METHOD FOR TREATMENT AND PROPHYLAXIS OF CRS IN PATIENTS COMPRISING A COMBINATION OF BISPECIFIC ANTIBODIES BINDING TO CDS X CANCER CELL AND TNF ALPHA OR IL-6 INHIBITOR

Information

  • Patent Application
  • 20230146593
  • Publication Number
    20230146593
  • Date Filed
    March 12, 2021
    3 years ago
  • Date Published
    May 11, 2023
    a year ago
Abstract
The present invention relates to medical combination products comprising (i) at least one antibody construct comprising at least one domain which binds to a target antigen expressed on the surface of a cell and at least one other domain which binds to CD3 as well as (ii) at least one molecule that is inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling and/or an inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling, wherein a first dose of said inhibitor/antagonist is administered before administration of a first dose of said antibody construct. Furthermore, the invention provides therapeutic and preventive methods and medical uses of said combination products, as well as a kit comprising said at least one antibody construct and at least one antagonist/inhibitor of TNF or IL6 or its cognate receptor, wherein the interaction of said antagonist/inhibitor of TNF or an inhibitor/antagonist of IL6 with its cognate receptor reduces, mitigates, prevents, or treats cytokine release syndrome.
Description

The present invention relates to medical uses of antibody constructs comprising at least one domain which binds to CD3 on a T cell and at least one other domain that binds a target on a target cell in combinations with inhibitors/antagonists of TNF-alpha (TNF) and/or TNF-alpha-Receptor (TNFR), thereby reducing or blocking signaling that is based on a TNF/TNFR interaction, or inhibitors/antagonists of interleukin 6 (IL6) and/or IL6-Receptor (IL6R), thereby reducing or blocking signaling that is based on a IL6/IL6R interaction. The pharmaceutical combination products or kits comprising the above inhibitors/antagonists and CD3-binding antibody constructs disclosed herein may be used in the treatment, prevention or mitigation of neoplastic cell growth or cancer and block the development of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) or mitigate, ameliorate or treat symptoms associated with excessive release of cytokines, particularly with CRS or TLS.


BACKGROUND OF THE INVENTION

Recently, immunotherapeutic approaches in the treatment, prevention, mitigation of neoplastic cell growth in cancer patients have witnessed impressive progress. For example, the CD19-directed bispecific T-cell engager (BiTE®) molecule Blinatumumab was approved in 2014 for treating Philadelphia chromosome-negative relapsed or refractory B-cell precursor ALL under the FDA's accelerated approval program. T cell engaging (TCE) constructs comprising one domain that binds to CD3 on T cells and another domain that binds to a protein expressed on target cells directly connect T cells to target cells to induce T cell redirected lysis. This mechanism of action is distinct from chemotherapy and other immunotherapy in that it can work with any CD3-positive T cell, independent of a costimulatory activating signal (Klinger et al., Immunol Reviews 2016).


However, occasionally patients that have been treated with effector molecules that comprise a domain binding CD3 are associated with adverse events, for example, due to an excessive activation of the immune system resulting in the release of proinflammatory cytokines. The release of these cytokines may cause milder adverse events, such as mild headaches. In rare events, patients may develop CRS. CRS can present with a variety of symptoms ranging from mild, flu-like symptoms to severe life-threatening manifestations of the excessive inflammatory response. Mild symptoms of CRS include fever, fatigue, headache, rashes, arthralgia, and myalgia. More severe cases are characterized by hypotension as well as high fever and can progress to an uncontrolled systems inflammatory response with vasopressor-requiring circulatory shock, vascular leakage, disseminated intravascular coagulation, and multi-organ system failure. Laboratory abnormalities that are common in patients with CRS include cytopenias, elevated creatinine and liver enzymes, deranged coagulation parameters, and a high CRP (Shimabukuro-Vornhagen et al., J. ImmunoTher Cancer (2018) 6:56). These adverse events are not only seen in patients treated with BiTE® molecules, but also in patients who have been administered with monoclonal antibodies, chimeric antigen receptor (CAR) T-cells, and tyrosine kinase inhibitors (Riegler et al., Therapeutics and Clinical Risk Management 2019: 15, 323-335).


The FDA recently approved tocilizumab, a monoclonal antibody that competes with the binding of the proinflammatory cytokine IL6 to its receptor, IL6R, thereby inhibiting IL6R signaling in effector cells, for the treatment of severe or life-threatening CAR T-cell-induced CRS in adults and pediatric patients that are older than 2 years. However, tocilizumab is not recommended for the primary management of neurotoxicity, one possible adverse event associated with immunotherapy (e.g., administration of T cell engaging target-specific immunoglobulin-based constructs) and some patients do not respond to tocilizumab. In addition, tocilizumab might increase the risk of long-term immunosuppression and repetitive administration of tocilizumab to patients with rheumatic diseases has resulted in a higher incidence of lower intestinal perforations, which may not occur in the acute setting (Borrega et al., HemaSphere (2019) 3:2 (e19).


Other immunomodulatory agents that have been used or suggested for the treatment of CRS relate to very specific applications. For example, the anti-IL-6 antibody siltuximab, T cell depleting antibody alemtuzumab and Anti-Thymocyte Globulin (ATG), IL-1-based inhibitors (anakinra), cyclophosphamide, ibrutinib, and GM-CSF inhibition or cytokine adsorption have been suggested (Borrega et al., HemaSphere (2019) 3:2 (e19)). TNF-alpha (hereinafter referred to simply as “TNF” in view of the old misleading and no longer used designation “TNF-beta” for the cytokine “lymphotoxin” as suggested, inter alia, by I. A. Clark/Cytokine & Growth Factor Reviews 18 (2007) 335-343), another player in the CRS development has also been discussed. TNF inhibitors/antagonists such as etanercept and infliximab have been used with mixed results in treating severe CRS (Riegler et al., Therapeutics and Clinical Risk Management 2019: 15, 323-335; Li et al, Sci Transl Med 11, eaax8861 (2019)).


Approaches have been made to prevent, reduce or treat adverse events associated with the administration of antibody constructs comprising a T cell engager domain, e.g., a CD3 binding domain, by co-administration with glucocorticoids, for example with dexamethasone. Corticosteroids have also been used in the treatment of CAR T-cell therapy-associated CRS but results of clinical trials are divergent (Borrega et al., HemaSphere (2019) 3:2 (e19)). The general picture concerning the treatment of CRS using different immunotherapeutic approaches is therefore unclear. While in a given therapeutic setting, a specific inhibitor or modulator may be effective, other immunotherapeutic approaches that may provoke or did result in CRS may require different approaches. Accordingly, there is a persistent need for new immunotherapies in which CRS is prevented, reduced, mitigated and/or treated.


Additionally, the administration of antibody constructs engaging T cells via a domain binding CD3, which comprise at least one further domain binding a tumor antigen, occasionally requires initial high dosages to achieve maximum efficacy. High initial doses of such antibody constructs, when administered to a patient in need thereof, may also increase the risk of adverse events. This applies, for example, to half-life extended antibody constructs according to the present invention. Schemes involving the prior administration of TNF/TNFR-signaling inhibitors represent a solution to prevent adverse events, i.e. prophylactic administration provides a solution to challenges associated with initial high dosing of antibody constructs.


Further, there is also a need to provide new preventive and therapeutic measures against adverse events associated with the administration of antibody constructs comprising a T cell engager domain, e.g., a CD3 binding domain, particularly for cancer patients having a corticosteroid intolerance, for example a dexamethasone intolerance, or particularly for cancer that are at risk of developing adverse events against corticosteroids, such as dexamethasone.


Similarly, there is a need to provide new preventive measures against adverse events associated with the administration of antibody constructs comprising a T cell engager domain, e.g., a CD3 binding domain, particularly for cancer patients with an intolerance against IL6 antagonists or IL6R-antagonists, for example, particularly for cancer patients with a tocilizumab intolerance, or cancer patients that are at risk of developing adverse events against such IL6 antagonists or IL6R-antagonists, for example a tocilizumab, e.g., for those cancer patients that have developed autoantibodies against tocilizumab.


DETAILED DESCRIPTION OF THE INVENTION

The above and other problems are solved by the present invention. The present invention relates, inter alia, to the following aspects and embodiments as well as to all combinations of these embodiments provided no scientific or technical reasons exist that render such combination unfeasible. Respective products, their uses and methods involving the same will be shown in separate sections in the following description of the invention.


General Aspect A)—Combination Products

(i) A combination product for the treatment of a cancer, and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with cancer immunotherapy with an antibody construct comprising at least one domain (also referred to as “first domain”) which binds to a target antigen on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell, comprising

    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), particularly, wherein the patient is either a human being or a non-human primate, and wherein the first domain binds selectively to a target antigen selected from the group comprising CD19, CD33, FLT3, PSMA, and DLL3.


      (ii) The combination product for the treatment of a cancer, and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with cancer immunotherapy according to embodiment (i) with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3 on the surface of a T cell, wherein the adverse event associated with immunotherapy is increased cytokine release of TNF, IL-1, MCP-1, and/or IL6, particularly wherein the adverse event is cytokine release syndrome (CRS) or tumor lysis syndrome (Us), wherein the group of adverse events further comprises a neurological reaction, preferably one or more selected from the group consisting of: confusion, ataxia, disorientation, dysphasia, aphasia, speech impairment, cerebellar symptoms, tremor, apraxia, seizure, grand mal convulsion, palsy, and balance disorder.


      (iii) The combination product according to embodiment (i) or (ii) for the treatment of a cancer, and optionally also the prevention prophylaxis, or reduction of adverse events associated with cancer immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3 on the surface of a T cell, wherein the second domain of said antibody construct binds to human CD3 epsilon and to Callithrix jacchus or Saimiri sciureus CD3 epsilon.


      (iv) The combination product according to any one of embodiments (i) to (iii) for the treatment of a cancer, and optionally also, the prevention, prophylaxis, or reduction of adverse events associated with cancer immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3 on the surface of a T cell, wherein
    • (a) the antibody construct is a single chain antibody construct,
    • (b) the first domain is in the format of an scFv,
    • (c) the second domain is in the format of an scFv,
    • (d) the first and the second domain are connected via a linker, and/or
    • (e) the antibody construct comprises a domain providing an extended serum half-life.


      (v) The combination product according to any one of the preceding embodiments for the treatment of a cancer, and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with cancer immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3 on the surface of a T cell, wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group comprising small molecules, biological molecules, antibodies and derivatives thereof, and aptamers.


