme are expressed in pure enzyme):
27IIIIIIIVLAS25.0———C25AS—13.018.015.0C25E3S—2.02.04.0C25E7——4.04.0TFAA—6.08.08.0APA3.01.02.0—TPKFA—15.011.011.0Citric1.01.01.01.0Dodecenyl/tetradecenyl15.0———succinic acidRapeseed fatty acid1.0—3.5—Ethanol7.02.03.02.01,2 Propanediol6.08.010.013.0Monoethanolamine——9.09.0TEPAE——0.40.3DETPMP2.01.21.0—Mannanase0.0010.00150.010.01Protease0.050.020.010.02Lipase——0.0030.003Amylase0.0040.010.010.01Cellulase——0.0040.003SRP 2——0.20.1Boric acid1.01.52.52.5Bentonite clay4.04.0——Brightener 10.10.20.3—Suds suppressor0.4———Opacifier0.80.7——NaOH up to pH8.07.58.08.2Miscellaneous and water



EXAMPLE 28

[0642] The following liquid detergent compositions were prepared according to the present invention (Levels are given in parts by weight, enzyme are expressed in pure enzyme):
28IIILAS27.618.9C45AS13.85.9C13E83.03.1Oleic acid3.42.5Citric5.45.4Na hydroxide0.43.6Ca Formate0.20.1Na Formate—0.5Ethanol7.0—Monoethanolamine16.58.01,2 propanediol5.95.5Xylene sulfonic acid—2.4TEPAE1.50.8Protease0.050.02Mannanase0.0010.01PEG—0.7Brightener 20.40.1Perfume0.50.3Water and Minors



EXAMPLE 29

[0643] The following granular fabric detergent compositions which provide “softening through the wash” capability were prepared according to the present invention:
29IIIC45AS—10.0LAS7.6—C68AS1.3—C45E74.0—C25E3—5.0Coco-alkyl-dimethyl1.41.0hydroxy-ethylammonium chlorideCitrate5.03.0Na-SKS-6—11.0Zeolite A15.015.0MA/AA4.04.0DETPMP0.40.4PB115.0—Percarbonate—15.0TAED5.05.0Smectite clay10.010.0HMWPEO—0.1Mannanase0.0010.01Protease0.020.01Lipase0.020.01Amylase0.030.005Cellulase0.001—Silicate3.05.0Carbonate10.010.0Suds suppressor1.04.0CMC0.20.1Miscellaneous and minorsUp to 100%



EXAMPLE 30

[0644] The following rinse added fabric softener composition was prepared according to the present invention:
30DEQA (2)20.0Mannanase0.0008Cellulase0.001HCL0.03Antifoam agent0.01Blue dye25 ppmCaCl20.20Perfume0.90Miscellaneous and waterUp to 100%



EXAMPLE 31

[0645] The following fabric softener and dryer added fabric conditioner compositions were prepared according to the present invention:
31IIIIIIIVVDEQA2.619.0———DEQA(2)————51.8DTMAMS———26.0—SDASA——70.042.040.2Stearic acid of IV = 00.3————Neodol 45-13——13.0——Hydrochloride acid0.020.02———Ethanol——1.0——Mannanase0.00080.00020.00050.0050.0002Perfume1.01.00.751.01.5Glycoperse S-20————15.4Glycerol monostearate———26.0—Digeranyl Succinate——0.38——Silicone antifoam0.010.01———Electrolyte—0.1———Clay———3.0—Dye10 ppm25 ppm0.01——Water and minors100%100%———



EXAMPLE 32

[0646] The following laundry bar detergent compositions were prepared according to the present invention (Levels are given in parts per weight, enzyme are expressed in pure enzyme):
32IIIIIIVIVIIIVIVLAS——19.015.021.06.758.8—C28AS30.013.5———15.7511.222.5Na Laurate2.59.0——————Zeolite A2.01.25———1.251.251.25Carbonate20.03.013.08.010.015.015.010.0Ca Carbonate27.539.035.0——40.0—40.0Sulfate5.05.03.05.03.0——5.0TSPP5.0————5.02.5—STPP5.015.010.0——7.08.010.0Bentonite clay—10.0——5.0———DETPMP—0.70.6—0.60.70.70.7CMC—1.01.01.01.0——1.0Talc——10.015.010.0———Silicate——4.05.03.0———PVNO0.020.03—0.01—0.02——MA/AA0.41.0——0.20.40.50.4SRP 10.30.30.30.30.30.30.30.3Mannanase0.0010.0010.010.010.0150.0010.050.01Amylase——0.01———0.002—Protease0.0010.0040.0010.0030.0030.0010.0010.003Lipase—0.002—0.002————Cellulase—.0003——.0003.0002——PEO—0.2—0.20.3——0.3Perfume1.00.50.30.20.4——0.4Mg sulfate——3.03.03.0———Brightener0.150.10.15————0.1Photoactivated—15.015.015.015.0——15.0bleach (ppm)



