Method for biocatalytic protein-oligonucleotide conjugation

Information

  • Patent Grant
  • 12077795
  • Patent Number
    12,077,795
  • Date Filed
    Monday, August 10, 2020
    4 years ago
  • Date Issued
    Tuesday, September 3, 2024
    6 months ago
Abstract
A composition comprising a polypeptide ligated to an oligonucleotide through a sterol linker. A method of ligating a polypeptide to an oligonucleotide, comprising a polypeptide having a hedgehog steroyl transferase catalytic domain at the C-terminal of the polypeptide with an electrophilic residue, e.g., glycine, between polypeptide and the hedgehog steroyl transferase catalytic domain, and a steroylated oligonucleotide in solution, and permitting a reaction to cleave the hedgehog steroyl transferase catalytic domain from the polypeptide while ligating the steroylated oligonucleotide to the glycine at the C-terminal of the polypeptide. The oligonucleotide may be, for example, a therapeutic, diagnostic, or affinity ligand.
Description
FIELD OF INVENTION

The present invention relates to a protein catalyst for the attachment of diverse chemical matter, specifically oligonucleotides, to a specific amino acid in a polypeptide substrate.


BACKGROUND

All references cited herein are expressly incorporated herein by reference in their entirety.


Site-specific selective protein modification procedures have been useful for oriented protein immobilization, for studies of naturally occurring post-translational modifications, for creating antibody-drug conjugates, for the introduction of fluorophores and other small molecules on to proteins, for examining protein structure, folding, dynamics, and protein-protein interactions, and for the preparation of protein-polymer conjugates. One approach for protein labeling is to incorporate biorthogonal functionalities into proteins at specific sites via enzymatic reactions. The incorporated sites then support chemoselective reactions, since reactions may be defined that are inert to normal biological materials, and occur selectively when the biorthogonal component is present. Known enzymes for site-specific ligation include formylglycine generating enzyme, sialyltransferases, phosphopantetheinyltransferases, O-GlcNAc post-translational modification, sortagging, transglutaminase, farnesyltransferase, biotin ligase, lipoic acid ligase, and N-myristoyltransferase.


Proteins, comprised of varying numbers of 20 distinct amino acid residues, arranged in a specific sequence, are the primary mediators of biological processes in all organisms, from single cell bacteria to humans. Techniques to manipulate the function of proteins can therefore find important applications in fundamental science as well as medicine and engineering. For example, the capacity to attach therapeutic chemical matter to specific amino acid residues in an antibody can pave the way for targeted therapeutics (i.e. antibody-drug conjugates). In addition, techniques to attach fluorophores or other optical probes to specific amino acid residues of an enzyme can prove useful for investigating the protein's spatial and temporal function in a specific biological process.


Joining together chemical matter with a protein (i.e. conjugation) requires at a minimum two reactive functional groups, such as a nucleophile and an electrophile, that, when combined in solution, chemically unite. Because proteins are metastable, suitable conjugation chemistry must involve functional groups that react together selectively without appreciable side-reactions; tolerate the presence of water, salts, and buffers; proceed at reasonable rates at ambient temperature; and progress to near completion so as to minimize post-reaction workup of the conjugated protein.


There are several proteins with conjugation activity that have been developed commercially. Prominent examples: Halotag (Promega) www.promega.com/products/pm/halotag-technology/halotag-technology/SNaP tag (New England Biolabs) www.neb.com/applications/protein-analysis-and-tools/proteinlabeling/protein-labeling-snap-clip Biotin ligase (Avidity) www.avidity.com/technologies/vitrobiotinylation-avitag-enzyme Sfp phosphopantetheinyltransferase (New England Biolabs) www.neb.com/products/p9302-sfp-synthase.


Of specific interest here is the conjugation of proteins to nucleic acids. Protein-DNA conjugates have been sought for fundamental and applied studies. In his 2010 review Niemeyer, Christof M. “Semisynthetic DNA-protein conjugates for biosensing and nanofabrication.” Angewandte Chemie International Edition 49, no. 7 (2010): 1200-1216 (www.ncbi.nlm.nih.gov/pubmed/20091721), Niemeyer identified a number of emerging areas, including bioanalytics (i.e immunoPCR); DNA directed immobilization of proteins (biochips); nanofabrication of protein assemblies (DNA arrays); and synthesis of medicinal nanoparticles bearing therapeutic proteins and peptides.


Current methods to conjugate proteins with nucleic acids depend on “spontaneous” chemical conjugation chemistry, such as disulfide bond formation, as opposed to conjugation catalyzed by a biomolecule. No enzyme has been fully described that can directly conjugate proteins with nucleic acids. Rather, methods in current use require installing reactive functional groups on the protein and separately, on the nucleic acid (Neimeyer, www.ncbi.nlm.nih.gov/pubmed/20091721). The chemically modified protein and nucleic acid are combined in a single tube and allowed to react. Often, these bimolecular reactions proceed slowly, requiring 24 h or more, and generate modest yields, see for example (Barbuto, Scott, Juliana Idoyaga, Miguel Vila-Perelló, Maria P. Longhi, Gaelle Breton, Ralph M. Steinman, and Tom W. Muir. “Induction of innate and adaptive immunity by delivery of poly dA: dT to dendritic cells.” Nature chemical biology 9, no. 4 (2013): 250-256, www.ncbi.nlm.nih.gov/pubmed/23416331). More recently, strategies have emerged that make use of activated esters as well as click chemistry, and appear to increase the speed conjugation; however they suffer from a lack of specificity with respect to the site (i.e. amino acid residue) of protein-nucleic acid conjugation (www.ncbi.nlm.nih.gov/pubmed/26947912).


See (each of which is expressly incorporated herein by reference in its entirety):