      (vi) The combination product according to any one of the preceding embodiments for the treatment of a cancer, and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with cancer immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group of TNF inhibitors/antagonists comprising etanercept, infliximab, adalimumab, certolizumab Pergol, and golimumab, particularly etanercept, for example as disclosed in WO2018/075818A1, which is hereby incorporated by reference in its entirety.


      (vii) The combination product according to any one of the preceding embodiments for the treatment of a cancer, and optionally also, for the prevention, prophylaxis, or reduction of adverse events associated with cancer immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3 on the surface of a T cell, wherein the first domain binds to a target antigen, wherein said target antigen is a tumor-associated antigen that is expressed or present on solid tumors and/or hematological tumors selected from the group consisting of CD19, CD33, FLT3, PSMA, BCMA, Claudin 6, Claudin 18.2, Mucin 17, and DLL3.


      (viii) The combination product according to any of the precending embodiments for the treatment of a cancer, and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with cancer immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell, wherein said combination product is for administration to a patient at risk of developing adverse events or having an intolerance to at least one of a group comprising corticosteroids, IL-6-inhibitors, IL-6R-inhibitors, and/or TNF/TNFR inhibitors different from an inhibitor/antagonist of TNF/35 TNFR that reduces TNF/TNFR signaling according to any of the preceding embodiments.


      (ix) The combination product according to any of the precending embodiments for the treatment of a cancer, and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with cancer immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3 on the surface of a T cell, wherein said combination product is for administration to a patient at risk of developing adverse events or having an intolerance to corticosteroids, wherein the corticosteroid is dexamethasone.


      (x) The combination product according to any of the precending embodiments for the treatment of a cancer, and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with cancer immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3 on the surface of a T cell, wherein the combination product is for administration to a patient at risk of developing adverse events or having an intolerance to IL-6-antagonists and/or IL-6R-antagonists, wherein said IL-6-antagonists and/or IL-6R-antagonists are selected from the group comprising tocilizumab, siltuximab, olokizumab, elsilimomab, clazakizumab, sirukumab, particularly tocilizumab, and/or wherein the combination product is for administration to a patient at risk of developing adverse events or having an intolerance to TNF/TNFR inhibitors, wherein said TNF/TNFR inhibitor is selected from the group comprising infliximab, adalimumab, certolizumab Pergol, and/or golimumab.


      (xi) The combination product according to any of embodiments (i) to (x) and (xii) for the treatment of a cancer, and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with cancer immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3 on the surface of a T cell, wherein said combination product further comprises at least one corticosteroid, and/or a non-glucocorticoidal compound.


      (xii) The combination product according to any of embodiments (i) to (x) and (xiii) for the treatment of a cancer, and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with cancer immunotherapy of a disease with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3 on the surface of a T cell, said combination product further comprises at least one corticosteroid, wherein said corticostoid is dexamethasone, and/or said non-glucocorticoidal compound is selected from the group comprising natalizumab, PPS, and minocylin.


      (xiii) The combination product according to any of embodiments (i) to (xi), (xiii), and (xiv) for the treatment of a cancer and optionally also, for the prevention, prophylaxis, or reduction of adverse events associated with cancer immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3 on the surface of a T cell, wherein said combination product further comprises an IL-6R-antagonist, wherein said IL-6R-antagonist is tocilizumab.


      (xiv) The combination product according to any of embodiments (i) to (ix) for the treatment of a cancer, and, optionally also, for the prevention, prophylaxis, or reduction of adverse events associated with cancer immunotherapy of a disease with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3 on the surface of a T cell, further comprising at least one corticosteroid, particularly dexamethasone and/or at least one IL-6 and/or IL-6R-antagonist, particularly tocilizumab, wherein said at least one corticosteroid and/or said IL-6 and/or IL-6R-antagonist is for administration to a patient in need thereof prior to, concomitant with, and/or after administration of said antibody construct (a).


The combination products according to any one of the above embodiments comprise antibody constructs, which are described in the following sections entitled Sub-Aspect A-1 to Sub-Aspect A-5.


Sub-Aspect A-1—Constructs Binding CD19 in Combination Products of the Invention

According to the present invention, one target antigen on the surface of a target cell that is selectively bound by the first domain of the antibody constructs, which are part of combination products, kits, etc., and may be used or administered in methods according to the invention, is CD19.


According to the invention, antibody contructs that comprise a CD19-binding domain are disclosed, for example, in WO2010052014, which is hereby incorporated by reference in its entirety. Some of the therein disclosed antibody constructs and domains binding to CD19 are also shown in the Sequence Listing below.


Also encompassed in the combination products according to the present invention may be antibodies competing with those explicitly recited herein, i.e. those characterized by specific SEQ ID numbers. Whether or not an antibody construct binds to the same epitope of CD19 as another given antibody construct can be measured e.g. by epitope mapping with chimeric or truncated target molecules, e.g. as described herein above and in the Examples in WO2017021362. Further, whether an antibody construct competes for binding with another given antibody construct can be measured in a competition assay such as a competitive ELISA or a cell-based competition assay. Avidin-coupled microparticles (beads) can also be used. Like an avidin-coated ELISA plate, when reacted with a biotinylated protein, each of these beads can be used as a substrate on which an assay can be performed. Antigen is coated onto a bead and then precoated with the first antibody. The second antibody is added, and any additional binding is determined. Possible methods for the read-out include flow cytometry.


Accordingly, it is envisaged for the antibody construct used in accordance with the present invention that the domain which binds to CD19 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


It is also envisaged for the antibody construct used in accordance with the present invention that the domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3, wherein CDR-L1 is depicted in SEQ ID NO:314, CDR-L2 is depicted in SEQ ID NO: 315, and CDR-L3 is depicted in SEQ ID NO: 316.


It is furthermore envisaged for the antibody construct used in accordance with the present invention that the domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-142 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


It is envisaged for the antibody construct used in accordance with the present invention that the domain which binds to CD19 comprises a VH region as depicted in any one of SEQ ID NO: 308.


It is also envisaged for the antibody construct used in accordance with the present invention that the domain which binds to CD19 that the domain which binds to CD19 comprises a VL region as depicted in SEQ ID NO: 309.


More preferably, the antibody construct in accordance with the present invention is characterized by the domain which binds to CD19 comprising a VL region and a VH region consisting a VH region as depicted in SEQ ID NO: 308 and a VL region as depicted in SEQ ID NO: 309.


Also encompassed are antibody constructs that compete for binding to CD19 with an antibody construct in accordance with the present invention that is characterized by a domain which binds to CD19 comprising a VL region and a VH region consisting a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308, or with an antibody construct having a domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


As used herein, the term “compete for binding” means, that the binding of the explicitly defined antibodies in the above paragraphs of this sub-aspect is reduced by competition by a competition antibody that binds to CD19, preferably to an epitope that is bound by any of the above explicitly defined antibodies. The binding of the explicitly defined antibodies is reduced by at least 50%, by at least 60%, by at least 70%, by at least 80%, by at least 90%, by at least 95%, or even more.


The competition antibodies may have VL and/or VH regions that differ in their amino acid sequence(s) from the explicitly described antibodies, when both, the competition antibodies and the explicitly described antibodies are co-incubated in a competition assay with target cells that express CD19, wherein both, competition antibody and explicitly defined antibody are used at equimolar concentrations in such competition assays.


The competition antibody may be labelled (the explicitly defined antibody may be unlabeled or differently labelled to permit a quantification) to distinguish the number of competition antibody bound to the target antigen at the end of the competition binding assay method.


The amount/number of competition antibody that binds under such circumstances to the target should be at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, preferably at least 95% of all antibodies selectively binding to the target antigen. The competition antibody may comprise one or more, e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or even more amino acid residues that are different from the explicitly disclosed antibodies.


In preferred aspects of the invention, the competition antibodies have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more amino acid residues that are different from the herein described antibodies characterized by a domain which binds to CD19 comprising a VL region and a VH region consisting a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308, or with an antibody construct having a domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


(i) Therefore, the combination product for the treatment of cancer, and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain (also referred to as “first domain”) which binds to CD19 on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), comprising

    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), particularly wherein the patient is not a rodent, and more particularly wherein the patient is either a human being or a non-human primate.


      (ii) The combination product for the treatment of cancer, and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy of leukemia, particularly of acute lymphoblastic leukemia (ALL), with an antibody construct comprising at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) of Sub-Aspect A-1), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), and optionally also following administration of said antibody construct, wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that has the VH chain and/or VL chain respectively, that are disclosed in WO2010052014, particularly in the sequence listing, which is hereby incorporated by reference in its entirety.


      (iii) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy of leukemia, particularly of acute lymphoblastic leukemia (ALL), with an antibody construct comprising at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) or (ii) of Sub-Aspect A-1), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that has the following VH chains and/or VL chains respectively that are disclosed in WO2010052014, particularly in the sequence listing, which is hereby incorporated by reference.


      (iv) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy of leukemia, particularly of acute lymphoblastic leukemia (ALL), with an antibody construct comprising at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (iii) of Sub-Aspect A-1), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3, wherein CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316.


      (v) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy of leukemia, particularly of acute lymphoblastic leukemia (ALL), with an antibody construct comprising at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (iv) of Sub-Aspect A-1), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to CD19 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


      (vi) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy of leukemia, particularly of acute lymphoblastic leukemia (ALL), with an antibody construct comprising at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (v) of Sub-Aspect A-1), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


      (vii) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy of leukemia, particularly of acute lymphoblastic leukemia (ALL), with an antibody construct comprising at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (vi) of Sub-Aspect A-1), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to CD19 comprises a VL region as depicted in SEQ ID NO: 309.


      (viii) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy of leukemia, particularly of acute lymphoblastic leukemia (ALL), with an antibody construct comprising at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (vii) of Sub-Aspect A-1), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to CD19 comprises a VH region as depicted in any one of SEQ ID NO: 308.


      (ix) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy of leukemia, particularly of acute lymphoblastic leukemia (ALL), with an antibody construct comprising at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (viii) of Sub-Aspect A-1), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to CD19 comprises a VL region and a VH region consisting a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308.


      (x) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy of leukemia, particularly of acute lymphoblastic leukemia (ALL), with an antibody construct comprising at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (ix) of Sub-Aspect A-1), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the first domain, which binds to CD19, competes for binding to CD19 with an antibody construct in accordance with the present invention that is characterized by a domain which binds to CD19 comprising a VL region and a VH region consisting a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308, or with an antibody construct having a domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


Sub-Aspect A-2—Constructs Binding CD33 in Combination Products of the Invention

In accordance with the present invention, antibody constructs binding to CD3 and CD33 comprise those exemplified in WO2008119567; in Example 23, and particularly in Example 36, and respective sequences in the Sequence Listing all of which are hereby incorporated by reference.