EXAMPLE 33

[0647] The following detergent additive compositions were prepared according to the present invention:
33IIIIIILAS—5.05.0STPP30.0—20.0Zeolite A—35.020.0PB120.015.0—TAED10.08.0—Mannanase0.0010.010.01Protease0.30.30.3Amylase—0.060.06Minors, waterUp to 100%and miscellaneous



EXAMPLE 34

[0648] The following compact high density (0.96 kg/l) dishwashing detergent compositions were prepared according to the present invention:
34IIIIIIIVVVIVIIVIIISTPP——54.351.451.4——50.9Citrate35.017.0———46.140.2—Carbonate—17.514.014.014.0—8.032.1Bicarbonate—————25.4——Silicate32.014.814.810.010.01.025.03.1Metasilicate—2.5—9.09.0———PB11.99.77.87.87.8———PB48.6———————Percarbonate—————6.711.84.8Nonionic1.52.01.51.71.52.61.95.3TAED5.22.4———2.2—1.4HEDP—1.0——————DETPMP—0.6——————MnTACN——————0.008—PAAC——0.0080.010.007———BzP————1.4———Paraffin0.50.50.50.50.50.6——Mannanase0.0010.0010.0020.0020.0010.0030.0020.002Protease0.0720.0720.0290.0530.0460.0260.0590.06Amylase0.0120.0120.0060.0120.0130.0090.0170.03Lipase—0.001—0.005————BTA0.30.30.30.30.3—0.30.3MA/AA——————4.2—480N3.36.0—————0.9Perfume0.20.20.20.20.20.20.10.1Sulphate7.020.05.02.20.812.04.6—pH10.811.010.811.311.39.610.810.9MiscellaneousUp to 100%and water



EXAMPLE 35

[0649] The following granular dishwashing detergent compositions of bulk density 1.02 kg/liter were prepared according to the present invention:
35IIIIIIIVVVIVIIVIISTPP30.030.033.034.229.631.126.617.6Carbonate30.530.531.030.023.039.44.245.0Silicate7.47.47.57.213.33.443.712.4Metasilicate——4.55.1————Percarbonate—————4.0——PB14.44.24.54.5————NADCC————2.0—1.61.0Nonionic1.21.00.70.81.90.70.60.3TAED1.0————0.8——PAAC—0.0040.0040.004————BzP———1.4————Paraffin0.250.250.250.25————Mannanase0.0010.0010.0010.0010.0010.0010.0010.001Protease0.0360.0150.030.028—0.03——Amylase0.0030.0030.010.006—0.01——Lipase0.005—0.001—————BTA0.150.150.150.15————Perfume0.20.20.20.20.10.20.2—Sulphate23.425.022.018.530.119.323.123.6pH10.810.811.311.310.711.512.710.9MiscellaneousUp to 100%and water



EXAMPLE 36

[0650] The following tablet detergent compositions were prepared according to the present invention by compression of a granular dishwashing detergent composition at a pressure of 13 KN/cm2 using a standard 12 head rotary press:
36IIIIIIIVVVISTPP—48.849.238.0—46.8Citrate26.4———31.1—Carbonate—5.014.015.414.423.0Silicate26.414.815.012.617.72.4Mannanase0.0010.0010.0010.0010.0010.02Protease0.0580.0720.0410.0330.0520.013Amylase0.010.030.0120.0070.0160.002Lipase0.005—————PB11.67.712.210.615.7—PB46.9————14.4Nonionic1.52.01.51.650.86.3PAAC——0.020.009——MnTACN————0.007—TAED4.32.5——1.31.8HEDP0.7——0.7—0.4DETPMP0.65—————Paraffin0.40.50.50.55——BTA0.20.30.30.3——PA303.2—————MA/AA————4.50.55Perfume——0.050.050.20.2Sulphate24.013.02.3—10.73.4Weight of25 g25 g20 g30 g18 g20 gtabletpH10.610.610.710.710.911.2MiscellaneousUp to 100%and water