  • (1) Hackenberger, C. P. R., and Schwarzer, D. (2008) Chemo-selective Ligation and Modification Strategies for Peptides and Proteins. Angew. Chem., Int. Ed. 47, 10030-10074.
  • (2) Rabuka, D. (2010) Chemoenzymatic methods for site-specific protein modification. Curr. Opin. Chem. Biol. 14, 790-796.
  • (3) Carrico, I. S. (2008) Chemoselective modification of proteins: hitting the target. Chem. Soc. Rev. 37, 1423.
  • (4) Wong, S. S., Jameson, D. M., and Wong, S. S. (2012) Chemistry of protein and nucleic acid cross-linking and conjugation, Taylor & Francis/CRC Press, Boca Raton.
  • (5) Fontana, A., Spolaore, B., Mero, A., and Veronese, F. M. (2008) Site-specific modification and PEGylation of pharmaceutical proteins mediated by transglutaminase. Adv. Drug Delivery Rev. 60, 13-28.
  • (6) Junutula, J. R., Raab, H., Clark, S., Bhakta, S., Leipold, D. D., Weir, S., Chen, Y., Simpson, M., Tsai, S. P., Dennis, M. S., Lu, Y., Meng, Y. G., Ng, C., Yang, J., Lee, C. C., Duenas, E., Gorrell, J., Katta, V., Kim, A., McDorman, K., Flagella, K., Venook, R., Ross, S., Spencer, S. D., Lee Wong, W., Lowman, H. B., Vandlen, R., Sliwkowski, M. X., Scheller, R. H., Polakis, P., and Mallet, W. (2008) Site-specific conjugation of a cytotoxic drug to an antibody improves the therapeutic index. Nat. Biotechnol. 26, 925-932.
  • (7) Gauchet, C., Labadie, G. R., and Poulter, C. D. (2006) Regio- and chemoselective covalent immobilization of proteins through unnatural amino acids. J. Am. Chem. Soc. 128, 9274-9275.
  • (8) Kochendoerfer, G. G. (2005) Site-specific polymer modification of therapeutic proteins. Curr. Opin. Chem. Biol. 9, 555-560.
  • (9) Chen, I., Howarth, M., Lin, W., and Ting, A. Y. (2005) Site-specific labeling of cell surface proteins with biophysical probes using biotin ligase. Nat. Meth. 2, 99-104.
  • (10) Kohn, M. (2009) Immobilization strategies for small molecule, peptide and protein microarrays. J. Pept. Sci. 15, 393-397.
  • (11) Wong, L. S., Khan, F., and Micklefield, J. (2009) Selective covalent protein immobilization: strategies and applications. Chem. Rev. 109, 4025-4053.
  • (12) Tiefenbrunn, T. K., and Dawson, P. E. (2010) Chemoselective ligation techniques: Modern applications of time-honored chemistry. Biopolymers 94, 95-106.
  • (13) Wu, B.-Y., Hou, S.-H., Huang, L., Yin, F., Zhao, Z.-X., Anzai, J.-I., and Chen, Q. (2008) Oriented immobilization of immunoglobulin G onto the cuvette surface of the resonant mirror biosensor throughlayer-by-layer assembly of multilayer films. Mater. Sci. Eng., C 28, 1065-1069.
  • (14) Hermanson, G. T. (2008) Bioconjugate techniques, Academic Press, Amsterdam.
  • (15) Dixon, H. B. (1964) Transamination of peptides. Biochem. J. 92, 661-666.
  • (16) Wu, P., and Brand, L. (1997) N-terminal modification of proteins for fluorescence measurements. Meth. Enzymol. 278, 321-330.
  • (17) Scheck, R. A., Dedeo, M. T., lavarone, A. T., and Francis, M. B. (2008) Optimization of a biomimetic transamination reaction. J. Am. Chem. Soc. 130, 11762-11770.
  • (18) Geoghegan, K. F., and Stroh, J. G. (1992) Site-directed conjugation of nonpeptide groups to peptides and proteins via periodate oxidation of a 2-amino alcohol. Application to modification at N-terminal serine. Bioconjugate Chem. 3, 138-146.
  • (19) Akgul, C., Moulding, D. A., White, M. R., and Edwards, S. W. (2000) In vivo localisation and stability of human Mcl-1 using green fluorescent protein (GFP) fusion proteins. FEBS Lett. 478, 72-76.
  • (20) Dundr, M., McNally, J. G., Cohen, J., and Misteli, T. (2002) Quantitation of GFP-fusion proteins in single living cells. J. Struct. Biol. 140, 92-99.
  • (21) Kanda, T., Sullivan, K. F., and Wahl, G. M. (1998) Histone-GFP fusion protein enables sensitive analysis of chromosome dynamics in living mammalian cells. Curr. Biol. 8, 377-385.
  • (22) Marguet, D., Spiliotis, E. T., Pentcheva, T., Lebowitz, M., Schneck, J., and Edidin, M. (1999) Lateral diffusion of GFP-tagged H2Ld molecules and of GFP-TAP1 reports on the assembly and retention of these molecules in the endoplasmic reticulum. Immunity 11, 231-240.
  • (23) Lisenbee, C. S., Karnik, S. K., and Trelease, R. N. (2003) Overexpression and mislocalization of a tail-anchored GFP redefines the identity of peroxisomal ER. Traffic 4, 491-501.
  • (24) De Graaf, A. J., Kooijman, M., Hennink, W. E., and Mastrobattista, E. (2009) Nonnatural amino acids for site-specific protein conjugation. Bioconjugate Chem. 20, 1281-1295.
  • (25) Wang, L., Xie, J., and Schultz, P. G. (2006) Expanding the genetic code. Annu. Rev. Biophys. Biomol. Struct. 35, 225-249.
  • (26) Chen, P. R., Groff, D., Guo, J., Ou, W., Cellitti, S., Geierstanger, B. H., and Schultz, P. G. (2009) A facile system for encoding unnatural amino acids in mammalian cells. Angew. Chem., Int. Ed. 48, 4052-4055.
  • (27) Guo, J., Melancon, C. E., Lee, H. S., Groff, D., and Schultz, P. G. (2009) Evolution of amber suppressor tRNAs for efficient bacterial production of proteins containing nonnatural amino acids. Angew. Chem., Int. Ed. 48, 9148-9151.
  • (28) Chatterjee, A., Xiao, H., and Schultz, P. G. (2012) Evolution of multiple, mutually orthogonal prolyl-tRNA synthetase/tRNA pairs for unnatural amino acid mutagenesis in Escherichia coli. Proc. Natl. Acad. Sci. U.S.A. 109, 14841-14846.
  • (29) Huisgen, R., Szeimies, G., and Mobius, L. (1967) Chemische Berichte-Recueil. Chem. Ber. 100, 2494.
  • (30) Rostovtsev, V. V., Green, L. G., Fokin, V. V., and Sharpless, K. B. (2002) A stepwise huisgen cycloaddition process: copper(I)-catalyzed regioselective “ligation” of azides and terminal alkynes. Angew. Chem., Int. Ed. 41, 2596-2599.
  • (31) Kolb, H. C., Finn, M. G., and Sharpless, K. B. (2001) Click chemistry: diverse chemical function from a few good reactions. Angew. Chem., Int. Ed. 40, 2004-2021.
  • (32) Kohn, M., and Breinbauer, R. (2004) The Staudinger ligation←a gift to chemical biology. Angew. Chem., Int. Ed. 43, 3106-3116.
  • (33) Song, W., Wang, Y., Qu, J., Madden, M. M., and Lin, Q. (2008) A photoinducible 1,3-dipolar cycloaddition reaction for rapid, selective modification of tetrazole-containing proteins. Angew. Chem., Int. Ed. 47, 2832-2835.
  • (34) Song, W., Wang, Y., Qu, J., and Lin, Q. (2008) Selective functionalization of a genetically encoded alkene-containing protein via “photoclick chemistry” in bacterial cells. J. Am. Chem. Soc. 130, 9654-9655.
  • (35) De Araujo, A. D., Palomo, J. M., Cramer, J., Seitz, O., Alexandrov, K., and Waldmann, H. (2006) Diels-Alder ligation of peptides and proteins. Chem. Eur. J. 12, 6095-6109.
  • (36) De Araujo, A. D., Palomo, J. M., Cramer, J., Kohn, M., Schroder, H., Wacker, R., Niemeyer, C., Alexandrov, K., and Waldmann, H. (2006) Diels-Alder ligation and surface immobilization of proteins. Angew. Chem., Int. Ed. 45, 296-301.
  • (37) Liu, D. S., Tangpeerachaikul, A., Selvaraj, R., Taylor, M. T., Fox, J. M., and Ting, A. Y. (2012) Diels-Alder cycloaddition for fluorophore targeting to specific proteins inside living cells. J. Am. Chem. Soc. 134, 792-795.
  • (38) Blackman, M. L., Royzen, M., and Fox, J. M. (2008) Tetrazine ligation: fast bioconjugation based on inverse-electron-demand Diels-Alder reactivity. J. Am. Chem. Soc. 130, 13518-13519.
  • (39) Schoch, J., Wiessler, M., and Jaschke, A. (2010) Post-synthetic modification of DNA by inverse-electron-demand Diels-Alder reaction. J. Am. Chem. Soc. 132, 8846-8847.
  • (40) Cordes, E. H., and Jencks, W. P. (1962) Nucleophilic catalysis of semicarbazone formation by anilines. J. Am. Chem. Soc. 84, 826-831.
  • (41) Dirksen, A., Yegneswaran, S., and Dawson, P. E. (2010) Bisaryl hydrazones as exchangeable biocompatible linkers. Angew. Chem., Int. Ed., 2023-2027.
  • (42) Rashidian, M., Song, J. M., Pricer, R. E., and Distefano, M. D. (2012) Chemoenzymatic reversible immobilization and labeling of proteins without prior purification. J. Am. Chem. Soc. 134, 8455-8467.
  • (43) Miller, L. W., and Cornish, V. W. (2005) Selective chemical labeling of proteins in living cells. Curr. Opin. Chem. Biol. 9, 56-61.
  • (44) Sunbul, M., and Yin, J. (2009) Site specific protein labeling by enzymatic posttranslational modification. Org. Biomol. Chem. 7, 3361.
  • (45) Roeser, D., Preusser-Kunze, A., Schmidt, B., Gasow, K., Wittmann, J. G., Dierks, T., von Figura, K., and Rudolph, M. G. (2006) A general binding mechanism for all human sulfatases by the formylglycine-generating enzyme. Proc. Natl. Acad. Sci. U.S.A. 103, 81-86.
  • (46) Rush, J. S., and Bertozzi, C. R. (2008) New aldehyde tag sequences identified by screening formylglycine generating enzymes in vitro and in vivo. J. Am. Chem. Soc. 130, 12240-12241.
  • (47) Wu, P., Shui, W., Carlson, B. L., Hu, N., Rabuka, D., Lee, J., and Bertozzi, C. R. (2009) Site-specific chemical modification of recombinant proteins produced in mammalian cells by using the genetically encoded aldehyde tag. Proc. Natl. Acad. Sci. U.S.A. 106, 3000-3005.
  • (48) Rabuka, D., Rush, J. S., deHart, G. W., Wu, P., and Bertozzi, C. R. (2012) Site-specific chemical protein conjugation using genetically encoded aldehyde tags. Nat. Protoc. 7, 1052-1067.
  • (49) Bertozzi, C. R., and Kiessling, L. L. (2001) Chemical glycobiology. Science 291, 2357-2364.
  • (50) Angata, T., and Varki, A. (2002) Chemical diversity in the sialic acids and related alpha-keto acids: an evolutionary perspective. Chem. Rev. 102, 439-469.
  • (51) Bork, K., Horstkorte, R., and Weidemann, W. (2009) Increasing the sialylation of therapeutic glycoproteins: the potential of the sialic acid biosynthetic pathway. J. Pharm. Sci. 98, 3499-3508.
  • (52) Anthony, R. M., and Ravetch, J. V. (2010) A novel role for the IgG Fc glycan: the anti-inflammatory activity of sialylated IgG Fcs. J. Clin. Immunol. 30 (Suppl 1), S9-14.
  • (53) Yu, H., Chokhawala, H., Karpel, R., Yu, H., Wu, B., Zhang, J., Zhang, Y., Jia, Q., and Chen, X. (2005) A multifunctional Pasteurella multocida sialyltransferase: a powerful tool for the synthesis of sialoside libraries. J. Am. Chem. Soc. 127, 17618-17619.
  • (54) Yu, H., Huang, S., Chokhawala, H., Sun, M., Zheng, H., and Chen, X. (2006) Highly efficient chemoenzymatic synthesis of naturally occurring and non-natural α-2,6-linked sialosides: AP. damsela α-2,6-sialyltransferase with extremely flexible donor-substrate specificity. Angew. Chem., Int. Ed. 45, 3938-3944.
  • (55) Khedri, Z., Muthana, M. M., Li, Y., Muthana, S. M., Yu, H., Cao, H., and Chen, X. (2012) Probe sialidase substrate specificity using chemoenzymatically synthesized sialosides containing C9-modified sialic acid. Chem. Commun. 48, 3357-3359.
  • (56) Cane, D. E., Walsh, C. T., and Khosla, C. (1998) Harnessing the biosynthetic code: combinations, permutations, and mutations. Science 282, 63-68.
  • (57) Marahiel, M. A., Stachelhaus, T., and Mootz, H. D. (1997) Modular peptide synthetases involved in nonribosomal peptide synthesis. Chem. Rev. 97, 2651-2674.
  • (58) Staunton, J., and Weissman, K. J. (2001) Polyketide biosyn—thesis: a millennium review. Nat. Prod. Rep. 18, 380-416.
  • (59) Wakil, S. J., Stoops, J. K., and Joshi, V. C. (1983) Fatty acid synthesis and its regulation. Annu. Rev. Biochem. 52, 537-579.
  • (60) Walsh, C. T., Gehring, A. M., Weinreb, P. H., Quadri, L. E., and Flugel, R. S. (1997) Post-translational modification of polyketide and nonribosomal peptide synthases. Curr. Opin. Chem. Biol. 1, 309-315.
  • (61) Yin, J., Liu, F., Li, X., and Walsh, C. T. (2004) Labeling proteins with small molecules by site-specific posttranslational modification. J. Am. Chem. Soc. 126, 7754-7755.
  • (62) Zhou, Z., Cironi, P., Lin, A. J., Xu, Y., Hrvatin, S., Golan, D. E., Silver, P. A., Walsh, C. T., and Yin, J. (2007) Genetically encoded short peptide tags for orthogonal protein labeling by Sfp and AcpS phosphopantetheinyl transferases. ACS Chem. Biol. 2, 337-346.
  • (63) Clarke, K. M., Mercer, A. C., La Clair, J. J., and Burkart, M. D. (2005) In vivo reporter labeling of proteins via metabolic delivery of coenzyme A analogues. J. Am. Chem. Soc. 127, 11234-11235.
  • (64) Worthington, A. S., and Burkart, M. D. (2006) One-pot chemo-enzymatic synthesis of reporter-modified proteins. Org. Biomol. Chem. 4, 44.
  • (65) Kosa, N. M., Haushalter, R. W., Smith, A. R., and Burkart, M. D. (2012) Reversible labeling of native and fusion-protein motifs. Nat. Methods 9, 981-984.
  • (66) George, N., Pick, H., Vogel, H., Johnsson, N., and Johnsson, K. (2004) Specific labeling of cell surface proteins with chemically diverse compounds. J. Am. Chem. Soc. 126, 8896-8897.
  • (67) Cappellaro, C., Baldermann, C., Rachel, R., and Tanner, W. (1994) Mating type-specific cell-cell recognition of Saccharomyces cerevisiae: cell wall attachment and active sites of a- and alpha-agglutinin. EMBO J. 13, 4737-4744.
  • (68) Yin, J., Straight, P. D., McLoughlin, S. M., Zhou, Z., Lin, A. J., Golan, D. E., Kelleher, N. L., Kolter, R., and Walsh, C. T. (2005) Genetically encoded short peptide tag for versatile protein labeling by Sfp phosphopantetheinyl transferase. Proc. Natl. Acad. Sci. U.S.A. 102, 15815-15820.
  • (69) Wong, L. S., Thirlway, J., and Micklefield, J. (2008) Direct site-selective covalent protein immobilization catalyzed by a phospho-pantetheinyl transferase. J. Am. Chem. Soc. 130, 12456-12464.
  • (70) Vocadlo, D. J., Hang, H. C., Kim, E., Hanover, J. A., and Bertozzi, C. R. (2003) A chemical approach for identifying O-GlcNAc-modified proteins in cells. Proc. Natl. Acad. Sci. U.S.A. 100, 9116-9121.
  • (71) Saxon, E., and Bertozzi, C. R. (2000) Cell surface engineering by a modified Staudinger reaction. Science 287, 2007-2010.
  • (72) Khidekel, N., Arndt, S., Lamarre-Vincent, N., Lippert, A., Poulin-Kerstien, K. G., Ramakrishnan, B., Qasba, P. K., and Hsieh-Wilson, L. C. (2003) A chemoenzymatic approach toward the rapid and sensitive detection of O-GlcNAc posttranslational modifications. J. Am. Chem. Soc. 125, 16162-16163.
  • (73) Clark, P. M., Dweck, J. F., Mason, D. E., Hart, C. R., Buck, S. B., Peters, E. C., Agnew, B. J., and Hsieh-Wilson, L. C. (2008) Direct in-gel fluorescence detection and cellular imaging of O-GlcNAc-modified proteins. J. Am. Chem. Soc. 130, 11576-11577.
  • (74) Khidekel, N., Ficarro, S. B., Peters, E. C., and Hsieh-Wilson, L. C. (2004) Exploring the O-GlcNAc proteome: Direct identification of O-GlcNAc-modified proteins from the brain. Proc. Natl. Acad. Sci. U.S.A. 101, 13132-13137.
  • (75) Khidekel, N., Ficarro, S. B., Clark, P. M., Bryan, M. C., Swaney, D. L., Rexach, J. E., Sun, Y. E., Coon, J. J., Peters, E. C., and Hsieh-Wilson, L. C. (2007) Probing the dynamics of O-GlcNAc glycosylation in the brain using quantitative proteomics. Nat. Chem. Biol. 3, 339-348.
  • (76) Mazmanian, S. K., Liu, G., Ton-That, H., and Schneewind, O. (1999) Staphylococcus aureus sortase, an enzyme that anchors surface proteins to the cell wall. Science 285, 760-763.
  • (77) Tsukiji, S., and Nagamune, T. (2009) Sortase-mediated ligation: a gift from gram-positive bacteria to protein engineering. Chem-BioChem 10, 787-798.
  • (78) Popp, M. W., Antos, J. M., Grotenbreg, G. M., Spooner, E., and Ploegh, H. L. (2007) Sortagging: a versatile method for protein labeling. Nat. Chem. Biol. 3, 707-708.
  • (79) Tanaka, T., Yamamoto, T., Tsukiji, S., and Nagamune, T. (2008) Site-specific protein modification on living cells catalyzed by sortase. ChemBioChem 9, 802-807.
  • (80) Strijbis, K., Spooner, E., and Ploegh, H. L. (2012) Protein ligation in living cells using sortase. Traffic 13, 780-789.
  • (81) Mohlmann, S., Mahlert, C., Greven, S., Scholz, P., and Harrenga, A. (2011) In vitro sortagging of an antibody Fab fragment: overcoming unproductive reactions of sortase with water and lysine side chains. ChemBioChem 12, 1774-1780.
  • (82) Popp, M. W., Dougan, S. K., Chuang, T.-Y., Spooner, E., and Ploegh, H. L. (2011) Sortase-catalyzed transformations that improve the properties of cytokines. Proc. Natl. Acad. Sci. U.S.A. 108, 3169-3174.
  • (83) Antos, J. M., Miller, G. M., Grotenbreg, G. M., and Ploegh, H. L. (2008) Lipid modification of proteins through sortase-catalyzed transpeptidation. J. Am. Chem. Soc. 130, 16338-16343.
  • (84) Guo, X., Wang, Q., Swarts, B. M., and Guo, Z. (2009) Sortase-catalyzed peptide-glycosylphosphatidylinositol analogue ligation. J. Am. Chem. Soc. 131, 9878-9879.
  • (85) Wu, Z., Guo, X., and Guo, Z. (2011) Sortase A-catalyzed peptide cyclization for the synthesis of macrocyclic peptides and glycopeptides. Chem. Commun. 47, 9218.
  • (86) Sinisi, A., Popp, M. W.-L., Antos, J. M., Pansegrau, W., Savino, S., Nissum, M., Rappuoli, R., Ploegh, H. L., and Buti, L. (2012) Development of an influenza virus protein array using sortagging technology. Bioconjugate Chem. 23, 1119-1126.
  • (87) Witte, M. D., Cragnolini, J. J., Dougan, S. K., Yoder, N. C., Popp, M. W., and Ploegh, H. L. (2012) Preparation of unnatural N-to-N and C-to-C protein fusions. Proc. Natl. Acad. Sci. U.S.A. 109, 11993-11998.
  • (88) Williamson, D. J., Fascione, M. A., Webb, M. E., and Turnbull, W. B. (2012) Efficient N-terminal labeling of proteins by use of sortase. Angew. Chem., Int. Ed. 124, 9511-9514.
  • (89) Claessen, J. H. L., Witte, M. D., Yoder, N. C., Zhu, A. Y., Spooner, E., and Ploegh, H. L. (2013) Catch-and-release probes applied to semi-intact cells reveal ubiquitin-specific protease expression in Chlamydia trachomatis infection. ChemBioChem 14, 343-352.
  • (90) Jeger, S., Zimmermann, K., Blanc, A., Grunberg, J., Honer, M., Hunziker, P., Struthers, H., and Schibli, R. (2010) Site-specific and stoichiometric modification of antibodies by bacterial transglutaminase. Angew. Chem., Int. Ed. 49, 9995-9997.
  • (91) Mero, A., Spolaore, B., Veronese, F. M., and Fontana, A. (2009) Transglutaminase-mediated PEGylation of proteins: direct identification of the sites of protein modification by mass spectrometry using a novel monodisperse PEG. Bioconjugate Chem. 20, 384-389.
  • (92) Abe, H., Goto, M., and Kamiya, N. (2011) Protein lipidation catalyzed by microbial transglutaminase. Chem.custom characterEur. J. 17, 14004-14008.
  • (93) Tanaka, T., Kamiya, N., and Nagamune, T. (2005) N-terminal glycine-specific protein conjugation catalyzed by microbial trans-glutaminase. FEBS Lett. 579, 2092-2096.
  • (94) Tominaga, J., Kamiya, N., Doi, S., Ichinose, H., Maruyama, T., and Goto, M. (2005) Design of a specific peptide tag that affords covalent and site-specific enzyme immobilization catalyzed by microbial transglutaminase. Biomacromolecules 6, 2299-2304.
  • (95) Lin, C.-W., and Ting, A. Y. (2006) Transglutaminase-catalyzed site-specific conjugation of small-molecule probes to proteins in vitro and on the surface of living cells. J. Am. Chem. Soc. 128, 4542-4543.
  • (96) Duckworth, B. P., Xu, J., Taton, T. A., Guo, A., and Distefano, M. D. (2006) Site-specific, covalent attachment of proteins to a solid surface. Bioconjugate Chem. 17, 967-974.
  • (97) Kho, Y. (2004) A tagging-via-substrate technology for detection and proteomics of farnesylated proteins. Proc. Natl. Acad. Sci. U.S.A. 101, 12479-12484.
  • (98) Duckworth, B. P., Zhang, Z., Hosokawa, A., and Distefano, M. D. (2007) Selective labeling of proteins by using protein farnesyltransferase. ChemBioChem 8, 98-105.
  • (99) Rashidian, M., Dozier, J. K., Lenevich, S., and Distefano, M. D. (2010) Selective labeling of polypeptides using protein farnesyl-transferase via rapid oxime ligation. Chem. Commun. 46, 8998-9000.
  • (100) Nguyen, U. T. T., Guo, Z., Delon, C., Wu, Y., Deraeve, C., Franzel, B., Bon, R. S., Blankenfeldt, W., Goody, R. S., Waldmann, H., Wolters, D., and Alexandrov, K. (2009) Analysis of the eukaryotic prenylome by isoprenoid affinity tagging. Nat. Chem. Biol. 5, 227-235.
  • (101) Subramanian, T., Pais, J. E., Liu, S., Troutman, J. M., Suzuki, Y., Leela Subramanian, K., Fierke, C. A., Andres, D. A., and Spielmann, H. P. (2012) Farnesyl diphosphate analogues with aryl moieties are efficient alternate substrates for protein farnesyltransferase. Biochemistry 51, 8307-8319.
  • (102) Labadie, G. R., Viswanathan, R., and Poulter, C. D. (2007) Farnesyl diphosphate analogues with ω-bioorthogonal azide and alkyne functional groups for protein farnesyl transferase-catalyzed ligation reactions. J. Org. Chem. 72, 9291-9297.
  • (103) Weinrich, D., Lin, P.-C., Jonkheijm, P., Nguyen, U. T. T., Schröder, H., Niemeyer, C. M., Alexandrov, K., Goody, R., and Waldmann, H. (2010) Oriented immobilization of farnesylated proteins by the thiol-ene reaction. Angew. Chem., Int. Ed. 49, 1252-1257.
  • (104) Nguyen, U. T. T., Cramer, J., Gomis, J., Reents, R., Gutierrez-Rodriguez, M., Goody, R. S., Alexandrov, K., and Waldmann, H. (2007) Exploiting the substrate tolerance of farnesyltransferase for site-selective protein derivatization. ChemBioChem 8, 408-423.
  • (105) Rose, M. W., Xu, J., Kale, T. A., O'Doherty, G., Barany, G., and Distefano, M. D. (2005) Enzymatic incorporation of orthogonally reactive prenylazide groups into peptides using geranylazide diphosphate via protein farnesyltransferase: implications for selective protein labeling. Biopolymers 80, 164-171.
  • (106) Rose, M. W., Rose, N. D., Boggs, J., Lenevich, S., Xu, J., Barany, G., and Distefano, M. D. (2005) Evaluation of geranylazide and farnesylazide diphosphate for incorporation of prenylazides into a CAAX box-containing peptide using protein farnesyltransferase. J. Pept. Res. 65, 529-537.
  • (107) Xu, J., DeGraw, A. J., Duckworth, B. P., Lenevich, S., Tann, C.-M., Jenson, E. C., Gruber, S. J., Barany, G., and Distefano, M. D. (2006) Synthesis and reactivity of 6,7-dihydrogeranylazides: reagents for primary azide incorporation into peptides and subsequent Staudinger ligation. Chem. Biol. Drug. Des. 68, 85-96.
  • (108) Duckworth, B. P., Chen, Y., Wollack, J. W., Sham, Y., Mueller, J. D., Taton, T. A., and Distefano, M. D. (2007) A universal method for the preparation of covalent protein-DNA conjugates for use in creating protein nanostructures. Angew. Chem. 119, 8975-8978.
  • (109) Khatwani, S. L., Kang, J. S., Mullen, D. G., Hast, M. A., Beese, L. S., Distefano, M. D., and Taton, T. A. (2012) Covalent protein-oligonucleotide conjugates by copper-free click reaction. Bioorg. Med. Chem. 20, 4532-4539.
  • (110) Speers, A. E., and Cravatt, B. F. (2004) Profiling enzyme activities in vivo using click chemistry methods. Chem. Biol. 11, 535-546.
  • (111) Hosokawa, A., Wollack, J. W., Zhang, Z., Chen, L., Barany, G., and Distefano, M. D. (2007) Evaluation of an alkyne-containing analogue of farnesyl diphosphate as a dual substrate for protein-prenyltransferases. Int. J. Pept. Res. Ther. 13, 345-354.
  • (112) Wollack, J. W., Silverman, J. M., Petzold, C. J., Mougous, J. D., and Distefano, M. D. (2009) A minimalist substrate for enzymatic peptide and protein conjugation. ChemBioChem 10, 2934-2943.
  • (113) Mahmoodi, M. M., Rashidian, M., Dozier, J. K., and Distefano, M. D. (2013) Chemoenzymatic reversible immobilization and labeling of proteins from crude cellular extract. Curr. Protoc. Chem. Biol., 89-109.
  • (114) Dirksen, A., Hackeng, T. M., and Dawson, P. E. (2006) Nucleophilic catalysis of oxime ligation. Angew. Chem., Int. Ed. 45, 7581-7584.
  • (115) Rashidian, M., Mahmoodi, M. M., Shah, R., Dozier, J. K., Wagner, C. R., and Distefano, M. D. (2013) A highly efficient catalyst for oxime ligation and hydrazone-oxime exchange suitable for bioconjugation. Bioconjugate Chem. 24, 333-342.
  • (116) Crisalli, P., and Kool, E. T. (2013) Water-soluble organo-catalysts for hydrazone and oxime formation. J. Org. Chem. 78, 1184-1189.
  • (117) Algar, W. R., Prasuhn, D. E., Stewart, M. H., Jennings, T. L., Blanco-Canosa, J. B., Dawson, P. E., and Medintz, I. L. (2011) The controlled display of biomolecules on nanoparticles: a challenge suited to bioorthogonal chemistry. Bioconjugate Chem. 22, 825-858.
  • (118) Howarth, M., Takao, K., hayashi, Y., and Ting, A. Y. (2005) Targeting quantum dots to surface proteins in living cells with biotin ligase. Proc. Natl. Acad. Sci. U.S.A. 102, 7583-7588.
  • (119) Howarth, M., Liu, W., Puthenveetil, S., Zheng, Y., Marshall, L. F., Schmidt, M. M., Wittrup, K. D., Bawendi, M. G., and Ting, A. Y. (2008) Monovalent, reduced-size quantum dots for imaging receptors on living cells. Nat. Meth. 5, 397-399.
  • (120) Slavoff, S. A., Chen, I., Choi, Y.-A., and Ting, A. Y. (2008) Expanding the substrate tolerance of biotin ligase through exploration of enzymes from diverse species. J. Am. Chem. Soc. 130, 1160-1162.
  • (121) Fernandez-Suarez, M., Chen, T. S., and Ting, A. Y. (2008) Protein-protein interaction detection in vitro and in cells by proximity biotinylation. J. Am. Chem. Soc. 130, 9251-9253.
  • (122) Sueda, S., Yoneda, S., and Hayashi, H. (2011) Site-specific labeling of proteins by using biotin protein ligase conjugated with fluorophores. ChemBioChem 12, 1367-1375.
  • (123) Roux, K. J., Kim, D. I., Raida, M., and Burke, B. (2012) A promiscuous biotin ligase fusion protein identifies proximal and interacting proteins in mammalian cells. J. Cell Biol. 196, 801-810.
  • (124) Fernandez-Suarez, M., Baruah, H., Martinez-Hernandez, L., Xie, K. T., Baskin, J. M., Bertozzi, C. R., and Ting, A. Y. (2007) Redirecting lipoic acid ligase for cell surface protein labeling with small-molecule probes. Nat. Biotechnol. 25, 1483-1487.
  • (125) Cohen, J. D., Thompson, S., and Ting, A. Y. (2011) Structure-guided engineering of a pacific blue fluorophore ligase for specific protein imaging in living cells. Biochemistry 50, 8221-8225.
  • (126) Uttamapinant, C., White, K. A., Baruah, H., Thompson, S., Fernandez-Suarez, M., Puthenveetil, S., and Ting, A. Y. (2010) From the cover: a fluorophore ligase for site-specific protein labeling inside living cells. Proc. Natl. Acad. Sci. U.S.A. 107, 10914-10919.
  • (127) Slavoff, S. A., Liu, D. S., Cohen, J. D., and Ting, A. Y. (2011) Imaging protein-protein interactions inside living cells via interaction-dependent fluorophore ligation. J. Am. Chem. Soc. 133, 19769-19776.
  • (128) Cohen, J. D., Zou, P., and Ting, A. Y. (2012) Site-specific protein modification using lipoic acid ligase and bis-aryl hydrazone formation. ChemBioChem 13, 888-894.
  • (129) Uttamapinant, C., Tangpeerachaikul, A., Grecian, S., Clarke, S., Singh, U., Slade, P., Gee, K. R., and Ting, A. Y. (2012) Fast, cell-compatible click chemistry with copper-chelating azides for bio-molecular labeling. Angew. Chem., Int. Ed. 51, 5852-5856.
  • (130) Yao, J. Z., Uttamapinant, C., Poloukhtine, A., Baskin, J. M., Codelli, J. A., Sletten, E. M., Bertozzi, C. R., Popik, V. V., and Ting, A. Y. (2012) Fluorophore targeting to cellular proteins via enzyme-mediated azide ligation and strain-promoted cycloaddition. J. Am. Chem. Soc. 134, 3720-3728.
  • (131) Farazi, T. A., Waksman, G., and Gordon, J. I. (2001) The biology and enzymology of protein N-myristoylation. J. Biol. Chem. 276, 39501-39504.
  • (132) Towler, D. A., Gordon, J. I., Adams, S. P., and Glaser, L. (1988) The biology and enzymology of eukaryotic protein acylation. Annu. Rev. Biochem. 57, 69-99.
  • (133) Price, H. P., Menon, M. R., Panethymitaki, C., Goulding, D., McKean, P. G., and Smith, D. F. (2003) Myristoyl-CoA:protein N-myristoyltransferase, an essential enzyme and potential drug target in kinetoplastid parasites. J. Biol. Chem. 278, 7206-7214.
  • (134) Martinez, A., Traverso, J. A., Valot, B., Ferro, M., Espagne, C., Ephritikhine, G., Zivy, M., Giglione, C., and Meinnel, T. (2008) Extent of N-terminal modifications in cytosolic proteins from eukaryotes. Proteomics 8, 2809-2831.
  • (135) Wright, M. H., Heal, W. P., Mann, D. J., and Tate, E. W. (2010) Protein myristoylation in health and disease. J. Chem. Biol. 3, 19-35.
  • (136) Heal, W. P., Wickramasinghe, S. R., Bowyer, P. W., Holder, A. A., Smith, D. F., Leatherbarrow, R. J., and Tate, E. W. (2008) Site-specific N-terminal labelling of proteins in vitro and in vivo using N-myristoyl transferase and bioorthogonal ligation chemistry. Chem. Commun., 480.
  • (137) Heal, W. P., Wickramasinghe, S. R., Leatherbarrow, R. J., and Tate, E. W. (2008) N-Myristoyl transferase-mediated protein labelling in vivo. Org. Biomol. Chem. 6, 2308.
  • (138) Heal, W. P., Wright, M. H., Thinon, E., and Tate, E. W. (2012) Multifunctional protein labeling via enzymatic N-terminal tagging and elaboration by click chemistry. Nat. Protoc. 7, 105-117.