The functionality of cross-species specific bispecific antibody constructs regarding the capability to bind to human and macaque CD33 and CD3, respectively, may be determined by FACS analysis as described in WO2008119567.


CHO cells transfected with CD33, preferably human CD33 as described in Example 23.1 in WO2008119567 and the CD3, preferably human CD3, positive T cell leukemia cell line HPB-ALL (DSMZ, Braunschweig, ACC483) may be used to test the binding to human target antigens. The binding reactivity to macaque antigens may be tested by using the generated macaque CD33 transfectant as described in Example 23.2 in WO2008119567 and macaque PBMC. Flow cytometry can be performed as described in WO2008119567 to acquire and analyze the data. FACS staining and measuring of the fluorescence intensity can be performed as described in Current Protocols in Immunology (Coligan, Kruisbeek, Margulies, Shevach and Strober, Wiley-Interscience, 2002).


The bispecific binding of single chain molecules, which are cross-species specific for CD33 and cross-species specific for human and non-chimpanzee primate CD3 may be determined as in WO2008119567. Bioactivity of the generated bispecific single chain antibodies can be analyzed by chromium 51 (51Cr) release in vitro cytotoxicity assays using the CD33 positive cell lines described in Examples 36, 23.1 and 23.2 as described in WO2008119567. As shown in WO2008119567, cross-species specific bispecific single chain antibody constructs demonstrate cytotoxic activity against human CD33 positive target cells elicited by stimulated human CD4/CD56 depleted PBMC and against macaque CD33 positive target cells elicited by the macaque T cell line 4119LnPx.


Further, as used herein, the term “compete for binding” means, that the binding of the explicitly defined antibodies in the above paragraphs of this sub-aspect is reduced by competition by a competition antibody that binds to CD33, preferably to an epitope that is bound by any of the above explicitly defined antibodies. The competition antibodies may have VL and/or VH regions that differ in their amino acid sequence(s) from the explicitly described antibodies, when both, the competition antibodies and the explicitly described antibodies are co-incubated in a competition assay with target cells that express CD33, wherein both, competition antibody and explicitly defined antibody are used at equimolar concentrations in such competition assays. The competition antibody may be labelled (the explicitly defined antibody may be unlabeled or differently labelled to permit a quantification) to distinguish the number of competition antibody bound to the target antigen at the end of the competition binding assay method. The amount/number of competition antibody that binds under such circumstances to the target should be at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, preferably at least 95% of all antibodies selectively binding to the target antigen. The competition antibody may comprise one or more, e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or even more amino acid residues that are different from the explicitly disclosed antibodies. In preferred aspects of the invention, the competition antibodies have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more amino acid residues that are different from the herein described antibodies characterized by a domain which binds to CD33 comprising a VL region and a VH region as defined herein below:


It is envisaged for the antibody construct used in accordance with the present invention that the domain which selectively binds to CD33 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from: CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, and CDR-L3 as depicted in SEQ ID NO: 319; and CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319.


It is also envisaged for the antibody construct used in accordance with the present invention that the domain which selectively binds to CD33 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325.


It is envisaged for the antibody construct used in accordance with the present invention that the domain which selectively binds to CD33 comprises a VL region selected from the group of VL regions comprising those depicted in any one of SEQ ID NOs 328, 329, 330, 331, and 332.


It is also envisaged that the domain which selectively binds to CD33 comprises a VH region selected from the group consisting of a VH regions comprising those depicted in any one of SEQ ID Nos. 333, 334, 335, 336, 337, 338 and 339.


More preferably, the antibody construct used in accordance with the present invention is characterized by the domain which binds to CD33 comprising a VL region and a VH region selected from the group comprising pairs of a VL region and a VH region as depicted in SEQ ID Nos: 328+333, 328+334, 328+335, 328+336, 328+337, 328+338, 328+339, 329+333, 329+334, 329+335, 329+336, 329+337, 329+338, 329+339, 330+333, 330+334, 330+335, 330+336, 330+337, 330+338, 330+339, 331+333, 331+333, 331+334, 331+335, 331+336, 331+337, 331+338, 331+339, 332+333, 332+334, 332+335, 332+336, 332+337, 332+338, and 332+339.


It is also envisaged for the antibody construct used in accordance with the present invention that the domain, which selectively binds to an epitope of CD33, comprises CDR-L1, CDR-L2 and CDR-L3 and CDR-H1, CDR-H2 and CDR-H3 as depicted in the following groups of sequences: CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325.


It is also envisaged for the antibody construct used in accordance with the present invention that the domain which selectively binds to an epitope of CD33 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from the pairs of VL and VH regions: 328+333, 328+334, 328+335, 328+336, 328+337, 328+338, 328+339, 329+333, 329+334, 329+335, 329+336, 329+337, 329+338, 329+339, 330+333, 330+334, 330+335, 330+336, 330+337, 330+338, 330+339, 331+333, 331+333, 331+334, 331+335, 331+336, 331+337, 331+338, 331+339, 332+333, 332+334, 332+335, 332+336, 332+337, 332+338, and 332+339.


It is also envisaged for the antibody construct used in accordance with the present invention that the domain which selectively binds to an epitope of CD33 competes with those explicitly recited herein, i.e. those characterized by specific SEQ ID Nos. referred to above. Whether or not an antibody construct binds to the same epitope of CD33 as another given antibody construct can be measured e.g. by epitope mapping with chimeric or truncated target molecules, e.g. as described herein above and in the Examples in WO2017021362.


Further, whether an antibody construct competes for binding with another given antibody construct can be measured in a competition assay such as a competitive ELISA or a cell-based competition assay. Avidin-coupled microparticles (beads) can also be used. Like an avidin-coated ELISA plate, when reacted with a biotinylated protein, each of these beads can be used as a substrate on which an assay can be performed. Antigen is coated onto a bead and then precoated with the first antibody. The second antibody is added, and any additional binding is determined. Possible means for the read-out include flow cytometry.


(i) Accordingly, the combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of a leukemia, such as AML, with an antibody construct comprising at least one domain (also referred to as “first domain”) which binds to a target antigen on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv), of Aspect A) comprising

    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), and optionally also for administration following the administration of said antibody construct, wherein the first domain binds selectively to CD33.


      (ii) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of a leukemia, such as AML, with an antibody construct comprising at least one domain which binds to a CD33 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) of Sub-Aspect A-2), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), and optionally also after administration of said antibody construct, wherein said antibody construct binds to an epitope of CD33 that is selectively bound by an antibody/antibody construct that has the following CDRs of the VH chain and/or VL chain selected from the group comprising a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from: CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, and CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319; and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325.


      (iii) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of a leukemia, such as AML, with an antibody construct comprising at least one domain which binds to a CD33 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) or (ii) of Sub-Aspect A-2), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to CD33 that is selectively bound by an antibody/antibody construct that comprises the following VL chain regions selected from the group of VL chain regions as depicted in any one of SEQ ID NOs 328, 329, 330, 331, and 332.


      (iv) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of a leukemia, such as AML, with an antibody construct comprising at least one domain which binds to a CD33 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (iii) of Sub-Aspect A-2), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to CD33 that is selectively bound by an antibody/antibody construct that comprises the following VH chain regions selected from the group of VH chain regions as depicted in any one of SEQ ID Nos. 333, 334, 335, 336, 337, 338 and 339.


      (v) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of a leukemia, such as AML, with an antibody construct comprising at least one domain which binds to a CD33 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (iv) of Sub-Aspect A-2), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said domain binding to CD33 comprises a VL region and a VH region selected from the group of pairs of a VL region and a VH region comprising those depicted in SEQ ID Nos: 328+333, 328+334, 328+335, 328+336, 328+337, 328+338, 328+339, 329+333, 329+334, 329+335, 329+336, 329+337, 329+338, 329+339, 330+333, 330+334, 330+335, 330+336, 330+337, 330+338, 330+339, 331+333, 331+333, 331+334, 331+335, 331+336, 331+337, 331+338, 331+339, 332+333, 332+334, 332+335, 332+336, 332+337, 332+338, and 332+339.


      (vi) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of a leukemia, such as AML, with an antibody construct comprising at least one domain which binds to a CD33 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (v) of Sub-Aspect A-2), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said domain binding to CD33 comprises CDR-L1, CDR-L2 and CDR-L3 and CDR-H1, CDR-H2 and CDR-H3 as depicted in the following groups of sequences: CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-1-12 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325.


      (vii) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of a leukemia, such as AML, with an antibody construct comprising at least one domain which binds to a CD33 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (vi) of Sub-Aspect A-2), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said domain binding to CD33 comprises a VL region comprises CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 comprised by those of the pairs of SEQ ID NOs: 328+333, 328+334, 328+335, 328+336, 328+337, 328+338, 328+339, 329+333, 329+334, 329+335, 329+336, 329+337, 329+338, 329+339, 330+333, 330+334, 330+335, 330+336, 330+337, 330+338, 330+339, 331+333, 331+333, 331+334, 331+335, 331+336, 331+337, 331+338, 331+339, 332+333, 332+334, 332+335, 332+336, 332+337, 332+338, and 332+339.


      (viii) The combination product for the treatment and optionally also/preferably for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of a leukemia, such as AML, with an antibody construct comprising at least one domain which binds to a CD33 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (vii) of Sub-Aspect A-2), comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the first domain which binds to CD33 competes for binding to CD33 with an antibody construct as defined in any one of embodiments (i) to (vii) of Sub-Aspect A-2).


Sub-Aspect A-3—Constructs Binding FLT3 in Combination Products of the Invention

In accordance with the present invention, antibody constructs binding to CD3 and FLT3 comprise those exemplified in WO2017021362, the contents of which are hereby incorporated by reference.