EXAMPLE 37

[0651] The following liquid dishwashing detergent compositions of density 1.40 kg/l were prepared according to the present invention:
37IIIIIIIVSTPP17.517.517.216.0Carbonate2.0—2.4—Silicate5.36.114.615.7NaOCl1.151.151.151.25Polygen/carbopol1.11.01.11.25Nonionic——0.1—NaBz0.750.75——Mannanase0.0010.0050.010.001NaOH—1.9—3.5KOH2.83.53.0—pH11.011.710.911.0Sulphate, miscellaneousup to 100%and water



EXAMPLE 38

[0652] The following liquid dishwashing compositions were prepared according to the present invention:
38IIIIIIIVVC17ES28.527.419.234.134.1Amine oxide2.65.02.03.03.0C12 glucose amide——6.0——Betaine0.9——2.02.0Xylene sulfonate2.04.0—2.0—Neodol C11E9——5.0——Polyhydroxy fatty———6.56.5acid amideSodium diethylene——0.03——penta acetate (40%)TAED———0.060.06Sucrose———1.51.5Ethanol4.05.55.59.19.1Alkyl diphenyl oxide————2.3disulfonateCa formate———0.51.1Ammonium citrate0.060.1———Na chloride—1.0———Mg chloride3.3—0.7——Ca chloride——0.4——Na sulfate——0.06——Mg sulfate0.08————Mg hydroxide———2.22.2Na hydroxide———1.11.1Hydrogen peroxide200 ppm0.160.006——Mannanase0.0010.050.0010.0010.015Protease0.0170.0050.0350.0030.002Perfume0.180.090.090.20.2Water and minorsUp to 100%



EXAMPLE 39

[0653] The following liquid hard surface cleaning compositions were prepared according to the present invention:
39IIIIIIIVVMannanase0.0010.00150.00150.050.01Amylase0.010.0020.005——Protease0.050.010.02——Hydrogen peroxide———6.06.8Acetyl triethyl citrate———2.5—DTPA———0.2—Butyl hydroxy toluene———0.05—EDTA*0.050.050.05——Citric/Citrate2.92.92.91.0—LAS0.50.50.5——C12 AS0.50.50.5——C10AS————1.7C12(E)S0.50.50.5——C12, 13 E6.5 nonionic7.07.07.0——Neodol 23-6.5———12.0—Dobanol 23-3————1.5Dobanol 91-10————1.6C25AE1.8S———6.0Na paraffin sulphonate———6.0Perfume1.01.01.00.50.2Propanediol———1.5Ethoxylated tetraethylene———1.0—pentaimine2, Butyl octanol————0.5Hexyl carbitol**1.01.01.0——SCS1.31.31.3——pH adjusted to7-127-127-124—Miscellaneous and waterUp to 100%*Na4 ethylenediamine diacetic acid **Diethylene glycol monohexyl ether



EXAMPLE 40

[0654] The following spray composition for cleaning of hard surfaces and removing household mildew was prepared according to the present invention:
40Mannanase0.01Amylase0.01Protease0.01Na octyl sulfate2.0Na dodecyl sulfate4.0Na hydroxide0.8Silicate0.04Butyl carbitol*4.0Perfume0.35Water/minorsup to 100%*Diethylene glycol monobutyl ether



LITERATURE

[0655] Aviv, H. & Leder, P., 1972, Proc. Natl. Acad. Sci. U.S.A. 69: 1408-1412.


[0656] Becker, D. M. & Guarante, L., 1991, Methods Enzymol., 194: 182-187.


[0657] Chirgwin, J. M., Przybyla, A. E., MacDonald, R. J. & Rutter, W. J., 1979, Biochemistry, 18: 5294-5299.


[0658] Gubler, U. & Hoffman, B. J., 1983, Gene 25: 263-269.


[0659] Sambrook, J., Fritsch, E. F. & Maniatis, T., 1989, Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Lab., Cold Spring Harbor, N.Y.