DEFINITIONS

It must be noted that as used herein and in the appended claims, the singular forms “a”, “an”, and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “a compound” includes a plurality of compounds.


Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the present disclosure belongs. As used herein the following terms have the following meanings.


As used herein, the term “about” when used before a numerical designation, e.g., temperature, time, amount, concentration, and such other, including a range, indicates approximations which may vary by (+) or (−) 10%, 5% or 1%.


As used herein, the term “administration” may be effected in one dose, continuously or intermittently or by several subdoses which in the aggregate provide for a single dose. Dosing can be conducted throughout the course of treatment. Methods of determining the most effective means and dosage of administration are known to those of skill in the art and will vary with the composition used for therapy, the purpose of the therapy, the target cell being treated and the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician. Suitable dosage formulations and methods of administering the agents are known in the art. Route of administration can also be determined and method of determining the most effective route of administration are known to those of skill in the art and will vary with the composition used for treatment, the purpose of the treatment, the health condition or disease stage of the subject being treated and target cell or tissue. Non-limiting examples of route of administration include intratumoral delivery, peritumoral delivery, intraperitoneal delivery, intrathecal delivery, intramuscular injection, subcutaneous injection, intravenous delivery, nasal spray and other mucosal delivery (e.g. transmucosal delivery), intra-arterial delivery, intraventricular delivery, intrasternal delivery, intracranial delivery, intradermal injection, electroincorporation (e.g., with electroporation), ultrasound, jet injector, oral and topical patches.


A “therapeutic agent,” as used herein, may be a molecule, or compound that is useful in treatment of a disease or condition. A “therapeutically effective amount,” “therapeutically effective concentration” or “therapeutically effective dose” is the amount of a compound that produces a desired therapeutic effect in a subject, such as preventing or treating a target condition, alleviating symptoms associated with the condition, producing a desired physiological effect, or allowing imaging or diagnosis of a condition that leads to treatment of the disease or condition. The precise therapeutically effective amount is the amount of the composition that will yield the most effective results in terms of efficacy of treatment in a given subject. This amount will vary depending upon a variety of factors, including, but not limited to, the characteristics of the therapeutic compound (including activity, pharmacokinetics, pharmacodynamics, and bioavailability), the physiological condition of the subject (including age, sex, disease type and stage, general physical condition, responsiveness to a given dosage, and type of medication), the nature of the pharmaceutically acceptable carrier or carriers in the formulation, and the route of administration. One skilled in the clinical and pharmacological arts will be able to determine a therapeutically effective amount through routine experimentation, namely by monitoring a subject's response to administration of a compound and adjusting the dosage accordingly. For additional guidance, see Remington: The Science and Practice of Pharmacy 21st Edition, Univ. of Sciences in Philadelphia (USIP), Lippincott Williams & Wilkins, Philadelphia, Pa., 2005.


As used herein, “in combination” or “in combination with,” when used herein in the context of multiple agents, therapeutics, or treatments, means in the course of treating the same disease or condition in a subject administering two or more agents, drugs, treatment regimens, treatment modalities or a combination thereof. This includes simultaneous administration (or “coadministration”), administration of a first agent prior to or after administration of a second agent, as well as in a temporally spaced order of up to several days apart. Such combination treatment may also include more than a single administration of any one or more of the agents, drugs, treatment regimens or treatment modalities. Further, the administration of the two or more agents, drugs, treatment regimens, treatment modalities or a combination thereof may be by the same or different routes of administration.


“Treating” or “treatment” of a condition, disease or disorder may refer to preventing the condition, disease or disorder, slowing the onset or rate of development of the condition, disease or disorder, reducing the risk of developing the condition, disease or disorder, preventing or delaying the development of symptoms associated with the condition, disease or disorder, reducing or ending symptoms associated with the condition, disease or disorder, generating a complete or partial regression of the condition, disease or disorder, or some combination thereof. Examples of neoplastic diseases or disorders include colorectal cancer, osteosarcoma, non-small cell lung cancer, breast cancer, ovarian cancer, glial cancer, solid tumors, metastatic tumor, acute lymphoblastic leukemia, acute myelogenous leukemia, adrenocortical carcinoma, Kaposi sarcoma, lymphoma, anal cancer, astrocytomas, basal cell carcinoma, bile duct cancer, bladder cancer, bone cancer, brain tumor, breast cancer, bronchial tumor, cervical cancer, chronic lymphocytic leukemia, chronic myelogenous leukemia, chronic myeloproliferative disorders, colon cancer, colorectal cancers, ductal carcinoma in situ, endometrial cancer, esophageal cancer, eye cancer, intraocular, retinoblastoma, metastatic melanoma, gallbladder cancer, gastric cancer, gastrointestinal carcinoid tumor, gastrointestinal stromal tumors, glioblastoma, glioma, hairy cell leukemia, head and neck cancer, hepatocellular carcinoma, hepatoma, Hodgkin lymphoma, hypopharyngeal cancer, Langerhans cell histiocytosis, laryngeal cancer, lip and oral cavity cancer, liver cancer, lobular carcinoma in situ, lung cancer, non-small cell lung cancer, small cell lung cancer, lymphoma, AIDS-related lymphoma, Burkitt lymphoma, non-Hodgkin lymphoma, cutaneous T-cell lymphoma, melanoma, squamous neck cancer, mouth cancer, multiple myeloma, myelodysplastic syndromes, myelodysplastic/myeloproliferative neoplasms, nasal cavity and paranasal sinus cancer, nasopharyngeal cancer, neuroblastoma, oral cavity cancer, oropharyngeal cancer, osteosarcoma, ovarian cancer, pancreatic carcinoma, papillary carcinomas, parathyroid cancer, penile cancer, pharyngeal cancer, pheochromocytoma, pineal parenchymal tumors, pineoblastoma, pituitary tumor, pleuropulmonary blastoma, primary central nervous system lymphoma, prostate cancer, rectal cancer, renal cell cancer, salivary gland cancer, sarcoma, Ewing sarcoma, soft tissue sarcoma, squamous cell carcinoma, Sezary syndrome, skin cancer, Merkel cell carcinoma, testicular cancer, throat cancer, thymoma, thymic carcinoma, thyroid cancer, urethral cancer, endometrial cancer, uterine cancer, uterine sarcoma, vaginal cancer, vulvar cancer, Waldenstrom macroglobulinemia, and Wilms tumor.


“Tumor”, as used herein, refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues. The terms “cancer”, “cancerous”, “cell proliferative disorder”, “proliferative disorder” and “tumor” are not mutually exclusive as referred to herein. Tumor or cancer status may also be assessed by sampling for the number, concentration or density of tumor or cancer cells, alone or with respect to a reference. In accordance with the practice of the invention, inhibiting a tumor may be measured in any way as is known and accepted in the art, including complete regression of the tumor(s) (complete response); reduction in size or volume of the tumor(s) or even a slowing in a previously observed growth of a tumor(s), e.g., at least about a 10-30% decrease in the sum of the longest diameter (LD) of a tumor, taking as reference the baseline sum LD (partial response); mixed response (regression or stabilization of some tumors but not others); or no apparent growth or progression of tumor(s) or neither sufficient shrinkage to qualify for partial response nor sufficient increase to qualify for progressive disease, taking as reference the smallest sum LD since the treatment started (stable disease).


“Polynucleotide,” or “nucleic acid,” as used interchangeably herein, refer to polymers of nucleotides of any length, and include DNA and RNA. “oligonucleotide” refers to a nucleotide having a chain length of less than 250 nucleotides. The nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides, and/or their analogs, including epigenetically modified variants, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase, or by a synthetic reaction.


A “subject” is a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, farm animals (such as cows), pets (such as cats, dogs and horses), primates, mice and rats.


An “effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.


A “therapeutically effective amount” of a substance/molecule of the invention, agonist or antagonist may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the substance/molecule, agonist or antagonist to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the substance/molecule, agonist or antagonist are outweighed by the therapeutically beneficial effects. A “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.


According to the present invention, where administration includes a pharmaceutical formulation, preferably the formulation is a unit dosage containing a daily dose or unit, daily sub-dose or an appropriate fraction thereof, of the active ingredient (also referred to herein as a therapeutic agent).


The compositions of the invention can be administered by any parenteral route, in the form of a pharmaceutical formulation comprising the active ingredient, optionally in the form of a nontoxic organic, or inorganic, acid, or base, addition salt, in a pharmaceutically acceptable dosage form. Depending upon the disorder and patient to be treated, as well as the route of administration, the compositions may be administered at varying doses.


In human therapy, compositions of the invention may be administered alone but may generally be administered in admixture with a suitable pharmaceutical excipient diluent or carrier selected with regard to the intended route of administration and standard pharmaceutical practice.


In embodiments of the present invention in which polypeptides or polynucleotides of the invention are administered parenterally, such administration can be, for example, intravenously, intra-arterially, intraperitoneally, intrathecally, intraventricularly, intracisternally, intracranially, intramuscularly or subcutaneously, or they may be administered by infusion techniques. They are best used in the form of a sterile aqueous solution which may contain other substances, for example, enough salts or glucose to make the solution isotonic with blood. The aqueous solutions should be suitably buffered (preferably to a pH of from 3 to 9), if necessary. The preparation of suitable parenteral formulations under sterile conditions is readily accomplished by standard pharmaceutical techniques well-known to those skilled in the art.


Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents. The formulations may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use. Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets of the kind previously described.


Therapeutic formulations may be prepared for storage by mixing an active component having the desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers (Remington: The Science and Practice of Pharmacy 20th edition (2000)), in the form of aqueous solutions, lyophilized or other dried formulations. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, histidine and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g., Zn-protein complexes); and/or non-ionic surfactants such as TWEEN™, PLURONICS™ or polyethylene glycol (PEG).


The formulation may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. Such molecules are suitably present in combination in amounts that are effective for the purpose intended.


The active ingredients may also be entrapped in microcapsule prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsule and poly-(methylmethacylate) microcapsule, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington: The Science and Practice of Pharmacy 20th edition (2000).


The formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes. When appropriate, chemical or radiation sterilization method may be used.


Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the immunoglobulin of the invention, which matrices are in the form of shaped articles, e.g., films, or microcapsule. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and .gamma.-ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT™ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(−)-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods. When encapsulated immunoglobulins remain in the body for a long time, they may denature or aggregate as a result of exposure to moisture at 37 C., resulting in a loss of biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular S—S bond formation through thio-disulfide interchange, stabilization may be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions. The formulation may also be an immediate-release formulation. The formation may also be a combination of an immediate-release formulation and a sustained-release formulation.


The medicaments and/or pharmaceutical compositions may be present in a unit dosage containing a daily dose or unit, daily sub-dose or an appropriate fraction thereof, of the active ingredient.


The agents, medicaments and pharmaceutical compositions of the invention may be administered orally or by any parenteral route, in the form of a pharmaceutical composition comprising the active ingredient, optionally in the form of a non-toxic organic, or inorganic, acid, or base, addition salt, in a pharmaceutically acceptable dosage form. Depending upon the disorder and patient to be treated, as well as the route of administration, the compositions may be administered at varying doses.


In human therapy, the agents, medicaments and pharmaceutical compositions of the invention can be administered alone but will generally be administered in admixture with a suitable pharmaceutical excipient, diluent or carrier selected with regard to the intended route of administration and standard pharmaceutical practice.


For example, the agents, medicaments and pharmaceutical compositions of the invention can be administered orally, buccally or sublingually in the form of tablets, capsules, ovules, elixirs, solutions or suspensions, which may contain flavoring or coloring agents, for immediate-, delayed- or controlled-release applications. Such tablets may contain excipients such as microcrystalline cellulose, lactose, sodium citrate, calcium carbonate, dibasic calcium phosphate and glycine, disintegrants such as starch (preferably corn, potato or tapioca starch), sodium starch glycollate, croscarmellose sodium and certain complex silicates, and granulation binders such as polyvinylpyrrolidone, hydroxypropylmethylcellulose (HPMC), hydroxy-propylcellulose (HPC), sucrose, gelatin and acacia. Additionally, lubricating agents such as magnesium stearate, stearic acid, glyceryl behenate and talc may be included. Solid compositions of a similar type may also be employed as fillers in gelatin capsules. Preferred excipients in this regard include lactose, starch, cellulose, milk sugar or high molecular weight polyethylene glycols. For aqueous suspensions and/or elixirs, the agents, medicaments and pharmaceutical compositions of the invention may be combined with various sweetening or flavoring agents, coloring matter or dyes, with emulsifying and/or suspending agents and with diluents such as water, ethanol, propylene glycol and glycerin, and combinations thereof.