Fms-like tyrosine kinase 3 (FLT3) also known as fetal liver kinase 2 (FLK-2), human stem cell kinase 1 (SCK-1) or Cluster of Differentiation antigen (CD135) is a hematopoietic receptor tyrosine kinase that was cloned by two independent groups in the 1990s. The FLT3 gene, located on chromosome 13q12 in humans encodes a Class III receptor tyrosine kinase protein that shares homology with other Class III family members including stem cell factor receptor (c-KIT), macrophage colony-stimulating factor receptor (FMS) and platelet-derived growth factor receptor (PDGFR). Human FLT3 is expressed in CD34+CD38-hematopoietic stem cells (HSC) as well as in a subset of dendritic precursor cells. The most common FLT3 mutation in Acute Myeloid Leukemia (AML) is the FLT3 internal tandem duplication (FLT3-ITD) that is found in 20 to 38% of patients with cytogenetically normal AML. FLT3-ITDs are formed when a portion of the juxtamembrane domain coding sequence gets duplicated and inserted in a head to tail orientation. FLT3 mutations have not been identified in patients with chronic lymphoid leukemia (CLL), non-Hodgkin's lymphoma and multiple myeloma suggesting strong disease specificity for AML. Mutant FLT3 activation is generally observed across all FAB subtypes, however, it is significantly increased in AML patients with FAB M5 (monocytic leukemia), while FAB subtypes M2 and M6 (granulocytic or erythroid leukemia) are significantly less frequently associated with FLT3 activation, in line with normal expression patterns of FLT3. A small percentage of AML patients (5-7%) present with single amino acid mutations in the FLT3 tyrosine kinase domain (FLT3 TKD), most commonly at D835 or in some cases at T842 or 1836 while even fewer patients (˜1%) harbor mutations in the FLT3 juxtamembrane domain involving residues 579, 590, 591 and 594. Patients with FLT3-ITD mutant AML have an aggressive form of disease characterized by early relapse and poor survival, while overall survival and event-free survival are not significantly influenced by presence of FLT3-TKD mutations. Furthermore, AML patients with FLT3-ITD mutation with concurrent TET2 or DNMT3A mutations have an unfavorable overall risk profile compared to FLT3-ITD mutant AML patients with wild-type TET2 or DNMT3A underscoring the clinical and biological heterogeneity of AML. The selective FLT3-targeting antibody domains disclosed in WO2017021362 are also subject matter of the present invention.


Accordingly, antibody constructs used in combination products, kits, or used in methods according to the present invention comprise a first binding domain which binds to human FLT3 on the surface of a target cell and a second binding domain which binds to CD3, preferably human CD3, on the surface of a T cell, wherein the first binding domain binds to an epitope of FLT3 which is comprised within the region of the human FLT3 having a sequence as depicted in SEQ ID NO: 814 (cluster 1) or SEQ ID NO: 816 (cluster 3) that are disclosed in WO2017021362.


Therefore, the first binding domain of the antibody constructs in combination according to this aspect of the present invention comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from the group comprising: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


Further, the first binding domain of the antibody constructs in combination products, kits, or used in methods according to the present invention which binds to human FLT3 on the surface of a target cell binds to the same epitope of FLT3 as an antibody selected from the group consisting of FL-1 to FL-65 disclosed in WO2017021362, i.e., constructs comprising a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from the group comprising: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


It is envisaged for the antibody construct in combination products and in kits of the invention, which may be used in methods or is generally used in accordance with the present invention binds to FLT3, and/or binds to the same epitope and/or competes with and antibody construct that comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from those depicted in: SEQ ID NOs: 344-346, SEQ ID NOs: 354-356, SEQ ID NOs: 364-366, SEQ ID NOs: 374-376, SEQ ID NOs: 384-386, SEQ ID NOs: 394-396, SEQ ID NOs: 404-406, SEQ ID NOs: 414-416, SEQ ID NOs: 424-426, SEQ ID NOs: 434-436, SEQ ID NOs: 444-446, SEQ ID NOs: 454-456, SEQ ID NOs: 464-466, SEQ ID NOs: 474-476, SEQ ID NOs: 484-486, SEQ ID NOs: 494-496, SEQ ID NOs: 504-506, SEQ ID NOs: 514-516, SEQ ID NOs: 524-526, SEQ ID NOs: 534-536, SEQ ID NOs: 544-546, SEQ ID NOs: 554-556, SEQ ID NOs: 564-566, SEQ ID NOs: 574-576, SEQ ID NOs: 584-586, SEQ ID NOs: 594-596, SEQ ID NOs: 604-606, SEQ ID NOs: 614-616, SEQ ID NOs: 624-626, SEQ ID NOs: 634-636, SEQ ID NOs: 644-646, SEQ ID NOs: 654-656, SEQ ID NOs: 664-666, SEQ ID NOs: 674-676, SEQ ID NOs: 684-686, SEQ ID NOs: 694-696, SEQ ID NOs: 704-706, SEQ ID NOs: 714-716, SEQ ID NOs: 724-726, SEQ ID NOs: 734-736, SEQ ID NOs: 744-746, SEQ ID NOs: 754-756, SEQ ID NOs: 764-766, SEQ ID NOs: 774-776, SEQ ID NOs: 784-786, SEQ ID NOs: 794-796, SEQ ID NOs: 804-806, SEQ ID NOs: 814-816, SEQ ID NOs: 824-826, SEQ ID NOs: 834-836, SEQ ID NOs: 844-846, SEQ ID NOs: 854-856, SEQ ID NOs: 864-866, SEQ ID NOs: 874-876, SEQ ID NOs: 884-886, SEQ ID NOs: 894-896, SEQ ID NOs: 904-906, SEQ ID NOs: 914-916, SEQ ID NOs: 924-926, SEQ ID NOs: 934-936, SEQ ID NOs: 944-946, SEQ ID NOs: 954-956, SEQ ID NOs: 964-966, SEQ ID NOs: 974-976, SEQ ID NOs: 984-986, particularly SEQ ID Nos: 564-566, SEQ ID Nos: 754-756, SEQ ID NOs: 724-726, and preferably SEQ ID NOs: 724-726.


It is further envisaged for the antibody construct which may be used in methods or is generally used in accordance with this aspect of the present invention that it binds to FLT3 and/or binds to an epitope recognized and/or competes with an antibody construct that comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from those depicted in SEQ ID NOs: 341-343, as depicted in SEQ ID NOs: 351-353, SEQ ID NOs: 361-363, SEQ ID NOs: 371-373, SEQ ID NOs: 381-383, SEQ ID NOs: 391-393, SEQ ID NOs: 401-403, SEQ ID NOs: 411-413, SEQ ID NOs: 421-423, SEQ ID NOs: 431-433, SEQ ID NOs: 441-443, SEQ ID NOs: 451-453, SEQ ID NOs: 461-463, SEQ ID NOs: 471-473, SEQ ID NOs: 481-483, SEQ ID NOs: 491-493, SEQ ID NOs: 501-503, SEQ ID NOs: 511-513, SEQ ID NOs: 521-523, SEQ ID NOs: 53-533, SEQ ID NOs: 541-543, SEQ ID NOs: 551-553, SEQ ID NOs: 561-563, SEQ ID NOs: 571-573, SEQ ID NOs: 581-583, SEQ ID NOs: 591-593, SEQ ID NOs: 601-603, SEQ ID NOs: 611-613, SEQ ID NOs: 621-623, SEQ ID NOs: 631-633, SEQ ID NOs: 641-643, SEQ ID NOs: 651-653, SEQ ID NOs: 661-663, SEQ ID NOs: 671-673, SEQ ID NOs: 681-683, SEQ ID NOs: 691-693, SEQ ID NOs: 701-703, SEQ ID NOs: 711-713, SEQ ID NOs: 721-723, SEQ ID NOs: 731-733, SEQ ID NOs: 741-743, SEQ ID NOs: 751-753, SEQ ID NOs: 761-763, SEQ ID NOs: 771-773, SEQ ID NOs: 781-783, SEQ ID NOs: 791-793, SEQ ID NOs: 801-803, SEQ ID NOs: 811-813, SEQ ID NOs: 821-823, SEQ ID NOs: 831-833, SEQ ID NOs: 841-843, SEQ ID NOs: 851-853, SEQ ID NOs: 861-863, SEQ ID NOs: 871-873, SEQ ID NOs: 881-883, SEQ ID NOs: 891-896, SEQ ID NOs: 901-903, SEQ ID NOs: 911-913, SEQ ID NOs: 921-923, SEQ ID NOs: 931-933, SEQ ID NOs: 941-943, SEQ ID NOs: 951-953, SEQ ID NOs: 961-963, SEQ ID NOs: 971-973, SEQ ID NOs: 981-983, particularly SEQ ID Nos: 561-563, SEQ ID Nos: 751-753, SEQ ID NOs: 721-723, and preferably SEQ ID NOs: 721-723.


It is furthermore envisaged for the antibody construct in combination products and in kits according to this sub-aspect of the invention, which binds to FLT3 or binds to and epitope recognized by and/or competes with an antibody construct that comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from the sequences in the two preceding paragraphs, particularly from the sequences selected from the group of members comprising the following six CDR sequences: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


It is also envisaged for the antibody construct used in accordance with the present invention that the domain which selectively binds to an epitope of FLT3 that it competes with those explicitly recited herein, i.e. those characterized by specific SEQ ID Nos. Whether or not an antibody construct binds to the same epitope of FLT3 as another given antibody construct can be measured e.g. by epitope mapping with chimeric or truncated target molecules, e.g. as described herein above and in the Examples in WO2017021362. Whether an antibody construct competes for binding with another given antibody construct can be measured in a competition assay such as a competitive ELISA or a cell-based competition assay. Avidin-coupled microparticles (beads) can also be used. Like an avidin-coated ELISA plate, when reacted with a biotinylated protein, each of these beads can be used as a substrate on which an assay can be performed. Antigen is coated onto a bead and then precoated with the first antibody. The second antibody is added, and any additional binding is determined. Possible means for the read-out includes flow cytometry.


A preferred antibody construct according to the invention can also be defined as a bispecific antibody construct comprising a first binding domain which binds to human FLT3 on the surface of a target cell and a second binding domain which binds to CD3, preferably human CD3, wherein the first binding domain competes for binding with an antibody selected from the group consisting of FL-1 to FL-65 as disclosed in WO2017021362, i.e., an antibody comprising a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from the group consisting of those described above.