[0660] Sanger, F., Nicklen, S. & Coulson, A. R., 1977. Proc. Natl. Acad. Sci. U.S.A., 74: 5463-5467.


[0661] Lever, M. (1972) A new reaction for colormetric determination of carbohydrates. Anal. Biochem. 47, 273-279.


[0662] N. C. Carpita and D. M. Gibeaut, 1993, The Plant Journal, 3: 1-30.


[0663] Diderichsen, B., Wedsted, U., Hedegaard, L., Jensen, B. R., Sjøholm, C., 1990, Cloning of aldB, which encodes alpha-acetolactate decarboxylase, an exoenzyme from Bacillus brevis. J. Bacteriol., 172: 4315-4321.


Claims
  • 1. An isolated mannanase which is (a) a polypeptide encodable by the mannanase encoding part of the DNA sequence cloned into the plasmid present in Escherichia coli DSM 12197, or (b) a polypeptide comprising a sequence of amino acids 32-330 of SEQ ID NO: 2, or (c) a polypeptide encoded by the DNA sequence of nucleotides 94-990 or positions 94-1470 of SEQ ID NO: 1, or (d) an analogue of the polypeptide defined in (a) or (b) which is at least 65% homologous with said polypeptide, or a fragment of (a), (b) or (c).
  • 2. The mannanase of claim 1 which is derivable from a strain of Bacillus sp.
  • 3. The mannanase of claim 2 which has (a) a relative mannanase activity of at least 60% in the pH range 7.5-10, measured at 40° C.; (b) a molecular weight of 34±10 kDa, as determined by SDS-PAGE; and/or (c) an N-terminal sequence ANSGFYVSGTTLYDANG (amino acids 32-48 of SEQ ID NO: 2).
  • 4. An isolated polynucleotide molecule comprising a DNA sequence encoding an enzyme exhibiting mannanase activity, which DNA sequence comprises: (a) the mannanase encoding part of the DNA sequence cloned into the plasmid present in Escherichia coli DSM 12197; (b) the DNA sequence of nucleotides 94-1470 of SEQ ID NO: 1, preferably nucleotides 94-990, or its complementary strand; (c) an analogue of the DNA sequence defined in (a) or (b) which is at least 65% homologous with said DNA sequence; (d) a DNA sequence which hybridizes with a double-stranded DNA probe comprising the sequence of nucleotides 94-990 of SEQ ID NO: 1 at low stringency; (e) a DNA sequence which, because of the degeneracy of the genetic code, does not hybridize with the sequences of (b) or (d), but which codes for a polypeptide having exactly the same amino acid sequence as the polypeptide encoded by any of these DNA sequences; or (f) a DNA sequence which is a fragment of the DNA sequences specified in (a), (b), (c), (d), or (e).
  • 5. The polynucleotide molecule of claim 4, in which the DNA sequence encoding an enzyme exhibiting mannanase activity is obtained from a microorganism.
  • 6. An isolated polynucleotide molecule encoding a polypeptide having mannanase activity which polynucleotide molecule hybridizes to a denatured double-stranded DNA probe under medium stringency conditions, wherein the probe is selected from the group consisting of DNA probes comprising the sequence of nucleotides 94-990 of SEQ ID NO: 1, the sequence of nucleotides 94-1470 of SEQ ID NO: 1 and DNA probes comprising a subsequence of nucleotides 94-990 of SEQ ID NO: 1 having a length of at least about 100 base pairs.
  • 7. An expression vector comprising the following operably linked elements: a transcription promoter; a DNA segment selected from the group consisting of (a) polynucleotide molecules encoding a polypeptide having mannanase activity comprising a sequence of nucleotides 94-990 of SEQ ID NO: 1, (b) polynucleotide molecules encoding a polypeptide having mannanase activity that is at least 65% identical to the sequence of amino acids 32-330 of SEQ ID NO: 2, and (c) degenerate nucleotide sequences of (a) or (b); and a transcription terminator.
  • 8. A cultured cell into which has been introduced an expression vector of claim 7, wherein said cell expresses the polypeptide encoded by the DNA segment.
  • 9. An isolated polypeptide having mannanase activity selected from the group consisting of: (a) a polypeptide comprising a sequence of amino acids 32-330 of SEQ ID NO: 2; and (b) a polypeptide that has an amino acid sequence that is at least 65% identical to amino acids 32-330 of SEQ ID NO: 2.