The agents, medicaments and pharmaceutical compositions can be administered parenterally, for example, intravenously, intra-arterially, intraperitoneally, intra-thecally, intraventricularly, intrasternally, intracranially, intra-muscularly or subcutaneously, or they may be administered by infusion techniques. They are best used in the form of a sterile aqueous solution which may contain other substances, for example, enough salts or glucose to make the solution isotonic with blood. The aqueous solutions should be suitably buffered (preferably to a pH of from 3 to 9), if necessary. The preparation of suitable parenteral formulations under sterile conditions is readily accomplished by standard pharmaceutical techniques well-known to those skilled in the art. Medicaments and pharmaceutical compositions suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents. The medicaments and pharmaceutical compositions may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use. Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets of the kind previously described.


For oral and parenteral administration to human patients, the daily dosage level of the agents, medicaments and pharmaceutical compositions of the invention will usually be from 10 μg to 500 mg per adult per day administered in single or divided doses.


The agents, medicaments and pharmaceutical compositions of the invention can also be administered intranasally or by inhalation and are conveniently delivered in the form of a dry powder inhaler or an aerosol spray presentation from a pressurised container, pump, spray or nebuliser with the use of a suitable propellant, e.g. dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoro-ethane, a hydrofluoroalkane such as 1,1,1,2-tetrafluoroethane (HFA 134A3 or 1,1,1,2,3,3,3-heptafluoropropane (HFA 227EA3), carbon dioxide or other suitable gas. In the case of a pressurized aerosol, the dosage unit may be determined by providing a valve to deliver a metered amount. The pressurized container, pump, spray or nebulizer may contain a solution or suspension of the active agent, e.g. using a mixture of ethanol and the propellant as the solvent, which may additionally contain a lubricant, e.g. sorbitan trioleate. Capsules and cartridges (made, for example, from gelatin) for use in an inhaler or insufflator may be formulated to contain a powder mix of an agent of the invention and a suitable powder base such as lactose or starch.


Aerosol or dry powder formulations are preferably arranged so that each metered dose or “puff” contains at least 1 mg of an agent of the invention for delivery to the patient. It will be appreciated that the overall daily dose with an aerosol will vary from patient to patient, and may be administered in a single dose or, more usually, in divided doses throughout the day.


Alternatively, the agents, medicaments and pharmaceutical compositions can be administered in the form of a suppository or pessary, or they may be applied topically in the form of a lotion, solution, cream, gel, ointment or dusting powder. The agents, medicaments and pharmaceutical compositions of the invention may also be transdermally administered, for example, by the use of a skin patch, ointment, cream or lotion. For application topically to the skin, the agents, medicaments and pharmaceutical compositions of the invention can be formulated as a suitable ointment containing the active agent suspended or dissolved in, for example, a mixture with one or more of the following: mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene polyoxypropylene agent, emulsifying wax and water. Alternatively, they can be formulated as a suitable lotion or cream, suspended or dissolved in, for example, a mixture of one or more of the following: mineral oil, sorbitan monostearate, a polyethylene glycol, liquid paraffin, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.


They may also be administered by the ocular route, particularly for treating diseases of the eye. For ophthalmic use, the agents, medicaments and pharmaceutical compositions can be formulated as soluble suspensions in isotonic, pH adjusted, sterile saline, or, preferably, as solutions in isotonic, pH adjusted, sterile saline, optionally in combination with a preservative such as a benzylalkonium chloride. Alternatively, they may be formulated in an ointment such as petrolatum.


Formulations suitable for topical administration in the mouth include lozenges comprising the active ingredient in a flavored basis, usually sucrose and acacia or tragacanth; pastilles comprising the active ingredient in an inert basis such as gelatin and glycerin, or sucrose and acacia; and mouth-washes comprising the active ingredient in a suitable liquid carrier.


Agents may be formulated at various concentrations, depending on the efficacy/toxicity of the compound being used, for example as described in the accompanying Examples. For in vitro applications, formulations may comprise a lower concentration of a compound of the invention.


Pharmaceutically acceptable base addition salts may also be used to produce pharmaceutically acceptable salt forms of the agents.


The chemical bases that may be used as reagents to prepare pharmaceutically acceptable base salts of the present agents that are acidic in nature are those that form non-toxic base salts with such compounds. Such non-toxic base salts include, but are not limited to those derived from such pharmacologically acceptable cations such as alkali metal cations (e.g. potassium and sodium) and alkaline earth metal cations (e.g. calcium and magnesium), ammonium or water-soluble amine addition salts such as N-methylglucamine-(meglumine), and the lower alkanolammonium and other base salts of pharmaceutically acceptable organic amines, among others.


SUMMARY OF THE INVENTION

Autoproteolytic cleavage is a critical step in the maturation of Hedgehog (Hh) proteins, where a precursor form of Hh is activated for nucleophilic attack by cholesterol. No cofactors, energy source or accessory proteins are required for this unusual cholesterolysis event; instead, all catalytic activity resides in a ˜26 kDa segment of the Hh precursor.


This autocatalytic element, termed hedgehog steroyl transferse I (HST-I) or hedgehog terminal transferase (HTTase), or HhC, may be used as a tool for protein labeling. HST-I is modular; and its activity is retained when fused to the C-terminus of heterologous peptides and proteins.


Using an optical assay developed to monitor HST-I, heterologous proteins can be covalently modified at their C-terminus by cholesterol with a t1/2 of 10-20 min at pH 7.1, 25 degrees Celsius. During the reaction, HST-I is liberated from the heterologous protein, rendering the reaction “traceless”, i.e., the product does not contain required traces of the HST-I component.


Sterols other than cholesterol may be used as substrates. In addition to cholesterol, HST-I will also ligate proteins to sterol derivatives equipped with fluorescent reporters, alkynes, and biotin, among other functional groups.


Typically, cholesterol modified proteins partition to eukaryotic cell membranes.


See,

  • (139) Cholesterol modification of hedgehog signaling proteins in animal development. Porter J A, Young K E, Beachy P A. Science. 1996 274. 255-9.
  • (140) Targeting of proteins to membranes through hedgehog auto-processing. Vincent S, Thomas A, Brasher B, Benson J D. Nat Biotechnol. 2003 21:936-40.
  • (141) Enzymatic labeling of proteins: techniques and approaches. Rashidian M, Dozier J K, Distefano M D. Bioconjug Chem. 2013 24:1277-94.


Hedgehog terminal transferase (HST-I) thus provides a tool which can be used to covalently conjugate virtually any protein with a variety of small molecules, from fluorophores to therapeutics. HST-I is a water soluble protein that catalyzes protein conjugation in <60 min in the absence accessory proteins.


Features of protein-conjugation with HST-I include: (1) two-component labeling kinetics (2) site-specific, stoichiometric modification (3) broad substrate tolerance and (4) labeling that is nearly traceless. The last feature is particularly noteworthy as existing protein conjugation methods require addition to the target protein of anywhere from 4 to 296 amino acids. That residual sequence can compromise function or engender an immune response during therapeutic application. Conjugation with HST-I requires addition to the target protein of a single glycine residue only (unless it is already present and available).


A general approach is provided for biocatalytic protein-small molecule conjugation, where the reaction is site-specific (C-terminus), stoichiometric (1:1), and nearly traceless (1 or 2 amino acid “scar”). The catalyst for this reaction, called HST-I, has the amino acid sequence (from Drosophila melanogaster), as follows:









SEQ ID NO.: 001



G{circumflex over ( )}CFTPESTALLESGVRKPLGELSIGDRVLSMTANGQAVYSEVILFMDRN






LEQMQNFVQLHTDGGAVLTVTPAHLVSVWQPESQKLTFVFADRIEEKNQV





LVRDVETGELRPQRVVKVGSVRSKGVVAPLTREGTIVVNSVAASCYAVIN





SQSLAHWGLAPMRLLSTLEAWLPAKEQLHSSPKVVSSAQQQNGIHWYANA





LYKVKDYVLPQSWRHD






The Hedgehog sterol transferase (HST-I) from Drosophila melanogaster HST-I conjugates the first amino acid (glycine, GA) to a sterol through a carboxylic acid ester. Other steroyl transferases and/or hedgehog terminal transferases with homology to HST-I may also be used, in similar fashion (For related sequences see: Burglin, Thomas R. “The Hedgehog protein family.” Genome biology 9, no. 11 (2008): 241, www.ncbi.nlm.nih.gov/pubmed/19040769). Homologous proteins are endogenous to multicellular organisms, vertebrates and invertebrates.


The native function of HST-I is to covalently couple the carboxyl terminus of a specific protein (substrate A) to cholesterol (substrate B). HST-I exhibits broad substrate tolerance toward substrate A and toward substrate B. Thus, proteins with no homology to the native protein substrate (substrate A) can be modified at their carboxyl terminus by HST-I; in addition, sterols other than cholesterol (substrate B), derivatized with a variety of functional groups can serve as the substrate for HST-I.


In each of these cases, the core steroid nucleus serves as the generic “linker” recognized by HST-I that ultimately joins protein to functional group.


A genetically engineered HST-I or HST-I derivative may be used, whose conjugation activity can be regulated by an exogenous trigger (redox, light); exhibits different solution properties (e.g., higher thermal stability; greater aggregation resistance); as well as HST-I derivatives that have been engineered to accept synthetic sterols with alterations to the fused ring system of sterols. The HST-I may also be switched, such as by pH, ligand or ionic binding, or the like.


HST-I has utility, particularly in the application areas of protein therapeutics (e.g. antibody-drug conjugates/protein-nucleic acid conjugates), protein detection, and protein immobilization. As one example, HST-I could be used to attach a therapeutic compound, or an imaging agent, to the caboxyl terminus of an antibody so as to target that cargo to a cancer cell bearing the appropriate antigen/receptor. In another embodiment, HST-I could be used to attach polypeptides to nanoparticles for biological or biophysical studies. HST-I can also be used to create protein-nucleic acids conjugates to enhance cellular delivery of therapeutic RNA or natural or synthetic polynucleotides.


Some examples include antibody-drug conjugates; protein-fluorophore labeling for imaging; protein immobilization for diagnostic applications (sensors); membrane-targeted therapeutics (hormones/antibacterials/inhibitors of membrane-bound enzymes); and membrane-targeted protein probes (GFP, etc.).


There are similarities and key distinctions of HST-I compared with other biocatalysts for protein conjugation. Conjugation by HST-I is residue specific; it is active in physiological buffer at room temperature; the kinetics are relatively fast (half time ˜1 h or less); and a variety of protein substrates (substrate A) can be labeled with a broad range of small molecules (substrate B).


The application of HST-I generally correspond to the applications of Sortase enzyme and farnesyl transferase. See, U.S. Pat. Nos. 6,544,772; 6,620,585; 6,773,706; 6,790,448; 6,838,239; 6,841,154; 6,896,887; 6,908,994; 6,936,252; 6,994,982; 7,067,248; 7,067,621; 7,067,639; 7,101,692; 7,125,698; 7,179,458; 7,183,101; 7,195,763; 7,238,489; 7,270,969; 7,312,076; 7,348,420; 7,371,719; 7,384,775; 7,390,526; 7,452,679; 7,455,992; 7,456,011; 7,485,710; 7,491,690; 7,534,761; 7,534,876; 7,538,209; 7,541,039; 7,544,661; 7,554,021; 7,615,616; 7,632,515; 7,635,487; 7,648,708; 7,683,025; 7,709,009; 7,713,534; 7,722,888; 7,731,978; 7,745,708; 7,754,467; 7,763,420; 7,771,728; 7,771,731; 7,776,553; 7,776,589; 7,785,608; 7,803,765; 7,820,184; 7,829,681; 7,833,791; 7,838,010; 7,838,491; 7,850,974; 7,851,445; 7,858,357; 7,888,075; 7,897,367; 7,927,864; 7,935,804; 7,939,087; 7,955,604; 7,960,505; 7,960,533; 7,968,100; 7,968,297; 7,968,683; 8,007,803; 8,007,811; 8,025,885; 8,025,890; 8,038,990; 8,039,005; 8,063,014; 8,076,295; 8,088,611; 8,101,194; 8,105,612; 8,110,199; 8,124,107; 8,124,583; 8,128,936; 8,137,673; 8,138,140; 8,148,321; 8,241,642; 8,252,546; 8,263,642; 8,280,643; 8,287,885; 8,318,908; 8,323,660; 8,329,195; 8,372,411; 8,377,446; 8,399,651; 8,409,589; 8,431,139; 8,445,426; 8,450,271; 8,475,809; 8,524,241; 8,529,913; 8,557,961; 8,563,001; 8,563,006; 8,563,007; 8,568,735; 8,574,597; 8,575,070; 8,580,923; 8,580,939; 8,591,899; 8,592,375; 8,598,342; 8,609,106; 8,617,556; 8,632,783; 8,647,835; 8,652,800; 8,663,631; 8,663,926; 8,669,226; 8,673,860; 8,679,505; 8,680,050; 8,703,717; 8,709,431; 8,709,436; 8,709,760; 8,710,188; 8,715,688; 8,716,448; 8,722,354; 8,748,122; 8,754,198; 8,758,765; 8,772,049; 8,778,358; 8,795,965; 8,795,983; 8,808,699; 8,821,894; 8,822,409; 8,835,187; 8,835,188; 8,840,906; 8,841,249; 8,853,382; 8,858,957; 8,859,492; 8,865,479; 8,871,204; 8,871,445; 8,883,788; 8,889,145; 8,889,150; 8,889,356; 8,927,230; 8,932,814; 8,933,193; 8,933,197; 8,937,167; 8,940,501; 8,945,542; 8,945,588; 8,945,589; 8,945,855; 8,946,381; 8,957,021; 8,961,979; 8,975,232; 8,980,284; 8,980,824; 8,986,710; 8,993,295; 9,005,579; 9,050,374; 9,056,912; 9,062,299; 9,068,985; 9,079,946; 9,079,952; 9,080,159; 9,090,677; 9,095,540; 9,102,741; 9,107,873; 9,109,008; 9,114,105; 9,127,050; 9,128,058; 9,129,785; 9,132,179; 9,132,182; 9,134,304; 9,150,626; 9,156,850; 9,168,293; 9,168,312; 9,181,297; 9,181,329; 9,182,390; 9,205,142; 9,212,219; 9,217,157; 9,221,882; 9,221,886; 9,221,902; 9,234,012; 9,238,010; 9,243,038; 9,249,211; 9,266,925; 9,266,943; 9,266,944; 9,267,127; 9,315,554; 9,340,582; 9,340,584; 9,353,160; 9,371,369; 9,376,672; 9,382,289; 9,388,225; 9,393,294; 9,394,092; 9,399,673; 9,403,904; 9,404,922; 9,405,069; 9,408,890; 9,409,952; 9,416,171; 9,434,774; 9,441,016; 9,458,228; 9,458,229; 9,463,431; 20020028457; 20030021789; 20030022178; 20030087864; 20030091577; 20030099940; 20030153020; 20030180816; 20030185833; 20030186851; 20030228297; 20040091856; 20040101919; 20040110181; 20040126870; 20040167068; 20040230033; 20040236072; 20050002925; 20050003510; 20050037444; 20050048545; 20050069984; 20050106648; 20050112612; 20050175581; 20050203280; 20050207995; 20050220788; 20050233396; 20050276814; 20060073530; 20060074016; 20060078901; 20060115491; 20060135416; 20060165716; 20060177462; 20060188975; 20060194226; 20060198852; 20060234222; 20060246080; 20060257413; 20060263846; 20060269538; 20060275315; 20070003667; 20070026011; 20070031832; 20070053924; 20070059295; 20070082006; 20070082007; 20070082866; 20070117197; 20070128210; 20070128211; 20070128229; 20070172495; 20070190029; 20070190063; 20070207170; 20070207171; 20070218075; 20070248581; 20070253964; 20070258955; 20070286866; 20080031877; 20080038287; 20080050361; 20080064079; 20080089899; 20080171059; 20080175857; 20080220441; 20080248522; 20080254070; 20080260768; 20090022753; 20090035780; 20090041744; 20090075839; 20090088337; 20090088372; 20090092582; 20090117113; 20090130115; 20090148408; 20090155304; 20090176967; 20090202578; 20090202593; 20090214476; 20090214537; 20090214584; 20090239264; 20090297548; 20090297549; 20090305252; 20090317420; 20090317421; 20100004324; 20100009917; 20100055761; 20100064393; 20100068220; 20100074923; 20100098789; 20100105865; 20100119534; 20100150943; 20100152054; 20100183614; 20100184624; 20100196524; 20100221288; 20100227341; 20100239554; 20100247561; 20100255026; 20100256070; 20100260706; 20100260790; 20100267053; 20100278740; 20100279328; 20100297183; 20100303864; 20100323956; 20110020323; 20110020385; 20110020402; 20110020900; 20110046008; 20110046060; 20110046061; 20110076299; 20110077199; 20110091956; 20110097360; 20110104168; 20110110982; 20110124520; 20110129935; 20110150918; 20110151053; 20110172146; 20110177976; 20110183863; 20110189187; 20110189236; 20110189664; 20110206616; 20110206676; 20110206692; 20110243976; 20110243977; 20110245480; 20110262477; 20110263501; 20110275132; 20110281745; 20110281764; 20110288005; 20110311536; 20110312881; 20110318339; 20110321183; 20120015379; 20120034261; 20120058906; 20120064103; 20120064104; 20120076814; 20120083599; 20120093840; 20120093850; 20120100174; 20120100569; 20120107340; 20120114686; 20120121643; 20120122123; 20120142682; 20120149590; 20120149710; 20120157665; 20120171211; 20120172303; 20120178691; 20120189649; 20120201844; 20120207778; 20120237536; 20120244189; 20120251568; 20120263701; 20120263703; 20120270797; 20120282247; 20120282289; 20120282670; 20120282700; 20120289454; 20120294880; 20120301428; 20120301433; 20120301496; 20120308595; 20120309679; 20120309701; 20120316071; 20130011386; 20130011428; 20130017997; 20130034575; 20130034847; 20130039884; 20130045211; 20130064845; 20130071416; 20130072420; 20130084648; 20130089525; 20130101665; 20130122043; 20130136746; 20130136761; 20130143955; 20130157281; 20130165389; 20130171183; 20130177940; 20130184177; 20130189287; 20130209494; 20130216568; 20130217592; 20130217612; 20130230550; 20130236419; 20130243818; 20130253175; 20130259889; 20130260404; 20130261293; 20130288266; 20130288267; 20130289251; 20130289253; 20130296257; 20130316946; 20130323819; 20130330335; 20130338030; 20130338047; 20130344010; 20140004138; 20140011709; 20140017764; 20140030697; 20140037650; 20140037669; 20140051834; 20140057317; 20140065171; 20140073639; 20140105818; 20140113832; 20140128289; 20140147873; 20140154286; 20140154287; 20140155319; 20140161915; 20140162949; 20140170702; 20140178425; 20140179006; 20140186265; 20140186327; 20140186350; 20140186354; 20140186358; 20140189896; 20140193438; 20140206840; 20140213515; 20140227295; 20140227298; 20140234972; 20140235828; 20140243280; 20140248702; 20140249296; 20140255470; 20140273231; 20140287509; 20140301974; 20140302084; 20140308318; 20140310830; 20140315314; 20140328819; 20140329706; 20140329750; 20140335095; 20140348868; 20140371136; 20140377289; 20150004155; 20150005233; 20150005481; 20150010566; 20150023879; 20150023959; 20150030594; 20150031134; 20150031563; 20150031604; 20150037359; 20150037421; 20150037828; 20150038421; 20150045535; 20150050717; 20150051082; 20150056239; 20150056240; 20150071957; 20150079132; 20150079681; 20150086576; 20150087545; 20150093406; 20150093413; 20150104468; 20150118183; 20150118264; 20150132324; 20150132335; 20150132339; 20150139984; 20150152134; 20150158929; 20150165062; 20150166640; 20150168405; 20150174130; 20150182588; 20150184142; 20150185216; 20150197538; 20150197734; 20150203834; 20150210756; 20150216960; 20150231228; 20150232518; 20150232541; 20150232560; 20150232561; 20150241440; 20150246024; 20150253335; 20150258210; 20150259389; 20150259397; 20150259431; 20150266943; 20150273040; 20150273042; 20150274800; 20150284452; 20150284477; 20150290362; 20150291704; 20150305361; 20150306212; 20150306218; 20150309021; 20150315248; 20150320882; 20150329590; 20150335724; 20150338579; 20150343051; 20150344862; 20150346195; 20150368322; 20150374811; 20150376266; 20160000895; 20160002338; 20160002346; 20160002645; 20160018397; 20160022776; 20160022833; 20160025740; 20160032346; 20160038581; 20160040158; 20160041157; 20160045885; 20160052982; 20160068583; 20160068589; 20160068591; 20160069894; 20160073671; 20160074497; 20160074498; 20160082046; 20160090351; 20160090404; 20160097773; 20160102137; 20160102332; 20160102344; 20160108091; 20160114046; 20160115222; 20160115488; 20160115489; 20160122405; 20160122451; 20160122707; 20160123991; 20160129101; 20160130299; 20160136298; 20160137698; 20160137711; 20160137720; 20160146786; 20160146794; 20160158335; 20160166634; 20160168232; 20160175412; 20160175441; 20160178627; 20160184421; 20160185791; 20160185817; 20160185828; 20160193355; 20160194363; 20160194410; 20160194627; 20160199454; 20160199510; 20160200742; 20160206566; 20160208233; 20160213744; 20160220686; 20160222096; 20160230216; 20160244747; 20160244784; 20160251409; 20160257749; 20160257932; 20160264624; 20160271268; 20160279192; 20160279257; 20160280748; 20160282369; 20160287734; 20160297854; each of which is expressly incorporated herein by reference. Likewise, applications provided in U.S. 2015/0329568, expressly incorporated herein by reference in its entirety, may be employed as appropriate.