Accordingly, the antibody construct in combination products and in kits of the invention, which may be used in accordance with the present invention comprises a domain that binds to FLT3 comprising a VL region selected from the group comprising any one of those depicted in SEQ ID NO: 348, SEQ ID NO: 358, SEQ ID NO: 368, SEQ ID NO: 378, SEQ ID NO: 388, SEQ ID NO: 398, SEQ ID NO: 407+408, SEQ ID NO: 418, SEQ ID NO: 428, SEQ ID NO: 438, SEQ ID NO: 448, SEQ ID NO: 458, SEQ ID NO: 468, SEQ ID NO: 478, SEQ ID NO: 488, SEQ ID NO: 498, SEQ ID NO: 508, SEQ ID NO: 518, SEQ ID NO: 528, SEQ ID NO: 538, SEQ ID NO: 548, SEQ ID NO: 558, SEQ ID NO: 568, SEQ ID NO: 578, SEQ ID NO: 588, SEQ ID NO: 598, SEQ ID NO: 608, SEQ ID NO: 618, SEQ ID NO: 628, SEQ ID NO: 638, SEQ ID NO: 648, SEQ ID NO: 658, SEQ ID NO: 668, SEQ ID NO: 678, SEQ ID NO: 688, SEQ ID NO: 698, SEQ ID NO: 708, SEQ ID NO: 718, SEQ ID NO: 728, SEQ ID NO: 738, SEQ ID NO: 748, SEQ ID NO: 758, SEQ ID NO: 768, SEQ ID NO: 778, SEQ ID NO: 788, SEQ ID NO: 798, SEQ ID NO: 808, SEQ ID NO: 818, SEQ ID NO: 828, SEQ ID NO: 838, SEQ ID NO: 848, SEQ ID NO: 858, SEQ ID NO: 868, SEQ ID NO: 878, SEQ ID NO: 888, SEQ ID NO: 898, SEQ ID NO: 908, SEQ ID NO: 918, SEQ ID NO: 928, SEQ ID NO: 938, SEQ ID NO: 948, SEQ ID NO: 958, SEQ ID NO: 968, SEQ ID NO: 978, particularly SEQ ID Nos: 728, 568, 758, preferably SEQ ID NO: 728.


Accordingly, the antibody construct in combination products and in kits of the invention, which may be used in in accordance with the present invention comprises a domain that binds to FLT3 comprising a VH region selected from the group of VH regions comprising those depicted in any one of SEQ ID NO: 347, SEQ ID NO: 357, SEQ ID NO: 367, SEQ ID NO: 377, SEQ ID NO: 387, SEQ ID NO: 397, SEQ ID NO: 407, SEQ ID NO: 417, SEQ ID NO: 427, SEQ ID NO: 437, SEQ ID NO: 447, SEQ ID NO: 457, SEQ ID NO: 467, SEQ ID NO: 477, SEQ ID NO: 487, SEQ ID NO: 497, SEQ ID NO: 507, SEQ ID NO: 517, SEQ ID NO: 527, SEQ ID NO: 537, SEQ ID NO: 547, SEQ ID NO: 557, SEQ ID NO: 567, SEQ ID NO: 577, SEQ ID NO: 587, SEQ ID NO: 597, SEQ ID NO: 607, SEQ ID NO: 617, SEQ ID NO: 627, SEQ ID NO: 637, SEQ ID NO: 647, SEQ ID NO: 657, SEQ ID NO: 667, SEQ ID NO: 677, SEQ ID NO: 687, SEQ ID NO: 697, SEQ ID NO: 707, SEQ ID NO: 717, SEQ ID NO: 727, SEQ ID NO: 737, SEQ ID NO: 747, SEQ ID NO: 757, SEQ ID NO: 767, SEQ ID NO: 777, SEQ ID NO: 787, SEQ ID NO: 797, SEQ ID NO: 807, SEQ ID NO: 817, SEQ ID NO: 827, SEQ ID NO: 837, SEQ ID NO: 847, SEQ ID NO: 857, SEQ ID NO: 867, SEQ ID NO: 877, SEQ ID NO: 887, SEQ ID NO: 897, SEQ ID NO: 907, SEQ ID NO: 917, SEQ ID NO: 927, SEQ ID NO: 937, SEQ ID NO: 947, SEQ ID NO: 957, SEQ ID NO: 967, SEQ ID NO: 977, particularly SEQ ID Nos: 727, 767, 757, preferably SEQ ID NO: 727.


Accordingly, the antibody construct in combination products and in kits of the invention, which may be used in accordance with the present invention comprises a domain that binds to FLT3 and comprises pairs consisting of a VH region and a VL region comprising those depicted in SEQ ID NO: 347+348, SEQ ID NO: 357+358, SEQ ID NO: 367+368, SEQ ID NO: 377+378, SEQ ID NO: 387+388, SEQ ID NO: 397+398, SEQ ID NO: 407+408, SEQ ID NO: 417+418, SEQ ID NO: 427+428, SEQ ID NO: 437+438, SEQ ID NO: 447+448, SEQ ID NO: 457+458, SEQ ID NO: 467+468, SEQ ID NO: 477+478, SEQ ID NO: 487+488, SEQ ID NO: 497+498, SEQ ID NO: 507+508, SEQ ID NO: 517+518, SEQ ID NO: 527+528, SEQ ID NO: 537+538, SEQ ID NO: 547+548, SEQ ID NO: 557+558, SEQ ID NO: 567+568, SEQ ID NO: 577+578, SEQ ID NO: 587+588, SEQ ID NO: 597+598, SEQ ID NO: 607+608, SEQ ID NO: 617+618, SEQ ID NO: 627+628, SEQ ID NO: 637+638, SEQ ID NO: 647+648, SEQ ID NO: 657+658, SEQ ID NO: 667+668, SEQ ID NO: 677+678, SEQ ID NO: 687+688, SEQ ID NO: 697+698, SEQ ID NO: 707+708, SEQ ID NO: 717+718, SEQ ID NO: 727+728, SEQ ID NO: 737+738, SEQ ID NO: 747+748, SEQ ID NO: 757+758, SEQ ID NO: 767+768, SEQ ID NO: 777+778, SEQ ID NO: 787+788, SEQ ID NO: 797+798, SEQ ID NO: 807+808, SEQ ID NO: 817+818, SEQ ID NO: 827+828, SEQ ID NO: 837+838, SEQ ID NO: 847+848, SEQ ID NO: 857+858, SEQ ID NO: 867+868, SEQ ID NO: 877+878, SEQ ID NO: 887+888, SEQ ID NO: 897+898, SEQ ID NO: 907+908, SEQ ID NO: 917+918, SEQ ID NO: 927+928, SEQ ID NO: 937+938, SEQ ID NO: 947+948, SEQ ID NO: 957+958, SEQ ID NO: 967+968, SEQ ID NO: 977+978, and SEQ ID NO: 987+988, particularly SEQ ID Nos: 727+728, 767+568, 757+758, preferably SEQ ID NO: 727+728.


Accordingly, the antibody construct in combination products and in kits of the invention, which may be used in accordance with the present invention comprises a domain binding to FLT3 comprising a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 349, SEQ ID NO: 359, SEQ ID NO: 369, SEQ ID NO: 379, SEQ ID NO: 389, SEQ ID NO: 399, SEQ ID NO: 409, SEQ ID NO: 419, SEQ ID NO: 429, SEQ ID NO: 439, SEQ ID NO: 449, SEQ ID NO: 459, SEQ ID NO: 469, SEQ ID NO: 479, SEQ ID NO: 489, SEQ ID NO: 499, SEQ ID NO: 509, SEQ ID NO: 519, SEQ ID NO: 529, SEQ ID NO: 539, SEQ ID NO: 549, SEQ ID NO: 559, SEQ ID NO: 569, SEQ ID NO: 579, SEQ ID NO: 589, SEQ ID NO: 599, SEQ ID NO: 609, SEQ ID NO: 619, SEQ ID NO: 629, SEQ ID NO: 639, SEQ ID NO: 649, SEQ ID NO: 659, SEQ ID NO: 669, SEQ ID NO: 679, SEQ ID NO: 689, SEQ ID NO: 699, SEQ ID NO: 709, SEQ ID NO: 719, SEQ ID NO: 729, SEQ ID NO: 739, SEQ ID NO: 749, SEQ ID NO: 759, SEQ ID NO: 769, SEQ ID NO: 779, SEQ ID NO: 789, SEQ ID NO: 799, SEQ ID NO: 809, SEQ ID NO: 819, SEQ ID NO: 829, SEQ ID NO: 839, SEQ ID NO: 849, SEQ ID NO: 859, SEQ ID NO: 869, SEQ ID NO: 879, SEQ ID NO: 889, SEQ ID NO: 899, SEQ ID NO: 909, SEQ ID NO: 919, SEQ ID NO: 929, SEQ ID NO: 939, SEQ ID NO: 949, SEQ ID NO: 959, SEQ ID NO: 969, SEQ ID NO: 979, and SEQ ID NO: 989, particularly SEQ ID NOS: 729, 759, 569, particularly SEQ ID NOS: 729, 759, 569, preferably SEQ ID NO: 729.


Accordingly, the antibody construct in combination products and in kits of the invention, which may be used in accordance with the present invention which binds to CD3 and FLT3 may be selected, for example, from the group comprising SEQ ID Nos: 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850, 860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980, and 990, particularly SEQ ID Nos: 570, 760, and 730, preferably SEQ ID NO: 730.


The above binding domains (which are specified by their CDRs, VH region and VL region and combinations thereof) are binding domains which bind to an epitope of FLT3 which is comprised within the region as depicted in SEQ ID NO: 991 such as disclosed in WO2017021362.


The antibody constructs binding to FLT3 as disclosed above are intended for the treatment and optionally also for use in the prevention, prophylaxis, treatment or amelioration of a hematological cancer disease or a metastatic cancer disease, particularly of AML or a metastatic cancer disease derived from AML, and are part of combination products, kits, etc., and/or may be used in or administered in steps of methods according to the present invention, i.e. together with an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling, wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) is administered to a patient in need thereof prior to and optionally also following administration of said antibody construct (a), wherein the patient is preferably a human being or a non-human primate, and wherein said inhibitor/antagonist is administered to prevent, reduce or ameliorate cytokine release syndrome (CRS) or other adverse effects that may associated with administration of CD3-binding construct sas disclosed throughout the present specification and as set out below:


(i) The combination product for the treatment of and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly of AML, with an antibody construct comprising at least one domain (also referred to as “first domain”) which binds to a target antigen on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), comprising

    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the first domain binds selectively to human FLT3 (SEQ ID NO: 989).