  • 10. The polypeptide of claim 9 which is produced by Bacillus sp. I633.
  • 11. An enzyme preparation comprising a purified polypeptide of claim 9.
  • 12. A method of producing a polypeptide having mannanase activity comprising culturing a cell into which has been introduced an expression vector of claim 7, whereby said cell expresses a polypeptide encoded by the DNA segment; and recovering the polypeptide.
  • 13. The preparation of claim 11 which further comprises one or more enzymes selected from the group consisting of proteases, cellulases (endoglucanases), beta-glucanases, hemicellulases, lipases, peroxidases, laccases, alpha-amylases, glucoamylases, cutinases, pectinases, reductases, oxidases, phenoloxidases, ligninases, pullulanases, pectate lyases, xyloglucanases, xylanases, pectin acetyl esterases, polygalacturonases, rhamnogalacturonases, pectin lyases, other mannanases, pectin methylesterases, cellobiohydrolases, transglutaminases; and mixtures thereof.
  • 14. An isolated enzyme having mannanase activity, in which the enzyme is (i) free from homologous impurities, and (ii) produced by the method of claim 12.
  • 15. A method for improving the properties of cellulosic or synthetic fibers, yarn, woven or non-woven fabric, comprising treating the fibers, yarn or fabric with an effective amount of the preparation of claim 11 or an effective amount of the enzyme of claim 1.
  • 16. The method of claim 15, wherein the enzyme preparation or the enzyme is used in a desizing process step.
  • 17. A method for degradation or modification of plant material, comprising treating the plant material with an effective amount of the preparation of claim 11 or an effective amount of the enzyme of claim 1.
  • 18. The method of claim 17, wherein the plant material is recycled waste paper; mechanical, chemical, semichemical, kraft or other paper-making pulps; fibers subjected to a wetting process; or guar gum or locust bean gum containing material.
  • 19. A method for processing liquid coffee extract, comprising treating the coffee extract with an effective amount of the preparation of claim 11 or an effective amount of the enzyme of claim 1.
  • 20. A cleaning composition comprising the enzyme preparation of claim 11 or the enzyme of claim 1.
  • 21. The cleaning composition of claim 20, which further comprises an enzyme selected from cellulases, proteases, lipases, amylases, pectin degrading enzymes and xyloglucanases; and a conventional detergent ingredient.
  • 22. The cleaning composition of claim 20, wherein the enzyme or enzyme preparation is present at a level of from 0.0001% to 2% pure enzyme by weight of total composition.
  • 23. The cleaning composition of claim 21, wherein the enzyme is present at a level of from 0.0001% to 2% pure enzyme by weight of total composition.
  • 24. The cleaning composition of claim 21, wherein the enzyme is an amylase.
  • 25. The cleaning composition of claim 24, which further comprises yet another enzyme selected from cellulase, protease, lipase, pectin degrading enzyme and xyloglucanase.
  • 26. The cleaning composition of claim 21, which comprises a surfactant selected from anionic, nonionic, cationic surfactant, and/or mixtures thereof.
  • 27. The cleaning composition of claim 21, which comprises a bleaching agent.
  • 28. The cleaning composition of claim 21, which comprises a builder.
  • 29. A fabric softening composition of claim 21, which comprises a cationic surfactant comprising two long chain lengths.
  • 30. A process for machine treatment of fabrics, which comprises treating fabric during a washing cycle of a machine washing process with a washing solution containing the enzyme preparation of claim 11 or the enzyme of claim 1.