There are two key advantages of HST-I over sortase and farnestyl transferase biocatalysts for protein conjugation: First, HST-I allows a one-pot, bi-molecular conjugation, whereas existing sortase and farnesyl transferase bioconjugations require 3 component reactions. Second, the conjugation reaction with HST-I is nearly traceless, as the HST-I cleaves itself from the target protein during conjugation. The bi-molecular labelling (i) stems from the fact that the catalyst, HST-I, is fused to the protein substrate (substrate A), thus only the modifier (substrate B) needs to be added to the “pot” to initiate conjugation. No cofactors or accessory proteins are required.


Existing methods that require at least three separate components (the protein of interest; the small molecule; and the conjugation catalyst). Three component coupling reactions often proceed slowly, and require excess reactant concentration to drive conjugation to completion.


The traceless feature arises from the fact that the protein of interest is liberated from HST-I upon labelling. Existing chemical labeling methods require addition to the protein of anywhere from 4 to 296 amino acid residues to allow recognition by the conjugation catalyst. That residual “scar” may compromise stability, perturb protein-protein association, or engender an immune response, which would be a serious concern for therapeutic applications, in contrast to the single glycine residue required by HST-I.


Labeling is restricted to a protein's carboxyl terminus.


The sterol moiety that functions as the generic linker is typically hydrophobic, which could compromise solubility of the labeled protein if a water-soluble/hydrophilic product is required.


The technology does require fusion of the protein of interest to HST-I, which is typically performed by genetically engineering the protein of interest fused to the HST-I, though other mechanisms of ligation may be employed.


The catalytic activity of HST-I, i.e., Hedgehog sterol transferase (HST-I, 26 kDa) does not need the entire hedgehog protein, 46 kDa, but rather only the C-terminal portion of the hedgehog protein. A signaling protein, HhN, is in the adjacent N-terminal region of the hedgehog protein, is not required for catalytic activity.


The native function of HST-I in Drosophila, and in other multicellular organisms, is to conjugate cholesterol to the last residue of HhN, which is invariably glycine. The lipid becomes joined to the carboxyl group of glycine through an ester (www.ncbi.nlm.nih.gov/pubmed/8824192). Conjugation by HST-I releases the cholesterol-modified protein, thereby generating two polypeptides; HhN-cholesterol and HST-I.


In vitro HST-I exhibits broad substrate tolerance. For example, conjugation proceeds even when HST-I is translationally fused to heterologous proteins. Examples of heterologous proteins include fluorescent proteins, enzymes, carbohydrate binding proteins, and peptides. These proteins, with no homology to the native substrate polypeptide, HhN, undergo efficient conjugation at a C-terminal glycine residue catalyzed by HST-I. Derivatives of cholesterol modified with a variety of chemical matter, including oligonucleotides, serve as suitable substrates for HST-I. In these non-native conjugation events, the steroid appears to serves as a kind of “molecular handle” recognized by HST-I and ultimately activated by HST-I so as to react with the final residue of the heterologous protein.


Advantages of conjugation of a nucleic acid with a protein of interest (POI), using HST-1 and a steroylated nucleic acid include:

    • (i) labeling reactions that require two components (POI-HST-I fusion protein, steroylated DNA);
    • (ii) site-specific, stoichiometric modification at the C-terminus of the POI;
    • (iii) broad substrate tolerance; and
    • (iv) labeling that is nearly traceless as HST-I is cleaved off from the POI concurrent with conjugation.


Example sterols and derivatized sterols include:




embedded image


embedded image


Formulas I and II are metal chelators, and Formulas III and IV are fluorophores. Formula V is a steroylated nucleic acid.




embedded image


Sterol derivatives may be prepared, for example, through a process as follows:




embedded image



For example, derivatives may be prepared in one-pot by reductive amination of pregnenolone with propargylamine. Diastereomers are separable by silica gel chromatography.


It is therefore an object to provide a method comprising: providing a purified fusion protein comprising a C-terminal steroyl transferase activity from a hedgehog protein, an intervening electrophilic amino acid, and an N-terminal polypeptide; reacting the purified fusion protein with a substrate for the steroyl transferase activity comprising a fused sterol or stanol ring system having a nucleophilic substituent of the A ring ligated to at least one nucleic acid, to thereby cleave the fusion protein to release the C-terminal steroyl transferase activity in solution and covalently link the nucleophilic substituent of the A ring to the electrophilic amino acid.


It is also an object to provide a method for generating a polypeptide-nucleic acid conjugate, comprising: providing a polypeptide; providing a steroylated-nucleic acid; providing a protein catalyst adapted to link the polypeptide through a sterol moiety to the steroylated-nucleic acid; and reacting the steroylated-nucleic acid and the polypeptide, catalyzed by the protein catalyst, to form a covalently linked polypeptide-steroyl-nucleic acid conjugate.


The protein catalyst may comprise a hedgehog sterol transferase activity.


The polypeptide and the protein catalyst may be provided as a fusion protein.


The reacting may disassociate the protein catalyst from the polypeptide-nucleic acid conjugate. The protein catalyst may be linked to the polypeptide through a glycine, or other suitable electrophilic amino acid.


The fusion protein may comprise a C-terminal portion having the hedgehog sterol transferase activity, an intervening glycine, and an N-terminal portion comprising the polypeptide.


The steroylated-nucleic acid may comprise a canonical fused sterol or stanol ring system, a nucleophilic group at the 3-position of the A-ring of the fused sterol or stanol ring system. For example, beta or alpha stereochemistry ring systems may be employed, and an oligonucleotide attached through a linker to the sterol or stanol ring system, e.g., through a D-ring or other ring. The steroylated-nucleic acid may comprise at least one sterol molecule joined covalently to a nucleic acid polymer.


The polypeptide may have a length of between 2 amino acids and 500 amino acids. The polypeptide may have glycine as a last amino acid residue, linked to the protein catalyst having the hedgehog sterol transferase activity.


The protein catalyst may be of, or related to, a hedgehog-family of proteins. Homologous proteins have been identified by sequence alignments (Burglin, Thomas R. “The Hedgehog protein family.” Genome biology 9, no. 11 (2008): 241, www.ncbi.nlm.nih.gov/pubmed/19040769). The protein catalyst and the polypeptide may be expressed from a genetically engineered chimeric gene. The protein catalyst and the polypeptide may be expressed from the genetically engineered chimeric gene in an organism lacking sterols. The fusion chimera polypeptide may also be produced in cell-free systems, e.g., in vitro translation. The protein catalyst may be configured to react with a last residue of the polypeptide through translation fusion. The protein catalyst may be configured to chemically link a C-terminal residue, typically glycine, of the polypeptide with the steroylated-nucleic acid. The protein catalyst may have a substrate affinity for the steroylated-nucleic acid. The protein catalyst and the polypeptide may be associated prior to the reacting, and the protein catalyst and the polypeptide may be disassociated subsequent prior to the reacting to form the polypeptide-nucleic acid conjugate.


A composition is provided according to any of the foregoing.


A kit is provided, comprising: a polypeptide comprising a C-terminal steroyl transferase activity, an N-terminal peptide, and an intervening electrophilic residue, typically glycine; and a steroylated-nucleic acid, the polypeptide and the steroylated-nucleic acid being configured to react in solution to ligate the steroylated-nucleic acid to the N-terminal peptide through the glycine, and to disassociate the C-terminal steroyl transferase activity from the ligated steroylated-nucleic acid and N-terminal peptide. The C-terminal steroyl transferase activity may correspond to a hedgehog protein steroyl transferase activity.


The polypeptide may be provided as a fusion protein expressed from a chimeric gene in a host system lacking sterols, or translated in vitro using a cell-free system.


The steroylated-nucleic acid may comprise a canonical fused sterol or stanol ring system, a nucleophilic group at the 3-position of the A-ring of the fused sterol or stanol ring system, and an oligonucleotide attached through a linker to the fused sterol or stanol ring system.


The N-terminal peptide may have a length of between 2 amino acids and 500 amino acids.


The steroylated-nucleic acid may comprise at least one sterol molecule joined covalently to a nucleic acid polymer.


It is also an object to provide a composition, comprising: a polypeptide having a C-terminal glycine, a canonical fused sterol or stanol ring system, having a nucleophilic group at the 3-position of the A-ring of the fused sterol or stanol ring system, covalently linked to the C-terminal glycine, and an oligonucleotide attached through a linker adjacent to the sterol or stanol ring system.


The polypeptide may have between 2 and 500 amino acids.


The oligonucleotide may be an RNA, single stranded DNA, a segment of a double stranded DNA, or an oligonucleotide bound to an oligonucleotide strand having a complementary sequence.


The polypeptide and/or oligonucleotide may have a therapeutic activity in an animal, a diagnostic activity in an animal, a fluorescent property, and/or a fluorescence quenching property.


A therapeutic may be provided which selectively delivers a nucleotide or oligonucleotide to cells. The nucleotide may be effective to provide gene therapy, a DNA vaccine therapy, DNA nanostructure devices, etc. In this class of applications, the linked peptide serves to target and/or anchor the nucleotide in a desired region, tissue or cell type. On the other hand, in another class of applications, the nucleotide serves the purpose of anchoring or targeting, and the peptide provides a functional therapy or function. In other cases, both the peptide and the nucleotide may have specific targeting activities or functional activities. In a still further embodiment, the ligated peptide and nucleotide is itself linked or attached to a further active or targeting functionality. For example, if the peptide is an antigen, it may be complexed with a corresponding antibody. Similarly, the nucleotide may be annealed to a corresponding antisense nucleotide. Further, the peptide may have affinity for cofactors, and thus complex with the respective cofactor and carry that to a site of action. As party of a therapy, the active molecule, which may be the fusion peptide, or the fused product, is provided in a pharmaceutically acceptable dosage form, and administered to provide an effective therapy. The disease to be treated may be a neoplastic or hyperproliferative disease, an immune disorder, a genetic disorder, a disease to be treated with a gene therapy, miRNA, siRNA, dsRNA, or other oligonucleotide therapy.


For example, the polypeptide moiety may have receptor characteristics, or receptor-specific binding characteristics, to bind to a corresponding receptor or ligand on or in a specific tissue. The binding may lead to an endycytosis of the oligonucleotide, and thus obtain cell entry. The oligonucleotide may then act within the endocytosed environment, be released from the endosome into the cell, or the peptide-steroyl-oligonucleotide may act to lyse the endosome. In other cases, the peptide or oligonucleotide may act at the cell surface, external to the cell.


At least one of the polypeptide and the oligonucleotide may be bound to a support or a suspended particle.


The polypeptide may be configured to act as a sensor to report a presence and/or concentration of an analyte, as shown in FIGS. 6B and 6C. As shown in FIG. 6B, the analyte is lead, which alters a configuration of a strand of DNA into a quadruplex formation. As shown in FIG. 6C, the analyte is pathogen DNA, which is sensed by an antisense oligonucleotide strand linked to a nanoluciferase peptide. In an absence of pathogen DNA, the luciferase luminescence is quenched by a DABCYL (4-((4-(dimethylamino)phenyl)azo)benzoic Acid, www.thermofisher.com/order/catalog/product/D2245), while in the presence of the pathogen DNA, the quencher is displaced from the nanoluciferase, and luminescence is apparent.


The polypeptide may be configured to act as an antigen for a corresponding antibody, or an antigen binding domain of an antibody.


The polypeptide may comprise a protease-sensitive domain, configured to release the oligonucleotide in response to cleavage of the protease-sensitive domain by a protease, as shown in FIG. 7. The oligonucleotide may comprise a restriction endonuclease-sensitive domain, configured to release a portion of the oligonucleotide in response to cleavage of the restriction endonuclease-sensitive domain by a corresponding protease restriction endonuclease.


The polypeptide may comprise a receptor binding domain, configured to deliver the oligonucleotide to a specific cell type by receptor-mediated endocytosis, also shown in FIG. 7. The oligonucleotide may comprise biologically active oligonucleotide, such as a DNAzyme, or siRNA, or the nucleic acid that has a specific target within the cell.


These and other objects will become apparent from a review of the description herein.





BRIEF DESCRIPTION OF FIGURES


FIG. 1 shows the native conjugation activity of HST-I.



FIG. 2 shows steroylated-oligonucleotides suitable for HST-I catalyzed conjugation.



FIGS. 3A and 3B show results of a study which conjugates proteins to oligonucleotides using HST-I.



FIG. 4 shows that, compared to other biocatalytic conjugations, HST-I leaves the smallest residual sequence “scar”.



FIGS. 5A-5C show, respectively, conjugation of an oligonucleotide (or other ligand) to a bead, an antibody, and to a cell surface.



FIG. 6A shows a general scheme for creating enzyme-aptamer conjugates.



FIG. 6B shows a strand-to-quadraplex sensor for bioluminescence resonance energy transfer (BRET), for lead sensing.