      (ii) The combination product for the treatment of and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly of AML, with an antibody construct comprising at least one domain which binds selectively to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) of Sub-Aspect A-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises the following CDRs of the VH chain and/or VL chain respectively, wherein the CDRs are selected from the group comprising the VH-CDR1, VH-CDR2, VH-CDR3, VL-CDR1, VL-CDR2, and VL-CDR3 regions depicted in SEQ ID Nos: SEQ ID NOs: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


      (iii) The combination product for the treatment of and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly of AML, with an antibody construct comprising at least one domain which binds selectively to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) and (ii) of Sub-Aspect A-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct comprises the following CDRs of the VH chain and/or VL chain respectively, wherein the CDRs are selected from the group comprising the VH-CDR1, VH-CDR2, VH-CDR3, VL-CDR1, VL-CDR2, and VL-CDR3 regions depicted in SEQ ID Nos: SEQ ID NOs: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


      (iv) The combination product for the treatment of and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly of AML, with an antibody construct comprising at least one domain which binds selectively to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (iv) of Sub-Aspect A-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises the following CDRs of the VH chain and/or VL chain respectively, wherein the CDRs are selected from the group comprising the VH-CDR1, VH-CDR2, VH-CDR3, VL-CDR1, VL-CDR2, and VL-CDR3 regions depicted in SEQ ID Nos: SEQ ID NOs: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


      (v) The combination product for the treatment of and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly of AML, with an antibody construct comprising at least one domain which binds selectively to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (iv) of Sub-Aspect A-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct comprises the following CDRs of the VH chain and/or VL chain respectively, wherein the CDRs are selected from the group comprising the VH-CDR1, VH-CDR2, VH-CDR3, VL-CDR1, VL-CDR2, and VL-CDR3 regions depicted in SEQ ID Nos: SEQ ID NOs: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


      (vi) The combination product for the treatment of and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly of AML, with an antibody construct comprising at least one domain which binds selectively to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (v) of Sub-Aspect A-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to FLT3 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from those as depicted in SEQ ID NOs: 344-346, SEQ ID NOs: 354-356, SEQ ID NOs: 364-366, SEQ ID NOs: 374-376, SEQ ID NOs: 384-386, SEQ ID NOs: 394-396, SEQ ID NOs: 404-406, SEQ ID NOs: 414-416, SEQ ID NOs: 424-426, SEQ ID NOs: 434-436, SEQ ID NOs: 444-446, SEQ ID NOs: 454-456, SEQ ID NOs: 464-466, SEQ ID NOs: 474-476, SEQ ID NOs: 484-486, SEQ ID NOs: 494-496, SEQ ID NOs: 504-506, SEQ ID NOs: 514-516, SEQ ID NOs: 524-526, SEQ ID NOs: 534-536, SEQ ID NOs: 544-546, SEQ ID NOs: 554-556, SEQ ID NOs: 564-566, SEQ ID NOs: 574-576, SEQ ID NOs: 584-586, SEQ ID NOs: 594-596, SEQ ID NOs: 604-606, SEQ ID NOs: 614-616, SEQ ID NOs: 624-626, SEQ ID NOs: 634-636, SEQ ID NOs: 644-646, SEQ ID NOs: 654-656, SEQ ID NOs: 664-666, SEQ ID NOs: 674-676, SEQ ID NOs: 684-686, SEQ ID NOs: 694-696, SEQ ID NOs: 704-706, SEQ ID NOs: 714-716, SEQ ID NOs: 724-726, SEQ ID NOs: 734-736, SEQ ID NOs: 744-746, SEQ ID NOs: 754-756, SEQ ID NOs: 764-766, SEQ ID NOs: 774-776, SEQ ID NOs: 784-786, SEQ ID NOs: 794-796, SEQ ID NOs: 804-806, SEQ ID NOs: 814-816, SEQ ID NOs: 824-826, SEQ ID NOs: 834-836, SEQ ID NOs: 844-846, SEQ ID NOs: 854-856, SEQ ID NOs: 864-866, SEQ ID NOs: 874-876, SEQ ID NOs: 884-886, SEQ ID NOs: 894-896, SEQ ID NOs: 904-906, SEQ ID NOs: 914-916, SEQ ID NOs: 924-926, SEQ ID NOs: 934-936, SEQ ID NOs: 944-946, SEQ ID NOs: 954-956, SEQ ID NOs: 964-966, SEQ ID NOs: 974-976, SEQ ID NOs: 984-986, preferably SEQ ID NOs: 724-726, particularly SEQ ID Nos: 564-566, SEQ ID Nos: 754-756, SEQ ID NOs: 724-726, and preferably SEQ ID NOs: 724-726.


      (vii) The combination product for the treatment of and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly of AML, with an antibody construct comprising at least one domain which binds selectively to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (vi) of Sub-Aspect A-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to FLT3 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from those depicted in SEQ ID NOs: 341-343; SEQ ID NOs: 351-353, SEQ ID NOs: 361-363, SEQ ID NOs: 371-373, SEQ ID NOs: 381-383, SEQ ID NOs: 391-393, SEQ ID NOs: 401-403, SEQ ID NOs: 411-413, SEQ ID NOs: 421-423, SEQ ID NOs: 431-433, SEQ ID NOs: 441-443, SEQ ID NOs: 451-453, SEQ ID NOs: 461-463, SEQ ID NOs: 471-473, SEQ ID NOs: 481-483, SEQ ID NOs: 491-493, SEQ ID NOs: 501-503, SEQ ID NOs: 511-513, SEQ ID NOs: 521-523, SEQ ID NOs: 531-533, SEQ ID NOs: 541-543, SEQ ID NOs: 551-553, SEQ ID NOs: 561-563, SEQ ID NOs: 571-573, SEQ ID NOs: 581-583, SEQ ID NOs: 591-593, SEQ ID NOs: 601-603, SEQ ID NOs: 611-613, SEQ ID NOs: 621-623, SEQ ID NOs: 631-633, SEQ ID NOs: 641-643, SEQ ID NOs: 651-653, SEQ ID NOs: 661-663, SEQ ID NOs: 671-673, SEQ ID NOs: 681-683, SEQ ID NOs: 691-693, SEQ ID NOs: 701-703, SEQ ID NOs: 711-713, SEQ ID NOs: 721-723, SEQ ID NOs: 731-733, SEQ ID NOs: 741-743, SEQ ID NOs: 751-753, SEQ ID NOs: 761-763, SEQ ID NOs: 771-773, SEQ ID NOs: 781-783, SEQ ID NOs: 791-793, SEQ ID NOs: 801-803, SEQ ID NOs: 811-813, SEQ ID NOs: 821-823, SEQ ID NOs: 831-833, SEQ ID NOs: 841-843, SEQ ID NOs: 851-853, SEQ ID NOs: 861-863, SEQ ID NOs: 871-873, SEQ ID NOs: 881-883, SEQ ID NOs: 891-896, SEQ ID NOs: 901-903, SEQ ID NOs: 911-913, SEQ ID NOs: 921-923, SEQ ID NOs: 931-933, SEQ ID NOs: 941-943, SEQ ID NOs: 951-953, SEQ ID NOs: 961-963, SEQ ID NOs: 971-973, SEQ ID NOs: 981-983, particularly SEQ ID Nos: 561-563, SEQ ID Nos: 751-753, SEQ ID NOs: 721-723, and preferably SEQ ID NOs: 721-723.


      (viii) The combination product for the treatment of and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly of AML, with an antibody construct comprising at least one domain which binds selectively to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (vii) of Sub-Aspect A-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to FLT3 comprises a VL region selected from the group of VL regions as depicted in any one of SEQ ID NO: 348, SEQ ID NO: 358, SEQ ID NO: 368, SEQ ID NO: 378, SEQ ID NO: 388, SEQ ID NO: 398, SEQ ID NO: 407+408, SEQ ID NO: 418, SEQ ID NO: 428, SEQ ID NO: 438, SEQ ID NO: 448, SEQ ID NO: 458, SEQ ID NO: 468, SEQ ID NO: 478, SEQ ID NO: 488, SEQ ID NO: 498, SEQ ID NO: 508, SEQ ID NO: 518, SEQ ID NO: 528, SEQ ID NO: 538, SEQ ID NO: 548, SEQ ID NO: 558, SEQ ID NO: 568, SEQ ID NO: 578, SEQ ID NO: 588, SEQ ID NO: 598, SEQ ID NO: 608, SEQ ID NO: 618, SEQ ID NO: 628, SEQ ID NO: 638, SEQ ID NO: 648, SEQ ID NO: 658, SEQ ID NO: 668, SEQ ID NO: 678, SEQ ID NO: 688, SEQ ID NO: 698, SEQ ID NO: 708, SEQ ID NO: 718, SEQ ID NO: 728, SEQ ID NO: 738, SEQ ID NO: 748, SEQ ID NO: 758, SEQ ID NO: 768, SEQ ID NO: 778, SEQ ID NO: 788, SEQ ID NO: 798, SEQ ID NO: 808, SEQ ID NO: 818, SEQ ID NO: 828, SEQ ID NO: 838, SEQ ID NO: 848, SEQ ID NO: 858, SEQ ID NO: 868, SEQ ID NO: 878, SEQ ID NO: 888, SEQ ID NO: 898, SEQ ID NO: 908, SEQ ID NO: 918, SEQ ID NO: 928, SEQ ID NO: 938, SEQ ID NO: 948, SEQ ID NO: 958, SEQ ID NO: 968, SEQ ID NO: 978, preferably SEQ ID NO: 728, particularly SEQ ID Nos: 728, 568, 758, preferably SEQ ID NO: 728.


      (ix) The combination product for the treatment of and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly of AML, with an antibody construct comprising at least one domain which binds selectively to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (viii) of Sub-Aspect A-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to FLT3 comprises a VH region selected from the group consisting of a VH region as depicted in any one of SEQ ID NO: 347, SEQ ID NO: 357, SEQ ID NO: 367, SEQ ID NO: 377, SEQ ID NO: 387, SEQ ID NO: 397, SEQ ID NO: 407, SEQ ID NO: 417, SEQ ID NO: 427, SEQ ID NO: 437, SEQ ID NO: 447, SEQ ID NO: 457, SEQ ID NO: 467, SEQ ID NO: 477, SEQ ID NO: 487, SEQ ID NO: 497, SEQ ID NO: 507, SEQ ID NO: 517, SEQ ID NO: 527, SEQ ID NO: 537, SEQ ID NO: 547, SEQ ID NO: 557, SEQ ID NO: 567, SEQ ID NO: 577, SEQ ID NO: 587, SEQ ID NO: 597, SEQ ID NO: 607, SEQ ID NO: 617, SEQ ID NO: 627, SEQ ID NO: 637, SEQ ID NO: 647, SEQ ID NO: 657, SEQ ID NO: 667, SEQ ID NO: 677, SEQ ID NO: 687, SEQ ID NO: 697, SEQ ID NO: 707, SEQ ID NO: 717, SEQ ID NO: 727, SEQ ID NO: 737, SEQ ID NO: 747, SEQ ID NO: 757, SEQ ID NO: 767, SEQ ID NO: 777, SEQ ID NO: 787, SEQ ID NO: 797, SEQ ID NO: 807, SEQ ID NO: 817, SEQ ID NO: 827, SEQ ID NO: 837, SEQ ID NO: 847, SEQ ID NO: 857, SEQ ID NO: 867, SEQ ID NO: 877, SEQ ID NO: 887, SEQ ID NO: 897, SEQ ID NO: 907, SEQ ID NO: 917, SEQ ID NO: 927, SEQ ID NO: 937, SEQ ID NO: 947, SEQ ID NO: 957, SEQ ID NO: 967, SEQ ID NO: 977, particularly SEQ ID NO: 567, 757, and 727, preferably SEQ ID NO: 727.