  • 31. An isolated mannanase which is (a1) a polypeptide encoded by the mannanase encoding part of the DNA sequence cloned into the plasmid present in Escherichia coli DSM 12180, or (b1) a polypeptide comprising a sequence of amino acids 32-344 of SEQ ID NO: 6, or (c1) an analogue of the polypeptide defined in (a) or (b) which is at least 85% homologous with said polypeptide, or a fragment of (a1), (b1) or (c1); (a2) a polypeptide encoded by the mannanase encoding part of the DNA sequence cloned into the plasmid present in Escherichia coli DSM 12433, or (b2) a polypeptide comprising a sequence of amino acids 32-362 of SEQ ID NO: 10, or (c2) an analogue of the polypeptide defined in (a) or (b) which is at least 85% homologous with said polypeptide, or a fragment of (a2), (b2) or (c2); (a3) a polypeptide encoded by the mannanase encoding part of the DNA sequence cloned into the plasmid present in Escherichia coli DSM 12441, or (b3) a polypeptide comprising a sequence of amino acids 33-331 of SEQ ID NO: 12, or (c3) an analogue of the polypeptide defined in (a) or (b) which is at least 85% homologous with said polypeptide, or a fragment of (a3), (b3) or (c3); (a4) a polypeptide encoded by the mannanase encoding part of the DNA sequence cloned into the plasmid present in Escherichia coli DSM 9984, or (b4) a polypeptide comprising a sequence of amino acids 166-488 of SEQ ID NO: 14, or (c4) an analogue of the polypeptide defined in (a) or (b) which is at least 85% homologous with said polypeptide, or a fragment of (a4), (b4) or (c4); (a5) a polypeptide encoded by the mannanase encoding part of the DNA sequence cloned into the plasmid present in Escherichia coli DSM 12432, or (b5) a polypeptide comprising a sequence of amino acids 68-369 of SEQ ID NO: 16, or (c5) an analogue of the polypeptide defined in (a) or (b) which is at least 85% homologous with said polypeptide, or a fragment of (a5), (b5) or (c5); (a6) a polypeptide encoded by the mannanase encoding part of the DNA sequence cloned into the plasmid present in Escherichia coli DSM 12849, or (b6) a polypeptide comprising a sequence of amino acids 29-320 of SEQ ID NO: 22, or (c6) an analogue of the polypeptide defined in (a) or (b) which is at least 85% homologous with said polypeptide, or a fragment of (a6), (b6) or (c6); (a7) a polypeptide encoded by the mannanase encoding part of the DNA sequence cloned into the plasmid present in Escherichia coli DSM 12180, or (b7) a polypeptide comprising a sequence of amino acids 301-625 of SEQ ID NO: 26, or (c7) an analogue of the polypeptide defined in (a) or (b) which is at least 85% homologous with said polypeptide, or a fragment of (a7), (b7) or (c7); (a8) a polypeptide encoded by the mannanase encoding part of the DNA sequence cloned into the plasmid present in Escherichia coli DSM 12851, or (b8) a polypeptide comprising a sequence of amino acids 166-496 of SEQ ID NO: 28, or (c8) an analogue of the polypeptide defined in (a) or (b) which is at least 85% homologous with said polypeptide, or a fragment of (a8), (b8) or (c8); (a9) a polypeptide encoded by the mannanase encoding part of the DNA sequence cloned into the plasmid present in Escherichia coli DSM 12852, or (b9) a polypeptide comprising a sequence of amino acids 26-361 of SEQ ID NO: 30, or (c9) an analogue of the polypeptide defined in (a) or (b) which is at least 85% homologous with said polypeptide, or a fragment of (a9), (b9) or (c9); (a10) a polypeptide encoded by the mannanase encoding part of the DNA sequence cloned into the plasmid present in Escherichia coli DSM 12436, or (b10) a polypeptide comprising a sequence of amino acids 593-903 of SEQ ID NO: 32, or (c10) an analogue of the polypeptide defined in (a) or (b) which is at least 85% homologous with said polypeptide, or a fragment of (a10), (b10) or (c10).
  • 32. An isolated mannanase, which is: (a) a polypeptide encoded by the DNA sequence cloned into the plasmid present in Escherichia coli DSM 12441, (b) a polypeptide comprising a sequence of amino acids 33-331 of SEQ ID NO: 12 or a fragment thereof that has mannanase activity, or (c) a polypeptide encoded by a DNA sequence that hybridizes with nucleotides 97-993 of SEQ ID NO: 11 under high stringency conditions.