FIG. 6C shows a hairpin-to-rod sensor for pathogen DNA with accompanying fluorescent enhancement.



FIG. 7 shows receptor specific binding of protein-oligonucleotide conjugates.





DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENT

According to one embodiment, the technology provides a method of conjugating a protein to a steroylated-oligonucleotide.



FIG. 1 shows the native conjugation activity of HST-I. A hedgehog precursor protein comprised of HhN linked to the HST-I polypeptide, associates with cholesterol in a cellular membrane; membrane bound HST-I generates an internal thioester by rearranging the peptide bond at the HhN/HST-I junction; HST-I then activates a molecule of cholesterol to attack the internal thioester, resulting in the departure of HhN and the linking of HhN to cholesterol as a carboxyl ester.


Chemical Synthesis of Steroylated-Oligonucleotide


A nominal 2-step protocol is provided to synthesize sterol-oligonucleotides via oxime chemistry, as shown schematically in FIG. 2.


The protocol takes advantage of the fact that aminooxy groups react to form oximes in buffered aqueous conditions with equilibrium constants, typically in the range of >108 M−1.


Sterol-oligonucleotides compatible with HST-I catalyzed conjugation generally have the same general structure as (II) shown in FIG. 2, namely, a canonical fused sterol or stanol ring system, a nucleophilic group at the 3-position of the A-ring with beta stereochemistry, and an oligonucleotide attached through a linker adjacent to the D ring.



FIG. 2 shows that steroylated-oligonucleotides suitable for HST-I catalyzed conjugation can be synthesized by sequential oxime formation chemistry. The reaction sequence begins with the reaction of pregnenolone and bis(aminoxy)PEG3 to form intermediate (I); followed by reaction of I with benzaldehyde modified oligonucleotide to form II.


The reaction proceeds as follows:


Pregnenolone-16-ene oxime (PEG3) aminoxy (I): In a total volume of 1 ml consisting of 900 μl MeOH/100 μl triethanolamine acetate buffer (1 M, pH 7), dissolve 0.2 mmoles of Bis-(Aminooxy)-PEG3 with 0.1 mmoles of pregnenolone. Solution starts out cloudy, then turns clear after overnight mixing on a vortex. Oxime formation is monitored by TLC (95% Dichloromethane/5% methanol). Product, pregnonlone is isolated by organic extraction (3×) using 6 mls ethylacetate/6 mls water, followed by drying under nitrogen stream to a white solid. Typical yield is 70-85%.


Pregnenolone-16-ene bisoxime(PEG3)-oligo-dT20 (II): In microscale reaction, the product from step (I) is joined using the same oxime chemistry to an oligonucleotide equipped with a (4-formylbenzamide) group, obtained commercially (Solulink/TriLink Inc.). The solvent is 90/10, methanol/triethanolmamine acetate buffer (pH 7), with I at 0.02 M and the oligonucleotide 0.0002 M. Following overnight incubation, the sterol-oligonucleotide (II) is purified using microspin oligo clean and concentrator column (Zymogen Inc.), and eluted with water.


Fusion Protein


Create and clone a synthetic gene encoding POI fused to HST-I. The gene encoding the protein of interest (POI) is cloned into an expression plasmid, creating an in-frame translational fusion with HST-I. If the last amino acid of the target protein is not glycine, a glycine codon is added at the 3′ of the POI gene. This step involves standard molecular biology techniques.


Express POI-HST-I fusion protein. Recombinant vector encoding POI-HST-I fusion protein is transformed into a suitable expression host, e.g., E. coli, strain BL21 DE3.


Alternative hosts, ideally organisms that do not contain endogenous sterols, may be employed. Endogenous sterols may react with the POI-HST-I precursor protein, resulting in the release of POI.


It is also possible to produce the POI-HST-I fusion peptide by in vitro translation. See, www.neb.com/tools-and-resources/feature-articles/the-next-generation-of-cell-free-protein-synthesis; www.thermofisher.com/us/en/home/references/ambion-tech-support/large-scale-transcription/general-articles/the-basics-in-vitro-translation.html; en.wikipedia.org/wiki/Cell-free_protein_synthesis; Mikami S et al. (2006) A hybridoma-based in vitro translation system that efficiently synthesizes glycoproteins. J Biotechnol 127(1):65-78; Mikami S et al. (2006) An efficient mammalian cell-free translation system supplemented with translation factors. Protein Expr Purif 46(2):348-57.


Purify POI-HST-1 fusion protein. Fusion protein is purified from the cell extract using an appropriate chromatography method. For example, immobilized metal affinity chromatography may be used (IMAC). Other purification techniques (GST-tag; chitin-tag; MBP-tag) could also be used.


Conjugation


Conjugation of POI to the sterol-oligonucleotide through the action of HST-I is initiated at room temperature by addition of a sterol-oligonucleotide to a final concentration 100-200 μM. Progress of the reaction can be followed by a variety of analytical methods. For example, SDS-PAGE may be used to monitor the change in molecular weight as the POI is conjugated and released from HST-1.


A final chromatography step can be carried out to separate HST-I from the conjugated target protein.


Example

The feasibility of HST-I catalyzed conjugation of protein to nucleic acids has been assessed through pilot scale experiments. In one example, a chimeric gene encoding a 20 kDa POI fused to HST-1 was created. This gene product, a 46 kDa precursor polypeptide, was expressed in E. coli and purified under native conditions using immobilized metal affinity chromatography. To test conjugation activity, a 30 μl solution of the purified protein (2 μM, final) in BisTris buffered solution, was mixed with sterol-oligonucleotide (˜35 μM, final).


The oligonucleotide used in this experiment was chemically modified with a fluorescein group. After 3 hours at room temperature, contents of the reaction and control reactions were separated by SDS-PAGE. The gel was first imaged using UV light source to detect the fluorescent oligonucleotide, and then by Coomassie staining which detects all proteins, as shown in FIGS. 3A and 3B.



FIGS. 3A and 3B show results of a pilot study which establishes feasibility of conjugating proteins to oligonucleotides using HST-I. FIG. 3A shows a scheme for the conjugation activity of POI-HST-I precursor protein. FIG. 3B shows conjugation of 46 kDa POI-HST-I fusion protein with sterol-oligonucleotide. Images of gels following SDS-PAGE to resolve reactions of POI-HST-I in the absence (lane 1) and presence of cholesterol (lane 2), synthetic sterol (lane 3), and a synthetic sterol-oligonucleotide. The gel was imaged under UV light (right) to detect the oligonucleotide, which was equipped with a fluorescein molecule; and under white light following straining with Coomassie dye (left).


Symbols:






    • POI-HST-I precursor protein (top triangles);

    • The POI-sterol-DNA conjugate (next-to-top triangle);

    • HST-I protein, released by conjugation, (next-to bottom triangles);

    • The sterol-modified POI (bottom triangles).






FIG. 4 shows that, compared to other biocatalytic conjugations, HST-I leaves the smallest residual sequence “scar”.



FIGS. 5A-5C show, respectively, conjugation of an oligonucleotide (or other ligand) to a bead, an antibody, and to a cell surface.



FIG. 6A shows a general scheme for creating enzyme-aptamer conjugates.



FIG. 6B shows a strand-to-quadraplex sensor for bioluminescence resonance energy transfer (BRET), for lead sensing, which exploits the ability of certain DNA to form a quadraplex with Pb2+ ions, which brings a dye, e.g., alexfluor 610 in close proximity to a nanoluciferase peptide.



FIG. 6C shows a hairpin-to-rod sensor for pathogen DNA, which exploits the ability of DABCYL to quench nanoluciferase when in close proximity, but to permit luminescence when displaced, such as during a hairpin-to-rod transformation or DNA or RNA.



FIG. 7 shows receptor specific binding of protein-oligonucleotide conjugates. In this case, FIG. 7 proposes a toxin ligated to the oligonucleotide, which is then endocytosed, and processed with lysosomes by normal cell activity, to release the toxin.


In the sample containing the HST-I precursor protein, conjugation activity is indicated by the diminished staining of the precursor protein compared with control, as well as by the appearance of protein corresponding to the molecular weight of HST-I. Finally, in this sample, a high molecular weight product (dots) is observed that reacts with the Coomassie stain and gives off a fluorescence signal. Together, these characteristics indicate that this species is the desired protein-oligonucleotide conjugate.


Each reference cited herein is expressly incorporated herein by reference it its entirety.


It is to be understood that while a certain form of the invention is illustrated, it is not to be limited to the specific form or arrangement herein described and shown. It will be apparent to those skilled in the art that various changes may be made without departing from the scope of the invention and the invention is not to be considered limited to what is shown and described in the specification and the figures included herein. The embodiments, methods, procedures and techniques described herein are presently representative of the preferred embodiments, are intended to be exemplary and are not intended as limitations on the scope. Changes therein and other uses will occur to those skilled in the art which are encompassed within the spirit of the invention and are defined by the scope of the appended claims.

Claims
  • 1. A method for generating a polypeptide-nucleic acid conjugate, comprising: providing a polypeptide comprising a C-terminal steroyl transferase activity, an N-terminal peptide, and an intervening electrophilic residue;providing a nucleic acid substrate comprising a fused sterol or stanol ring system comprising: i) a nucleophilic substituent on the A ring; andii) at least one nucleic acid, ligated to the fused sterol or stanol ring system by a linker; andreacting the nucleic acid substrate and the polypeptide in a solution, to form a covalently linked polypeptide-nucleic acid conjugate.
  • 2. The method according to claim 1, further comprising providing a complementary nucleic acid having a nucleic acid sequence complementary to a nucleic acid sequence of nucleic acid substrate, and allowing the complementary nucleic acid to selectively bind to the nucleic acid substrate.
  • 3. The method according to claim 1, wherein at least one of the nucleic acid substrate and the N-terminal peptide comprises a label, selected from the group consisting of at least one of a fluorescent activity, an enzymatic activity, an antigenic activity, an antibody activity.
  • 4. The method according to claim 1, wherein the nucleic acid substrate acid has an affinity for a complementary nucleic acid, and the N-terminal peptide has at least one of a fluorescent activity, an enzymatic activity, an antigenic activity, an antibody activity.
  • 5. The method according to claim 1, wherein the intervening electrophilic reside comprises glycine.
  • 6. The method according to claim 5, wherein the C-terminal steroyl transferase activity comprises a hedgehog sterol transferase activity.
  • 7. The method according to claim 1, wherein the C-terminal steroyl transferase activity comprises a hedgehog sterol transferase activity.
  • 8. The method according to claim 1, wherein the nucleic acid substrate comprises the fused sterol or stanol ring system, a nucleophilic group at the 3-position of an A-ring of the fused sterol or stanol ring system, and the at least one nucleic acid being an oligonucleotide attached through a linker to the fused sterol or stanol ring system.
  • 9. The method according to claim 1, wherein the nucleic acid substrate comprises a canonical fused sterol or stanol ring system, a nucleophilic group at the 3-position of the A-ring of the fused sterol or stanol ring system with beta stereochemistry, and the at least one nucleic acid being an oligonucleotide attached through a linker adjacent to the D ring of the fused sterol or stanol ring system.
  • 10. The method according to claim 1, wherein the polypeptide has a length of between 2 amino acids and 500 amino acids.
  • 11. The method according to claim 1, wherein the polypeptide and the nucleic acid substrate react with each other in solution to ligate the nucleic acid substrate to the N-terminal peptide through the intervening electrophilic residue, and to disassociate the C-terminal steroyl transferase activity from the ligated nucleic acid substrate and N-terminal peptide.
  • 12. The method according to claim 1, wherein the C-terminal steroyl transferase activity chemically links the intervening electrophilic residue with the nucleic acid substrate.
  • 13. The method according to claim 1, wherein the polypeptide is provided as a fusion protein expressed from a chimeric gene in a host system lacking sterols.
  • 14. A method for ligating a polypeptide to a nucleic acid, comprising: providing a polypeptide comprising a C-terminal steroyl transferase activity, an N-terminal peptide, and an intervening electrophilic residue;providing a nucleic acid substrate for the steroyl transferase activity comprising a fused sterol or stanol ring system having a nucleophilic substituent of the A ring, the fused stanol or sterol system being ligated with a linker to at least one nucleic acid having an affinity for a complementary nucleic acid; andreacting the nucleic acid substrate and the polypeptide in a solution, to form a covalently linked polypeptide-nucleic acid conjugate.
  • 15. The method according to claim 14, further comprising selectively binding the nucleic acid substrate to the complementary nucleic acid before said reacting.
  • 16. The method according to claim 14, wherein the N-terminal peptide comprises a label having at least one of a fluorescent activity, an enzymatic activity, an antigenic activity, an antibody activity, and the covalently linked polypeptide-nucleic acid conjugate comprises the label.
  • 17. The method according to claim 14, wherein the C-terminal steroyl transferase activity corresponds to a hedgehog protein steroyl transferase activity and the intervening electrophilic residue comprises a glycine.
  • 18. The method according to claim 14, further comprising expressing the polypeptide as a fusion protein from a chimeric gene in a host system lacking sterols.
  • 19. The method according to claim 3, further comprising detecting the label.
CROSS REFERENCE TO RELATED APPLICATIONS

The present application is a Division of U.S. patent application Ser. No. 15/782,391, filed Oct. 12, 2017, now U.S. Pat. No. 10,738,338, issued Aug. 11, 2020, which is a Non-provisional of, and claims benefit of priority from, U.S. Provisional Patent Application No. 62/409,655, filed Oct. 18, 2016, the entirety of which are expressly incorporated herein by reference.