      (x) The combination product for the treatment of and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly of AML, with an antibody construct comprising at least one domain which binds selectively to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (ix) of Sub-Aspect A-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to FLT3 comprises pairs of a VH region and a VL region as depicted in SEQ ID NO: 347+348, SEQ ID NO: 357+358, SEQ ID NO: 367+368, SEQ ID NO: 377+378, SEQ ID NO: 387+388, SEQ ID NO: 397+398, SEQ ID NO: 407+408, SEQ ID NO: 417+418, SEQ ID NO: 427+428, SEQ ID NO: 437+438, SEQ ID NO: 447+448, SEQ ID NO: 457+458, SEQ ID NO: 467+468, SEQ ID NO: 477+478, SEQ ID NO: 487+488, SEQ ID NO: 497+498, SEQ ID NO: 507+508, SEQ ID NO: 517+518, SEQ ID NO: 527+528, SEQ ID NO: 537+538, SEQ ID NO: 547+548, SEQ ID NO: 557+558, SEQ ID NO: 567+568, SEQ ID NO: 577+578, SEQ ID NO: 587+588, SEQ ID NO: 597+598, SEQ ID NO: 607+608, SEQ ID NO: 617+618, SEQ ID NO: 627+628, SEQ ID NO: 637+638, SEQ ID NO: 647+648, SEQ ID NO: 657+658, SEQ ID NO: 667+668, SEQ ID NO: 677+678, SEQ ID NO: 687+688, SEQ ID NO: 697+698, SEQ ID NO: 707+708, SEQ ID NO: 717+718, SEQ ID NO: 727+728, SEQ ID NO: 737+738, SEQ ID NO: 747+748, SEQ ID NO: 757+758, SEQ ID NO: 767+768, SEQ ID NO: 777+778, SEQ ID NO: 787+788, SEQ ID NO: 797+798, SEQ ID NO: 807+808, SEQ ID NO: 817+818, SEQ ID NO: 827+828, SEQ ID NO: 837+838, SEQ ID NO: 847+848, SEQ ID NO: 857+858, SEQ ID NO: 867+868, SEQ ID NO: 877+878, SEQ ID NO: 887+888, SEQ ID NO: 897+898, SEQ ID NO: 907+908, SEQ ID NO: 917+918, SEQ ID NO: 927+928, SEQ ID NO: 937+938, SEQ ID NO: 947+948, SEQ ID NO: 957+958, SEQ ID NO: 967+968, SEQ ID NO: 977+978, and SEQ ID NO: 987+988, particularly SEQ ID Nos: 727+728, 767+568, 757+758, preferably SEQ ID NO: 727+728.


      (xi) The combination product for the treatment of and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly of AML, with an antibody construct comprising at least one domain which binds selectively to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (x) of Sub-Aspect A-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to FLT3 comprises a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 349, SEQ ID NO: 359, SEQ ID NO: 369, SEQ ID NO: 379, SEQ ID NO: 389, SEQ ID NO: 399, SEQ ID NO: 409, SEQ ID NO: 419, SEQ ID NO: 429, SEQ ID NO: 439, SEQ ID NO: 449, SEQ ID NO: 459, SEQ ID NO: 469, SEQ ID NO: 479, SEQ ID NO: 489, SEQ ID NO: 499, SEQ ID NO: 509, SEQ ID NO: 519, SEQ ID NO: 529, SEQ ID NO: 539, SEQ ID NO: 549, SEQ ID NO: 559, SEQ ID NO: 569, SEQ ID NO: 579, SEQ ID NO: 589, SEQ ID NO: 599, SEQ ID NO: 609, SEQ ID NO: 619, SEQ ID NO: 629, SEQ ID NO: 639, SEQ ID NO: 649, SEQ ID NO: 659, SEQ ID NO: 669, SEQ ID NO: 679, SEQ ID NO: 689, SEQ ID NO: 699, SEQ ID NO: 709, SEQ ID NO: 719, SEQ ID NO: 729, SEQ ID NO: 739, SEQ ID NO: 749, SEQ ID NO: 759, SEQ ID NO: 769, SEQ ID NO: 779, SEQ ID NO: 789, SEQ ID NO: 799, SEQ ID NO: 809, SEQ ID NO: 819, SEQ ID NO: 829, SEQ ID NO: 839, SEQ ID NO: 849, SEQ ID NO: 859, SEQ ID NO: 869, SEQ ID NO: 879, SEQ ID NO: 889, SEQ ID NO: 899, SEQ ID NO: 909, SEQ ID NO: 919, SEQ ID NO: 929, SEQ ID NO: 939, SEQ ID NO: 949, SEQ ID NO: 959, SEQ ID NO: 969, SEQ ID NO: 979, and SEQ ID NO: 989 particularly SEQ ID NOS: 729, 759, 569, preferably SEQ ID NO: 729.


      (xii) The combination product for the treatment of and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly of AML, with an antibody construct comprising at least one domain which binds selectively to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (x) of Sub-Aspect A-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to FLT3 comprises binding to CD3 and FLT3 as used herein may be selected, for example, from the group comprising SEQ ID Nos: 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850, 860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980, and 990, preferably SEQ ID NO: 730.


Sub-Aspect A-4—Constructs Binding PSMA in Combination Products of the Invention

In accordance with the present invention, antibody constructs binding to CD3 and PSMA comprise those exemplified in WO2017134158, the contents of which are hereby incorporated by reference.


Several markers for prostate cancer have been identified, including e.g. prostate-specific antigen (PSA), the six transmembrane epithelial antigen of the prostate (STEAP) (Hubert et al., PNAS 96 (1999), 14523-14528), the prostate stem cell antigen (PSCA) (Reiter et al., Proc. Nat. Acad. Sci. 95: 1735-1740, 1998) and the prostate-specific membrane antigen (PSMA; PSM) (Israeli et al., Cancer Res. 53 (1993).


PSMA was originally defined by the monoclonal antibody (MAb) 7E11 derived from immunization with a partially purified membrane preparation from the lymph node prostatic adenocarcinoma (LNCaP) cell line (Horoszewicz et al., Anticancer Res. 7 (1987), 927-35). A 2.65-kb cDNA fragment encoding the PSMA protein was cloned and subsequently mapped to chromosome 1 1 p1 1 0.2 (Israeli et al., loc. cit; O'Keefe et al., Biochem. Biophys. Acta 1443 (1998), 1 13-127). Initial analysis of PSMA demonstrated widespread expression within the cells of the prostatic secretory epithelium. Immunohistochemical staining demonstrated that PSMA was absent to moderately expressed in hyperplastic and benign tissues, while malignant tissues stained with the greatest intensity (Horoszewicz et al., loc. cit.). Consistent with the correlation between PSMA expression and tumor stage, increased levels of PSMA are associated with androgen-independent prostate cancer (PCa). Analysis of tissue samples from patients with prostate cancer has demonstrated elevated PSMA levels after physical castration or androgen-deprivation therapy. Unlike expression of prostate specific antigen, which is downregulated after androgen ablation, PSMA expression is significantly increased in both primary and metastatic tumor specimens (Kawakami et al., Wright et al., loc. cit.). PSMA is also highly expressed in secondary prostatic tumors and occult metastatic disease. Immunohistochemical analysis has revealed relatively intense and homogeneous expression of PSMA within metastatic lesions localized to lymph nodes, bone, soft tissue, and lungs compared with benign prostatic tissues (Chang et al. (2001), loc. cit.; Murphy et al., Cancer 78 (1996), 809-818; Sweat et al., loc. cit.). PSMA is also expressed in the tumor-associated neovasculature of most solid cancers examined yet is absent in the normal vascular endothelium (Chang et al. (1999), Liu et al., Silver et al., loc. cit.). Although the significance of PSMA expression within the vasculature is unknown, the specificity for tumor-associated endothelium makes PSMA a potential target for the treatment of many forms of malignancy.


According to the present invention, the combination product for the treatment of and optionally also for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of prostate cancer and cancers originating therefrom, which comprise antibody constructs having a PSMA binding domain correspond to PSMA binders, wherein each may be a polypeptide monomer that has an amino acid sequence that is at least 90% identical to, or consists of, a sequence selected from the group consisting of: SEQ ID NO: 17-24 in the Sequence Listing in WO2017134158, which is hereby incorporated explicitly be reference. Further, the PSMA binding domain may have an amino acid sequence selected from the group consisting of SEQ ID NOs: 50, 56, 68, 74, 86, 92, 104, 1 10, 122, 128, 140, 146, 158, 164, 176, 182, 194, 200, 212, 218, 230, 236, 248, 254, 266, 272, 284, 290, 302, 308, 320, 335, 350, 365, 380, 395, 410, 425, 440, 455, 470 in the sequence listing disclosed in WO2017134158, which are also incorporated by reference.


The combination products comprising the antibody constructs according to this and related sub-aspects of the present invention are particularly suitable for the treatment of and optionally also for use in the prevention, treatment or amelioration of a proliferative disease, a tumorous disease, cancer or an immunological disorder, particularly wherein the disease is prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, and wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to administration of said antibody construct.