  • 33. The mannanase of claim 32, which is encoded by the DNA sequence cloned into the plasmid present in Escherichia coli DSM 12441.
  • 34. The mannanase of claim 32, which has a sequence comprising amino acids 33-331 of SEQ ID NO: 12.
  • 35. The mannanase of claim 34, which consists of a sequence of amino acids 33-331 of SEQ ID NO: 12.
  • 36. The mannanase of claim 32, which is a fragment of the sequence of amino acids 33-331 of SEQ ID NO: 12, wherein the fragment has mannanase activity.
  • 37. The mannanase of claim 32, encoded by a DNA sequence that hybridizes with nucleotides 97-993 of SEQ ID NO: 11 under high stringency conditions.
  • 38. The mannanase of claim 37, which has an amino acid sequence that is at least 80% homologous with the sequence of amino acids 33-331 of SEQ ID NO: 12.
  • 39. The mannanase of claim 38, which has an amino acid sequence that is at least 85% homologous with the sequence of amino acids 33-331 of SEQ ID NO: 12.
  • 40. The mannanase of claim 39, which has an amino acid sequence that is at least 90% homologous with the sequence of amino acids 33-331 of SEQ ID NO: 12.
  • 41. The mannanase of claim 40, which has an amino acid sequence that is at least 95% homologous with the sequence of amino acids 33-331 of SEQ ID NO: 12.
  • 42. The mannanase of claim 41, which has an amino acid sequence that is at least 98% homologous with the sequence of amino acids 33-331 of SEQ ID NO: 12.
  • 43. The mannanase of claim 37, which is a Bacillus mannanase.
  • 44. The mannanase of claim 43, which is a Bacillus halodurans mannanase.
  • 45. An enzyme preparation comprising a mannanase of claim 32 and one or more enzymes selected from the group consisting of proteases, cellulases (endoglucanases), beta-glucanases, hemicellulases, lipases, peroxidases, laccases, alpha-amylases, glucoamylases, cutinases, pectinases, reductases, oxidases, phenoloxidases, ligninases, pullulanases, pectate lyases, xyloglucanases, xylanases, pectin acetyl esterases, polygalacturonases, rhamnogalacturonases, pectin lyases, other mannanases, pectin methylesterases, cellobiohydrolases, transglutaminases; and mixtures thereof.
  • 46. A cleaning composition, comprising a mannanase of claim 32 and a surfactant.
  • 47. A fabric softening composition, comprising a mannanase of claim 32, an enzyme selected from the group consisting of amylases, cellulases, lipases, pectin degrading enzymes, proteases and xyloglucanases, and a cationic surfactant comprising two long chain lengths.
Priority Claims (7)
Number Date Country Kind
PA 1998 01340 Oct 1998 DK
PA 1998 01341 Oct 1998 DK
PA 1998 01725 Dec 1998 DK
PA 1999 00306 Mar 1999 DK
PA 1999 00307 Mar 1999 DK
PA 1999 00308 Mar 1999 DK
PA 1999 00309 Mar 1999 DK
CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application is a divisional of U.S. application Ser. No. 09/339,159 filed Jun. 24, 1999, which is a continuation of application No. PCT/DK99/00314 filed Jun. 10, 1999, which is a continuation-in-part of application Ser. No. 09/111,256 filed Jun. 10, 1998, and claims priority or the benefit under 35 U.S.C. 119 of Danish application nos. PA 1998 01340, PA 1998 01341, PA 1998 01725, PA 1999 00306, PA 1999 00307, PA 1999 00308 and PA 1999 00309 filed Oct. 20, 1998, Oct. 20, 1998, Dec. 23, 1998, Mar. 5, 1999, Mar. 5, 1999, Mar. 5, 1999 and Mar. 5, 1999, respectively, and U.S. provisional application Nos. 60/105,970, 60/106,054, 60/123,543, 60/123,623, 60/123,641 and 60/123,642 filed Oct. 28, 1998, Oct. 28, 1998, Mar. 9, 1999, Mar. 10, 1999, Mar. 10, 1999 and Mar. 10, 1999, respectively, the contents of which are fully incorporated herein by reference.

Provisional Applications (6)
Number Date Country
60106054 Oct 1998 US
60105970 Oct 1998 US
60123543 Mar 1999 US
60123623 Mar 1999 US
60123641 Mar 1999 US
60123642 Mar 1999 US
Divisions (1)
Number Date Country
Parent 09339159 Jun 1999 US
Child 10372054 Feb 2003 US
Continuations (1)
Number Date Country
Parent PCT/DK99/00314 Jun 1999 US
Child 09339159 Jun 1999 US
Continuation in Parts (1)
Number Date Country
Parent 09111256 Jun 1998 US
Child PCT/DK99/00314 Jun 1999 US