US Referenced Citations (723)
Number Name Date Kind
3773919 Boswell et al. Nov 1973 A
6544772 Glenn et al. Apr 2003 B1
6620585 Zyskind Sep 2003 B1
6773706 Schneewind et al. Aug 2004 B2
6790448 Xu et al. Sep 2004 B2
6838239 Zyskind Jan 2005 B1
6841154 Foster et al. Jan 2005 B2
6896887 Leenhouts et al. May 2005 B2
6908994 Rich et al. Jun 2005 B1
6936252 Gilbert et al. Aug 2005 B2
6994982 Watt et al. Feb 2006 B1
7067248 Hruby et al. Jun 2006 B2
7067621 Yeaman et al. Jun 2006 B2
7067639 Eenhouts et al. Jun 2006 B2
7101692 Schneewind et al. Sep 2006 B2
7125698 Glenn et al. Oct 2006 B2
7179458 Chang et al. Feb 2007 B2
7183101 Arigoni et al. Feb 2007 B2
7195763 Xu et al. Mar 2007 B2
7238489 Schneewind et al. Jul 2007 B2
7270969 Watt et al. Sep 2007 B2
7312076 Chang et al. Dec 2007 B2
7348420 Klaenhammer et al. Mar 2008 B2
7371719 Stupp et al. May 2008 B2
7384775 Zagursky et al. Jun 2008 B2
7390526 Stupp et al. Jun 2008 B2
7452679 Stupp et al. Nov 2008 B2
7455992 Klaenhammer et al. Nov 2008 B2
7456011 Liu et al. Nov 2008 B2
7485710 Reinscheid et al. Feb 2009 B2
7491690 Stupp et al. Feb 2009 B2
7534761 Stupp et al. May 2009 B1
7534876 Klaenhammer et al. May 2009 B2
7538209 Klaenhammer et al. May 2009 B2
7541039 Leenhouts et al. Jun 2009 B2
7544661 Stupp et al. Jun 2009 B2
7554021 Stupp et al. Jun 2009 B2
7615616 Hook et al. Nov 2009 B2
7632515 Gilbert et al. Dec 2009 B2
7635487 Meinke et al. Dec 2009 B2
7648708 Gilbert et al. Jan 2010 B2
7683025 Stupp et al. Mar 2010 B2
7709009 Grandi et al. May 2010 B2
7713534 Gilbert et al. May 2010 B2
7722888 Gilbert et al. May 2010 B2
7731978 Bensi et al. Jun 2010 B2
7745708 Stupp et al. Jun 2010 B2
7754467 Chang et al. Jul 2010 B2
7763420 Stritzker et al. Jul 2010 B2
7771728 Meinke et al. Aug 2010 B2
7771731 Matsuka et al. Aug 2010 B2
7776553 Love et al. Aug 2010 B2
7776589 Prongay et al. Aug 2010 B1
7785608 Zlotnick et al. Aug 2010 B2
7803765 Watt et al. Sep 2010 B2
7820184 Stritzker et al. Oct 2010 B2
7829681 Seefeldt et al. Nov 2010 B2
7833791 Chang et al. Nov 2010 B2
7838010 Bensi et al. Nov 2010 B2
7838491 Stupp et al. Nov 2010 B2
7850974 Hook et al. Dec 2010 B2
7851445 Stupp et al. Dec 2010 B2
7858357 Leenhouts et al. Dec 2010 B2
7888075 McCarthy et al. Feb 2011 B2
7897367 Klaenhammer et al. Mar 2011 B2
7927864 Owen Apr 2011 B2
7935804 Dubensky, Jr. et al. May 2011 B2
7939087 Telford et al. May 2011 B2
7955604 Telford et al. Jun 2011 B2
7960505 OSullivan et al. Jun 2011 B2
7960533 Reinscheid et al. Jun 2011 B2
7968100 Foster et al. Jun 2011 B2
7968297 Meinke et al. Jun 2011 B2
7968683 Beyer et al. Jun 2011 B1
8007803 Emery et al. Aug 2011 B2
8007811 Emery et al. Aug 2011 B2
8025885 Emery et al. Sep 2011 B2
8025890 Telford et al. Sep 2011 B2
8038990 Wang et al. Oct 2011 B2
8039005 Bensi et al. Oct 2011 B2
8063014 Stupp et al. Nov 2011 B2
8076295 Hulvat et al. Dec 2011 B2
8088611 Prongay et al. Jan 2012 B2
8101194 Zlotnick et al. Jan 2012 B2
8105612 Soriani et al. Jan 2012 B2
8110199 Gilbert et al. Feb 2012 B2
8124107 Hook et al. Feb 2012 B2
8124583 Stupp et al. Feb 2012 B2
8128936 Grandi et al. Mar 2012 B2
8137673 Telford et al. Mar 2012 B2
8138140 Stupp et al. Mar 2012 B2
8148321 Roy et al. Apr 2012 B2
8241642 Zagursky et al. Aug 2012 B2
8252546 Briles et al. Aug 2012 B2
8263642 Skaar et al. Sep 2012 B2
8280643 Hook et al. Oct 2012 B2
8287885 Margarit Y Ros et al. Oct 2012 B2
8318908 Reinscheid et al. Nov 2012 B2
8323660 Meinke et al. Dec 2012 B2
8329195 Briles et al. Dec 2012 B2
8372411 Meinke et al. Feb 2013 B2
8377446 Soriani et al. Feb 2013 B2
8399651 Margarit Y Ros et al. Mar 2013 B2
8409589 Bensi et al. Apr 2013 B2
8431139 Telford et al. Apr 2013 B2
8445426 De Vos et al. May 2013 B2
8450271 Shah et al. May 2013 B2
8475809 Leigh Jul 2013 B2
8524241 Seed et al. Sep 2013 B2
8529913 Grandi et al. Sep 2013 B2
8557961 Silverman et al. Oct 2013 B2
8563001 Dodge et al. Oct 2013 B2
8563006 Zlotnick et al. Oct 2013 B2
8563007 Zlotnick et al. Oct 2013 B1
8568735 Anderson et al. Oct 2013 B2
8574597 Zlotnick Nov 2013 B2
8575070 Watt et al. Nov 2013 B2
8580923 Stupp et al. Nov 2013 B2
8580939 Dubensky, Jr. et al. Nov 2013 B2
8591899 Shafferman et al. Nov 2013 B2
8592375 Yeaman et al. Nov 2013 B2
8598342 Kahne et al. Dec 2013 B2
8609106 Masignani et al. Dec 2013 B2
8617556 Beaumont et al. Dec 2013 B2
8632783 Bagnoli et al. Jan 2014 B2
8647835 Walsh et al. Feb 2014 B2
8652800 Walsh et al. Feb 2014 B2
8663631 Quinn Mar 2014 B2
8663926 Boyer et al. Mar 2014 B2
8669226 Bond et al. Mar 2014 B2
8673860 Schellenberger et al. Mar 2014 B2
8679505 Bagnoli et al. Mar 2014 B2
8680050 Schellenberger et al. Mar 2014 B2
8703717 Schellenberger et al. Apr 2014 B2
8709431 Chowdari et al. Apr 2014 B2
8709436 Emery et al. Apr 2014 B2
8709760 Emery et al. Apr 2014 B2
8710188 Beyer et al. Apr 2014 B2
8715688 Meinke et al. May 2014 B2
8716448 Schellenberger et al. May 2014 B2
8722354 Sjong et al. May 2014 B2
8748122 Hyman et al. Jun 2014 B2
8754198 Lunder et al. Jun 2014 B2
8758765 Missiakas et al. Jun 2014 B2
8772049 Love et al. Jul 2014 B2
8778358 Telford et al. Jul 2014 B2
8795965 Zhang Aug 2014 B2
8795983 Hyman et al. Aug 2014 B2
8808699 Schneewind et al. Aug 2014 B2
8821894 Schneewind et al. Sep 2014 B2
8822409 Milech et al. Sep 2014 B2
8835187 Love et al. Sep 2014 B2
8835188 Love et al. Sep 2014 B2
8840906 Bubeck-Wardenburg et al. Sep 2014 B2
8841249 Johansen et al. Sep 2014 B2
8853382 Hammarstrom et al. Oct 2014 B2
8858957 Margarit Y Ros et al. Oct 2014 B2
8859492 Cowan et al. Oct 2014 B2
8865479 Love et al. Oct 2014 B2
8871204 Brezski et al. Oct 2014 B2
8871445 Cong et al. Oct 2014 B2
8883788 Hasui et al. Nov 2014 B2
8889145 Anderson et al. Nov 2014 B2
8889150 Malouin et al. Nov 2014 B2
8889356 Zhang Nov 2014 B2
8927230 Hoess et al. Jan 2015 B2
8932814 Cong et al. Jan 2015 B2
8933193 OSullivan et al. Jan 2015 B2
8933197 Stemmer et al. Jan 2015 B2
8937167 Janetka et al. Jan 2015 B2
8940501 Ploegh et al. Jan 2015 B2
8945542 Heartlein et al. Feb 2015 B2
8945588 Schneewind et al. Feb 2015 B2
8945589 Telford et al. Feb 2015 B2
8945855 Iverson et al. Feb 2015 B2
8946381 Fear et al. Feb 2015 B2
8957021 Schellenberger et al. Feb 2015 B2
8961979 Emery et al. Feb 2015 B2
8975232 Liu et al. Mar 2015 B2
8980284 Ichtchenko et al. Mar 2015 B2
8980824 Cong et al. Mar 2015 B2
8986710 Anderson et al. Mar 2015 B2
8993295 Seed et al. Mar 2015 B2
9005579 Nowinski et al. Apr 2015 B2
9050374 Watts et al. Jun 2015 B2
9056912 Grandi et al. Jun 2015 B2
9062299 Schellenberger et al. Jun 2015 B2
9068985 Sjong et al. Jun 2015 B2
9079946 Grandi et al. Jul 2015 B2
9079952 Collier et al. Jul 2015 B2
9080159 Briles et al. Jul 2015 B2
9090677 Beaumont et al. Jul 2015 B2
9095540 Schneewind et al. Aug 2015 B2
9102741 Margarit Y Ros et al. Aug 2015 B2
9107873 Zlotnick et al. Aug 2015 B2
9109008 Cong et al. Aug 2015 B2
9114105 Anderson et al. Aug 2015 B2
9127050 Scully et al. Sep 2015 B2
9128058 Walsh et al. Sep 2015 B2
9129785 Dulay et al. Sep 2015 B2
9132179 Van Ginkel et al. Sep 2015 B2
9132182 Zlotnick et al. Sep 2015 B2
9134304 Wagner et al. Sep 2015 B2
9150626 Liu et al. Oct 2015 B2
9156850 Chowdari et al. Oct 2015 B2
9168293 Zlotnick et al. Oct 2015 B2
9168312 Schellenberger et al. Oct 2015 B2
9181297 Pentelute et al. Nov 2015 B1
9181329 Bubeck-Wardenburg et al. Nov 2015 B2
9182390 Nishimura et al. Nov 2015 B2
9205142 Bagnoli et al. Dec 2015 B2
9212219 Schneewind et al. Dec 2015 B2
9217157 Garcia-Sastre et al. Dec 2015 B2
9221882 Skerra et al. Dec 2015 B2
9221886 Liu et al. Dec 2015 B2
9221902 Smider et al. Dec 2015 B2
9234012 Saito et al. Jan 2016 B2
9238010 Hammer et al. Jan 2016 B2
9243038 Liu et al. Jan 2016 B2
9249211 Schellenberger et al. Feb 2016 B2
9266925 Zecri et al. Feb 2016 B2
9266943 Beaumont et al. Feb 2016 B2
9266944 Emery et al. Feb 2016 B1
9267127 Liu et al. Feb 2016 B2
9315554 Schneewind et al. Apr 2016 B2
9340582 Yuan et al. May 2016 B2
9340584 Wolfe et al. May 2016 B2
9353160 Foster et al. May 2016 B2
9371369 Schellenberger et al. Jun 2016 B2
9376672 Schellenberger et al. Jun 2016 B2
9382289 Cong et al. Jul 2016 B2
9388225 Del Campo Ascarateil et al. Jul 2016 B2
9393294 Gierahn et al. Jul 2016 B2
9394092 Lee et al. Jul 2016 B2
9399673 Beaumont et al. Jul 2016 B2
9403904 Smider et al. Aug 2016 B2
9404922 Fischetti et al. Aug 2016 B2
9405069 Fattinger Aug 2016 B2
9408890 Comolli et al. Aug 2016 B2
9409952 Kariyuki et al. Aug 2016 B2
9416171 Lydon Aug 2016 B2
9434774 Liu et al. Sep 2016 B2
9441016 Altermann et al. Sep 2016 B2
9458228 Beaumont et al. Oct 2016 B2
9458229 Grandi et al. Oct 2016 B2
9463431 Love et al. Oct 2016 B2
10100080 Pallisse Bergwerf Oct 2018 B2
20020028457 Empedocles et al. Mar 2002 A1
20030021789 Xu et al. Jan 2003 A1
20030022178 Schneewind et al. Jan 2003 A1
20030087864 Talbot et al. May 2003 A1
20030091577 Gilbert et al. May 2003 A1
20030099940 Empedocles et al. May 2003 A1
20030153020 Schneewind et al. Aug 2003 A1
20030180816 Leenhouts et al. Sep 2003 A1
20030185833 Foster et al. Oct 2003 A1
20030186851 Leenhouts et al. Oct 2003 A1
20030228297 Chang et al. Dec 2003 A1
20040091856 Pelletier et al. May 2004 A1
20040101919 Hook et al. May 2004 A1
20040110181 Zagursky et al. Jun 2004 A1
20040126870 Arigoni et al. Jul 2004 A1
20040167068 Zlotnick et al. Aug 2004 A1
20040230033 Walker Nov 2004 A1
20040236072 Olmsted et al. Nov 2004 A1
20050002925 Xu et al. Jan 2005 A1
20050003510 Chang et al. Jan 2005 A1
20050037444 Meinke et al. Feb 2005 A1
20050048545 Cull et al. Mar 2005 A1
20050069984 Schneewind et al. Mar 2005 A1
20050106648 Foster et al. May 2005 A1
20050112612 Klaenhammer et al. May 2005 A1
20050175581 Haupts et al. Aug 2005 A1
20050203280 McMichael et al. Sep 2005 A1
20050207995 Gregory et al. Sep 2005 A1
20050220788 Nagy et al. Oct 2005 A1
20050233396 Hruby et al. Oct 2005 A1
20050276814 Gilbert et al. Dec 2005 A1
20060073530 Schneewind et al. Apr 2006 A1
20060074016 Yeaman et al. Apr 2006 A1
20060078901 Buchrieser et al. Apr 2006 A1
20060115491 Leenhouts et al. Jun 2006 A1
20060135416 Yeaman et al. Jun 2006 A1
20060165716 Telford et al. Jul 2006 A1
20060177462 Anderson et al. Aug 2006 A1
20060188975 Ramaswami Aug 2006 A1
20060194226 Liu et al. Aug 2006 A1
20060198852 Hook et al. Sep 2006 A1
20060234222 McKeown et al. Oct 2006 A1
20060246080 Alibek et al. Nov 2006 A1
20060257413 Zlotnick et al. Nov 2006 A1
20060263846 Meinke et al. Nov 2006 A1
20060269538 Koltermann et al. Nov 2006 A1
20060275315 Telford et al. Dec 2006 A1
20070003667 Klaenhammer et al. Jan 2007 A1
20070026011 Liu et al. Feb 2007 A1
20070031832 Watt et al. Feb 2007 A1
20070053924 Tettelin et al. Mar 2007 A1
20070059295 Wang et al. Mar 2007 A1
20070082006 Zlotnick et al. Apr 2007 A1
20070082007 Zlotnick et al. Apr 2007 A1
20070082866 Zlotnick et al. Apr 2007 A1
20070117197 Chang et al. May 2007 A1
20070128210 Olmsted et al. Jun 2007 A1
20070128211 Olmsted et al. Jun 2007 A1
20070128229 Olmsted et al. Jun 2007 A1
20070172495 Klaenhammer et al. Jul 2007 A1
20070190029 Pardoll et al. Aug 2007 A1
20070190063 Bahjat et al. Aug 2007 A1
20070207170 Dubensky et al. Sep 2007 A1
20070207171 Dubensky et al. Sep 2007 A1
20070218075 Matsuka et al. Sep 2007 A1
20070248581 Chen et al. Oct 2007 A1
20070253964 Zlotnick et al. Nov 2007 A1
20070258955 Klaenhammer et al. Nov 2007 A1
20070286866 Van Ginkel et al. Dec 2007 A1
20080031877 Covacci et al. Feb 2008 A1
20080038287 Meinke et al. Feb 2008 A1
20080050361 Heinrichs et al. Feb 2008 A1
20080064079 Hoess et al. Mar 2008 A1
20080089899 Gilbert et al. Apr 2008 A1
20080171059 Howland et al. Jul 2008 A1
20080175857 Gilbert et al. Jul 2008 A1
20080220441 Birnbaum et al. Sep 2008 A1
20080248522 Seefeldt et al. Oct 2008 A1
20080254070 Gilbert et al. Oct 2008 A1
20080260768 Gilbert et al. Oct 2008 A1
20090022753 Olmsted et al. Jan 2009 A1
20090035780 McCarthy et al. Feb 2009 A1
20090041744 Ostergaard et al. Feb 2009 A1
20090075839 Zagursky et al. Mar 2009 A1
20090088337 Gill et al. Apr 2009 A1
20090088372 Roy et al. Apr 2009 A1
20090092582 Bogin et al. Apr 2009 A1
20090117113 Bensi et al. May 2009 A1
20090130115 Hook et al. May 2009 A1
20090148408 Chang et al. Jun 2009 A1
20090155304 Liu et al. Jun 2009 A1
20090176967 Stennicke Jul 2009 A1
20090202578 Foster et al. Aug 2009 A1
20090202593 Zlotnick et al. Aug 2009 A1
20090214476 Pretzer et al. Aug 2009 A1
20090214537 Soriani et al. Aug 2009 A1
20090214584 Guss et al. Aug 2009 A1
20090239264 Leenhouts et al. Sep 2009 A1
20090297548 Kudva et al. Dec 2009 A1
20090297549 Tettelin et al. Dec 2009 A1
20090305252 Li et al. Dec 2009 A1
20090317420 Telford et al. Dec 2009 A1
20090317421 Missiakas et al. Dec 2009 A1
20100004324 Skaar et al. Jan 2010 A1
20100009917 Buchardt et al. Jan 2010 A1
20100055761 Seed et al. Mar 2010 A1
20100064393 Berka et al. Mar 2010 A1
20100068220 Hook et al. Mar 2010 A1
20100074923 Covacci et al. Mar 2010 A1
20100098789 Balambika et al. Apr 2010 A1
20100105865 Telford et al. Apr 2010 A1
20100119534 Dodge et al. May 2010 A1
20100150943 Grandi et al. Jun 2010 A1
20100152054 Love et al. Jun 2010 A1
20100183614 Paul et al. Jul 2010 A1
20100184624 Samuel et al. Jul 2010 A1
20100196524 Meindert De Vos et al. Aug 2010 A1
20100221288 Zagursky et al. Sep 2010 A1
20100227341 Briles et al. Sep 2010 A1
20100239554 Schellenberger et al. Sep 2010 A1
20100247561 Anderson et al. Sep 2010 A1
20100255026 Stump et al. Oct 2010 A1
20100256070 Seed et al. Oct 2010 A1
20100260706 Bogin et al. Oct 2010 A1
20100260790 Meinke et al. Oct 2010 A1
20100267053 Prongay et al. Oct 2010 A1
20100278740 Gilbert et al. Nov 2010 A1
20100279328 Hong et al. Nov 2010 A1
20100297183 Smith Nov 2010 A1
20100303864 Tettelin et al. Dec 2010 A1
20100323956 Schellenberger et al. Dec 2010 A1
20110020323 Beaumont et al. Jan 2011 A1
20110020385 Masignani et al. Jan 2011 A1
20110020402 Meinke et al. Jan 2011 A1
20110020900 Klaenhammer et al. Jan 2011 A1
20110046008 Love et al. Feb 2011 A1
20110046060 Schellenberger et al. Feb 2011 A1
20110046061 Schellenberger et al. Feb 2011 A1
20110076299 Zlotnick et al. Mar 2011 A1
20110077199 Schellenberger et al. Mar 2011 A1
20110091956 Nishimura et al. Apr 2011 A1
20110097360 Donati et al. Apr 2011 A1
20110104168 Briles et al. May 2011 A1
20110110982 Telford et al. May 2011 A1
20110124520 Love et al. May 2011 A1
20110129935 Schaeffer Jun 2011 A1
20110150918 Foster et al. Jun 2011 A1
20110151053 Klaenhammer et al. Jun 2011 A1
20110172146 Schellenberger et al. Jul 2011 A1
20110177976 Gordon et al. Jul 2011 A1
20110183863 Wagner et al. Jul 2011 A1
20110189187 Zlotnick Aug 2011 A1
20110189236 Scott et al. Aug 2011 A1
20110189664 Dixon et al. Aug 2011 A1
20110206616 Ichtchenko et al. Aug 2011 A1
20110206676 Missiakas et al. Aug 2011 A1
20110206692 Maione et al. Aug 2011 A1
20110243976 Donati et al. Oct 2011 A1
20110243977 Olmsted et al. Oct 2011 A1
20110245480 Dubensky, Jr. et al. Oct 2011 A1
20110262477 Cheng et al. Oct 2011 A1
20110263501 Johansen Oct 2011 A1
20110275132 Covacci et al. Nov 2011 A1
20110281745 Love et al. Nov 2011 A1
20110281764 Love et al. Nov 2011 A1
20110288005 Silverman et al. Nov 2011 A1
20110311536 Von Boehmer et al. Dec 2011 A1
20110312881 Silverman et al. Dec 2011 A1
20110318339 Smider et al. Dec 2011 A1
20110321183 Ploegh et al. Dec 2011 A1
20120015379 Shafferman et al. Jan 2012 A1
20120034261 Zlotnick et al. Feb 2012 A1
20120058906 Smider et al. Mar 2012 A1
20120064103 Giuliani et al. Mar 2012 A1
20120064104 Costantino Mar 2012 A1
20120076814 Masignani et al. Mar 2012 A1
20120083599 Thomas et al. Apr 2012 A1
20120093840 Ostergaard et al. Apr 2012 A1
20120093850 Bagnoli et al. Apr 2012 A1
20120100174 Leigh Apr 2012 A1
20120100569 Liu et al. Apr 2012 A1
20120107340 Bagnoli et al. May 2012 A1
20120114686 Schneewind et al. May 2012 A1
20120121643 Dubensky, Jr. et al. May 2012 A1
20120122123 Boyer et al. May 2012 A1
20120142682 Merrill Jun 2012 A1
20120149590 Klaenhammer et al. Jun 2012 A1
20120149710 Jung et al. Jun 2012 A1
20120157665 Beaumont et al. Jun 2012 A1
20120171211 Soriani et al. Jul 2012 A1
20120172303 Johansen et al. Jul 2012 A1
20120178691 Schellenberger et al. Jul 2012 A1
20120189649 Gierahn et al. Jul 2012 A1
20120201844 Zlotnick et al. Aug 2012 A1
20120207778 Telford et al. Aug 2012 A1
20120237536 Rappuoli et al. Sep 2012 A1
20120244189 Foster et al. Sep 2012 A1
20120251568 Garcia-Sastre et al. Oct 2012 A1
20120263701 Schellenberger et al. Oct 2012 A1
20120263703 Schellenberger et al. Oct 2012 A1
20120270797 Wittrup et al. Oct 2012 A1
20120282247 Schneewind et al. Nov 2012 A1
20120282289 Bannoehr et al. Nov 2012 A1
20120282670 Rossomando Nov 2012 A1
20120282700 Lunder et al. Nov 2012 A1
20120289454 Cowan et al. Nov 2012 A1
20120294880 Zlotnick et al. Nov 2012 A1
20120301428 Wren et al. Nov 2012 A1
20120301433 Lu et al. Nov 2012 A1
20120301496 Zlotnick et al. Nov 2012 A1
20120308595 Zlotnick et al. Dec 2012 A1
20120309679 Hesse et al. Dec 2012 A1
20120309701 Janetka et al. Dec 2012 A1
20120316071 Smider et al. Dec 2012 A1
20130011386 Brezski et al. Jan 2013 A1
20130011428 Zagursky et al. Jan 2013 A1
20130017997 Schellenberger et al. Jan 2013 A1
20130034575 Meinke et al. Feb 2013 A1
20130034847 Kojic et al. Feb 2013 A1
20130039884 Bogin et al. Feb 2013 A1
20130045211 Nowinski et al. Feb 2013 A1
20130064845 Malouin et al. Mar 2013 A1
20130071416 Grandi et al. Mar 2013 A1
20130072420 Skerra et al. Mar 2013 A1
20130084648 Bolton et al. Apr 2013 A1
20130089525 Bond et al. Apr 2013 A1
20130101665 Ugolin et al. Apr 2013 A1
20130122043 Guimaraes et al. May 2013 A1
20130136746 Schneewind et al. May 2013 A1
20130136761 Meinke et al. May 2013 A1
20130143955 Breaker et al. Jun 2013 A1
20130157281 Beyer et al. Jun 2013 A1
20130165389 Schellenberger et al. Jun 2013 A1
20130171183 Schneewind Jul 2013 A1
20130177940 Hoess et al. Jul 2013 A1
20130184177 Bosma Jul 2013 A1
20130189287 Bregeon et al. Jul 2013 A1
20130209494 Chowdari et al. Aug 2013 A1
20130216568 Maione et al. Aug 2013 A1
20130217592 Samuel et al. Aug 2013 A1
20130217612 Altermann et al. Aug 2013 A1
20130230550 Schneewind et al. Sep 2013 A1
20130236419 Schneewind et al. Sep 2013 A1
20130243818 Leigh Sep 2013 A1
20130253175 Beaumont et al. Sep 2013 A1
20130259889 Zlotnick et al. Oct 2013 A1
20130260404 Sjong et al. Oct 2013 A1
20130261293 Beaumont et al. Oct 2013 A1
20130288266 Gerg et al. Oct 2013 A1
20130288267 Gerg et al. Oct 2013 A1
20130289251 Gallusser et al. Oct 2013 A1
20130289253 Uescher et al. Oct 2013 A1
20130296257 Saito et al. Nov 2013 A1
20130316946 Barrack Nov 2013 A1
20130323819 Hammarstrom et al. Dec 2013 A1
20130330335 Bremel et al. Dec 2013 A1
20130338030 Love et al. Dec 2013 A1
20130338047 Love et al. Dec 2013 A1
20130344010 Pompejus Dec 2013 A1
20140004138 Briles et al. Jan 2014 A1
20140011709 Love et al. Jan 2014 A1
20140017764 Iverson et al. Jan 2014 A1
20140030697 Ploegh et al. Jan 2014 A1
20140037650 Kim et al. Feb 2014 A1
20140037669 Scully et al. Feb 2014 A1
20140051834 Hoffman et al. Feb 2014 A1
20140057317 Liu et al. Feb 2014 A1
20140065171 Geierstanger et al. Mar 2014 A1
20140073639 Fischetti et al. Mar 2014 A1
20140105818 Hammer et al. Apr 2014 A1
20140113832 Wolfe et al. Apr 2014 A1
20140128289 Gordon et al. May 2014 A1
20140147873 Clubb et al. May 2014 A1
20140154286 Malley et al. Jun 2014 A1
20140154287 Malley et al. Jun 2014 A1
20140155319 Bond et al. Jun 2014 A1
20140161915 Payne et al. Jun 2014 A1
20140162949 Cleland et al. Jun 2014 A1
20140170702 Reitmeir et al. Jun 2014 A1
20140178425 Bagnoli et al. Jun 2014 A1
20140179006 Zhang Jun 2014 A1
20140186265 McNaughton et al. Jul 2014 A1
20140186327 Schellenberger et al. Jul 2014 A1
20140186350 Ghosh et al. Jul 2014 A1
20140186354 Bossenmaier et al. Jul 2014 A1
20140186358 Bossenmaier et al. Jul 2014 A1
20140189896 Zhang et al. Jul 2014 A1
20140193438 Chowdari et al. Jul 2014 A1
20140206840 Sjong et al. Jul 2014 A1
20140213515 Liu et al. Jul 2014 A1
20140227295 Cong et al. Aug 2014 A1
20140227298 Cong et al. Aug 2014 A1
20140234972 Zhang Aug 2014 A1
20140235828 Beaumont et al. Aug 2014 A1
20140243280 Herrmann et al. Aug 2014 A1
20140248702 Zhang et al. Sep 2014 A1
20140249296 Ploegh et al. Sep 2014 A1
20140255470 Comolli et al. Sep 2014 A1
20140273231 Zhang et al. Sep 2014 A1
20140287509 Sharei et al. Sep 2014 A1
20140301974 Schellenberger et al. Oct 2014 A1
20140302084 Schneewind et al. Oct 2014 A1
20140308318 Watts et al. Oct 2014 A1
20140310830 Zhang et al. Oct 2014 A1
20140315314 Dubensky, Jr. et al. Oct 2014 A1
20140328819 Schellenberger et al. Nov 2014 A1
20140329706 Gale Nov 2014 A1
20140329750 Andersen et al. Nov 2014 A1
20140335095 Schneewind et al. Nov 2014 A1
20140348868 Donati et al. Nov 2014 A1
20140371136 Schellenberger et al. Dec 2014 A1
20140377289 Cowan et al. Dec 2014 A1
20150004155 Beaumont et al. Jan 2015 A1
20150005233 DeFrees Jan 2015 A1
20150005481 Chin et al. Jan 2015 A1
20150010566 Spits et al. Jan 2015 A1
20150023879 Meinel et al. Jan 2015 A1
20150023959 Chhabra et al. Jan 2015 A1
20150030594 Yuan et al. Jan 2015 A1
20150031134 Zhang et al. Jan 2015 A1
20150031563 Huynh et al. Jan 2015 A1
20150031604 Zecri et al. Jan 2015 A1
20150037359 Schellenberger et al. Feb 2015 A1
20150037421 Lu et al. Feb 2015 A1
20150037828 Dulay et al. Feb 2015 A1
20150038421 Schellenberger et al. Feb 2015 A1
20150045535 Berka et al. Feb 2015 A1
20150050717 Collins et al. Feb 2015 A1
20150051082 Barker et al. Feb 2015 A1
20150056239 Flechtner et al. Feb 2015 A1
20150056240 Schneewind et al. Feb 2015 A1
20150071957 Kelly et al. Mar 2015 A1
20150079132 Maisonneuve et al. Mar 2015 A1
20150079681 Zhang Mar 2015 A1
20150086576 Ploegh et al. Mar 2015 A1
20150087545 Nair et al. Mar 2015 A1
20150093406 Del Campo Ascarateil et al. Apr 2015 A1
20150093413 Thess et al. Apr 2015 A1
20150104468 Geierstanger et al. Apr 2015 A1
20150118183 Baumhof Apr 2015 A1
20150118264 Baumhof et al. Apr 2015 A1
20150132324 Cong et al. May 2015 A1
20150132335 Malouin et al. May 2015 A1
20150132339 Bufali et al. May 2015 A1
20150139984 Brezski et al. May 2015 A1
20150152134 Pentelute et al. Jun 2015 A1
20150158929 Schellenberger et al. Jun 2015 A1
20150165062 Liao et al. Jun 2015 A1
20150166640 Lydon Jun 2015 A1
20150168405 Kojic et al. Jun 2015 A1
20150174130 Skaar et al. Jun 2015 A1
20150182588 Kahvejian et al. Jul 2015 A1
20150184142 Hong et al. Jul 2015 A1
20150185216 Albert et al. Jul 2015 A1
20150197538 Janetka et al. Jul 2015 A1
20150197734 Ma et al. Jul 2015 A1
20150203834 Iverson et al. Jul 2015 A1
20150210756 Torres et al. Jul 2015 A1
20150216960 Zlotnick et al. Aug 2015 A1
20150231228 Amara et al. Aug 2015 A1
20150232518 Foster et al. Aug 2015 A1
20150232541 Fenn et al. Aug 2015 A1
20150232560 Heindl et al. Aug 2015 A1
20150232561 Fenn et al. Aug 2015 A1
20150241440 Fasan et al. Aug 2015 A1
20150246024 Richter et al. Sep 2015 A1
20150253335 Burkart et al. Sep 2015 A1
20150258210 Van Delft et al. Sep 2015 A1
20150259389 Berka et al. Sep 2015 A9
20150259397 Lee et al. Sep 2015 A1
20150259431 Stemmer et al. Sep 2015 A1
20150266943 Chhabra et al. Sep 2015 A1
20150273040 McAdow et al. Oct 2015 A1
20150273042 Maione et al. Oct 2015 A1
20150274800 Schellenberger et al. Oct 2015 A1
20150284452 Bremel et al. Oct 2015 A1
20150284477 Chaikof et al. Oct 2015 A1
20150290362 Douglas et al. Oct 2015 A1
20150291704 Beck et al. Oct 2015 A1
20150305361 Holz-Schietinger et al. Oct 2015 A1
20150306212 Kahvejian et al. Oct 2015 A1
20150306218 Nowinski et al. Oct 2015 A1
20150309021 Birnbaum et al. Oct 2015 A1
20150315248 Galeotti et al. Nov 2015 A1
20150320882 Van Delft et al. Nov 2015 A1
20150329568 Tuttle et al. Nov 2015 A1
20150329590 Pentelute et al. Nov 2015 A1
20150335724 Zlotnick et al. Nov 2015 A1
20150338579 Fattinger Nov 2015 A1
20150343051 Grandi et al. Dec 2015 A1
20150344862 Schellenberger et al. Dec 2015 A1
20150346195 Belmant et al. Dec 2015 A1
20150368322 McAdow et al. Dec 2015 A1
20150374811 Malley et al. Dec 2015 A1
20150376266 Beaumont et al. Dec 2015 A1
20160000895 Barta et al. Jan 2016 A1
20160002338 Bossenmaier et al. Jan 2016 A1
20160002346 Bossenmaier et al. Jan 2016 A1
20160002645 Clubb et al. Jan 2016 A1
20160018397 Fischetti et al. Jan 2016 A1
20160022776 Lee Jan 2016 A1
20160022833 Bregeon Jan 2016 A1
20160025740 Song et al. Jan 2016 A1
20160032346 Tsourkas et al. Feb 2016 A1
20160038581 Bielke et al. Feb 2016 A1
20160040158 Wagner et al. Feb 2016 A1
20160041157 Tsourkas et al. Feb 2016 A1
20160045885 Love et al. Feb 2016 A1
20160052982 Cohen et al. Feb 2016 A1
20160068583 Van Vlasselaer et al. Mar 2016 A1
20160068589 Lydon Mar 2016 A1
20160068591 Anderson et al. Mar 2016 A1
20160069894 Smider et al. Mar 2016 A1
20160073671 Geistlinger et al. Mar 2016 A1
20160074497 Falugi et al. Mar 2016 A1
20160074498 Hultgren et al. Mar 2016 A1
20160082046 Lodish et al. Mar 2016 A1
20160090351 Hedstrom et al. Mar 2016 A1
20160090404 Malley et al. Mar 2016 A1
20160097773 Pasqual et al. Apr 2016 A1
20160102137 Bjorkman et al. Apr 2016 A1
20160102332 Collier et al. Apr 2016 A1
20160102344 Niemeyer et al. Apr 2016 A1
20160108091 Zecri et al. Apr 2016 A1
20160114046 Brudno et al. Apr 2016 A1
20160115222 Lydon Apr 2016 A1
20160115488 Zhang et al. Apr 2016 A1
20160115489 Zhang et al. Apr 2016 A1
20160122405 Palchaudhuri et al. May 2016 A1
20160122451 Chilkoti et al. May 2016 A1
20160122707 Swee et al. May 2016 A1
20160123991 Mumm et al. May 2016 A1
20160129101 Biemans et al. May 2016 A1
20160130299 Perez et al. May 2016 A1
20160136298 Grawunder et al. May 2016 A1
20160137698 Skerra et al. May 2016 A1
20160137711 Schellenberger et al. May 2016 A1
20160137720 Song et al. May 2016 A1
20160146786 Hopkins et al. May 2016 A1
20160146794 Johnsson et al. May 2016 A1
20160158335 Bagnoli et al. Jun 2016 A1
20160166634 Caplan et al. Jun 2016 A1
20160168232 Beaumont et al. Jun 2016 A9
20160175412 Von Boehmer et al. Jun 2016 A1
20160175441 Schneewind et al. Jun 2016 A1
20160178627 Albert et al. Jun 2016 A1
20160184421 Huang et al. Jun 2016 A1
20160185791 Nicolaou et al. Jun 2016 A1
20160185817 Zhu et al. Jun 2016 A1
20160185828 Joshi et al. Jun 2016 A1
20160193355 Qin et al. Jul 2016 A1
20160194363 Schneewind et al. Jul 2016 A1
20160194410 Gallusser et al. Jul 2016 A1
20160194627 Smider et al. Jul 2016 A1
20160199454 Liu et al. Jul 2016 A1
20160199510 McDonald et al. Jul 2016 A1
20160200742 Zhang et al. Jul 2016 A1
20160206566 Lu et al. Jul 2016 A1
20160208233 Liu et al. Jul 2016 A1
20160213744 Liu et al. Jul 2016 A1
20160220686 Brudno et al. Aug 2016 A1
20160222096 Beaumont et al. Aug 2016 A1
20160230216 Nair et al. Aug 2016 A1
20160244747 Liu et al. Aug 2016 A1
20160244784 Jacobson et al. Aug 2016 A1
20160251409 Oestergaard et al. Sep 2016 A1
20160257749 Lifke et al. Sep 2016 A1
20160257932 Kahvejian et al. Sep 2016 A1
20160264624 Cong et al. Sep 2016 A1
20160271268 Shih et al. Sep 2016 A1
20160279192 Saito et al. Sep 2016 A1
20160279257 Koussa et al. Sep 2016 A1
20160280748 Liu et al. Sep 2016 A1
20160282369 Cravatt et al. Sep 2016 A1
20160287734 Rashidian et al. Oct 2016 A1
20160297854 Ghosh et al. Oct 2016 A1
Non-Patent Literature Citations (2)
Entry
Chatlin et al., Delivery of antisense oligonucleotides using cholesterol-modified sense dendrimers and cationic lipids, Bioconjugate Chem 16, 827-836. (Year: 2005).
Burglin, T., The hedgehog protein family, Genome Biology, 9:241 (doi:10.1186/GB-2008-9-11-241) (Year: 2008).
Related Publications (1)
Number Date Country
20200377920 A1 Dec 2020 US
Provisional Applications (1)
Number Date Country
62409655 Oct 2016 US
Divisions (1)
Number Date Country
Parent 15782391 Oct 2017 US
Child 16989843 US