It is envisaged for the antibody construct used in combination products comprising the antibody constructs according to the present invention are particularly suitable for the treatment of and optionally also for use in the prevention, treatment or amelioration of a disease selected from a proliferative disease, a tumorous disease, cancer or an immunological disorder, particularly wherein the disease is prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, that the domain which binds to PSMA, preferably human PSMA, comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from: CDR-L1 as depicted in SEQ ID NO:997, CDR-L2 as depicted in SEQ ID NO: 998, and CDR-L3 as depicted in SEQ ID NO: 999; CDR-L1 as depicted in SEQ ID NO: 1012, CDR-L2 as depicted in SEQ ID NO: 1013, and CDR-L3 as depicted in SEQ ID NO: 1014; and CDR-L1 as depicted in SEQ ID NO: 1027, CDR-L2 as depicted in SEQ ID NO: 1028, and CDR-L3 as depicted in SEQ ID NO: 1029.


It is envisaged for the antibody construct used in combination products comprising the antibody constructs according to the present invention are particularly for the treatment of and optionally also for use in the prevention, treatment or amelioration of a disease selected from a proliferative disease, a tumorous disease, cancer or an immunological disorder, particularly wherein the disease is prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, that the domain which binds to PSMA, preferably human PSMA, comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-H1 as depicted in SEQ ID NO: 994, CDR-H2 as depicted in SEQ ID NO: 995, and CDR-H3 as depicted in SEQ ID NO: 996; CDR-H1 as depicted in SEQ ID NO: 1009, CDR-H2 as depicted in SEQ ID NO: 1010, and CDR-H3 as depicted in SEQ ID NO: 1011, CDR-H1 as depicted in SEQ ID NO: 1024, CDR-H2 as depicted in SEQ ID NO: 1025, and CDR-H3 as depicted in SEQ ID NO: 1026.


It is envisaged for the antibody construct used in combination products comprising the antibody constructs according to the present invention are particularly for the treatment of and optionally also for use in the prevention, treatment or amelioration of a disease selected from a proliferative disease, a tumorous disease, cancer or an immunological disorder, particularly wherein the disease is prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, that the domain which binds to PSMA, preferably human PSMA, comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:997, CDR-L2 as depicted in SEQ ID NO: 998, and CDR-L3 as depicted in SEQ ID NO: 999; CDR-L1 as depicted in SEQ ID NO: 1012, CDR-L2 as depicted in SEQ ID NO: 1013, and CDR-L3 as depicted in SEQ ID NO: 1014; and CDR-L1 as depicted in SEQ ID NO: 1027, CDR-L2 as depicted in SEQ ID NO: 1028, and CDR-L3 as depicted in SEQ ID NO: 1029, and CDR-H1 as depicted in SEQ ID NO: 994, CDR-H2 as depicted in SEQ ID NO: 995, and CDR-H3 as depicted in SEQ ID NO: 996; CDR-H1 as depicted in SEQ ID NO: 1009, CDR-H2 as depicted in SEQ ID NO: 1010, and CDR-H3 as depicted in SEQ ID NO: 1011, CDR-H1 as depicted in SEQ ID NO: 1024, CDR-H2 as depicted in SEQ ID NO: 1025, and CDR-H3 as depicted in SEQ ID NO: 1026.


It is envisaged for the antibody construct used in combination products comprising the antibody constructs according to the present invention are particularly for the treatment of and optionally also for use in the prevention, treatment or amelioration of a disease selected from a proliferative disease, a tumorous disease, cancer or an immunological disorder, particularly wherein the disease is prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, that the domain which binds to PSMA, preferably human PSMA, comprises a VL region selected from the group of VL regions as depicted in any one of SEQ ID NO: 1001, SEQ ID NO: 1016, and SEQ ID NO: 1031.


It is envisaged for the antibody construct used in combination products comprising the antibody constructs according to the present invention are particularly for the treatment of and optionally also for use in the prevention, treatment or amelioration of a disease selected from a proliferative disease, a tumorous disease, cancer or an immunological disorder, particularly wherein the disease is prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, that the domain which binds to PSMA, preferably human PSMA, comprises a VH region selected from the group consisting of a VH region as depicted in any one of SEQ ID NO: 1000, SEQ ID NO: 1015, and SEQ ID NO: 1030.


It is envisaged for the antibody construct used in combination products comprising the antibody constructs according to the present invention are particularly for the treatment of and optionally also for use in the prevention, treatment or amelioration of a disease selected from a proliferative disease, a tumorous disease, cancer or an immunological disorder, particularly wherein the disease is prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, that the domain which binds to PSMA, preferably human PSMA, comprises a VL region and a VH region selected from the group consisting of a VL region as depicted in SEQ ID NO: 1001, SEQ ID NO: 1016, or SEQ ID NO: 1031 and a VH region as depicted in SEQ ID NO: SEQ ID NO: 1000, SEQ ID NO: 1015, or SEQ ID NO: 1030.


It is also envisaged for the antibody construct used in accordance with the present invention that the domain which selectively binds to an epitope of PSMA that it competes with those explicitly recited herein, i.e. those characterized by specific SEQ ID Nos. Whether or not an antibody construct binds to the same epitope of PSMA as another given antibody construct can be measured e.g. by epitope mapping with chimeric or truncated target molecules, e.g. as described herein above and in the Examples in WO2017021362. Further, whether an antibody construct competes for binding with another given antibody construct can be measured in a competition assay such as a competitive ELISA or a cell-based competition assay. Avidin-coupled microparticles (beads) can also be used. Like an avidin-coated ELISA plate, when reacted with a biotinylated protein, each of these beads can be used as a substrate on which an assay can be performed. Antigen is coated onto a bead and then precoated with the first antibody. The second antibody is added, and any additional binding is determined. Possible means for the read-out includes flow cytometry.


The antibody constructs binding to PSMA as disclosed above are intended for use in the prevention, prophylaxis, treatment or amelioration of a cancer disease, particularly of prostate cancer or a metastatic cancer disease derived from prostate cancer, and are part of combination products, kits, etc., and/or may be used in or administered in steps of the methods according to the present invention, i.e. together with an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling, wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) is administered to a patient in need thereof prior to administration of said antibody construct (a), wherein the patient is preferably a human being or a non-human primate, and wherein said inhibitor/antagonist is administered to prevent or reduce cytokine release syndrome (CRS) or other adverse effects associated with administration of a CD3-binding construct as disclosed throughout the present invention and as set out below:


(i) The combination product for the treatment of and optionally also for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain (also referred to as “first domain”) which binds to a target antigen on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), comprising

    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain binds selectively to human PSMA (SEQ ID NO: 993) as disclosed in WO2017134158, more particularly, as disclosed in the sequence listing in WO2017134158, herein preferably those CDRs, VLs, VHs, and antibody constructs shown in SEQ ID Nos: 42 to 474, which selectively bind to PSMA epitopes.


      (ii) The combination product for the treatment of and optionally also for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) of Sub-Aspect A-4, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that has the following CDRs of the VH chain and/or VL chain respectively: CDR-L1 as depicted in SEQ ID NO:997, CDR-L2 as depicted in SEQ ID NO: 998, and CDR-L3 as depicted in SEQ ID NO: 999; CDR-L1 as depicted in SEQ ID NO: 1012, CDR-L2 as depicted in SEQ ID NO: 1013, and CDR-L3 as depicted in SEQ ID NO: 1014; CDR-L1 as depicted in SEQ ID NO: 1027, CDR-L2 as depicted in SEQ ID NO: 1028, and CDR-L3 as depicted in SEQ ID NO: 1029, and/or CDR-H1 as depicted in SEQ ID NO: 994, CDR-H2 as depicted in SEQ ID NO: 995, and CDR-H3 as depicted in SEQ ID NO: 996; CDR-H1 as depicted in SEQ ID NO: 1009, CDR-H2 as depicted in SEQ ID NO: 1010, and CDR-H3 as depicted in SEQ ID NO: 1011, CDR-H1 as depicted in SEQ ID NO: 1024, CDR-H2 as depicted in SEQ ID NO: 1025, and CDR-H3 as depicted in SEQ ID NO: 1026.


      (iii) The combination product for the treatment of and optionally also for the prevention or reduction, prophylaxis of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) and/or (ii) of Sub-Aspect A-4, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that has the following CDRs of the VH chain and/or VL chain respectively: CDR-H1 as depicted in SEQ ID NO: 994, CDR-H2 as depicted in SEQ ID NO: 995, and CDR-H3 as depicted in SEQ ID NO: 996; CDR-L1 as depicted in SEQ ID NO:997, CDR-L2 as depicted in SEQ ID NO: 998, and CDR-L3 as depicted in SEQ ID NO: 999; CDR-H1 as depicted in SEQ ID NO: 1009, CDR-H2 as depicted in SEQ ID NO: 1010, and CDR-H3 as depicted in SEQ ID NO: 1011, CDR-L1 as depicted in SEQ ID NO: 1012, CDR-L2 as depicted in SEQ ID NO: 1013, and CDR-L3 as depicted in SEQ ID NO: 1014; and CDR-H1 as depicted in SEQ ID NO: 1024, CDR-H2 as depicted in SEQ ID NO: 1025, and CDR-H3 as depicted in SEQ ID NO: 1026, CDR-L1 as depicted in SEQ ID NO: 1027, CDR-L2 as depicted in SEQ ID NO: 1028, and CDR-L3 as depicted in SEQ ID NO: 1029.


      (iv) The combination product for the treatment of and optionally also for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) of Sub-Aspect A-4, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct has the following CDRs of the VH chain and/or VL chain respectively: CDR-L1 as depicted in SEQ ID NO:997, CDR-L2 as depicted in SEQ ID NO: 998, and CDR-L3 as depicted in SEQ ID NO: 999; CDR-L1 as depicted in SEQ ID NO: 1012, CDR-L2 as depicted in SEQ ID NO: 1013, and CDR-L3 as depicted in SEQ ID NO: 1014; CDR-L1 as depicted in SEQ ID NO: 1027, CDR-L2 as depicted in SEQ ID NO: 1028, and CDR-L3 as depicted in SEQ ID NO: 1029, and/or CDR-H1 as depicted in SEQ ID NO: 994, CDR-H2 as depicted in SEQ ID NO: 995, and CDR-H3 as depicted in SEQ ID NO: 996; CDR-H1 as depicted in SEQ ID NO: 1009, CDR-H2 as depicted in SEQ ID NO: 1010, and CDR-H3 as depicted in SEQ ID NO: 1011, CDR-H1 as depicted in SEQ ID NO: 1024, CDR-H2 as depicted in SEQ ID NO: 1025, and CDR-H3 as depicted in SEQ ID NO: 1026.


      (v) The combination product for the treatment of and optionally also for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (iii) of Sub-Aspect A-4, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct has the following CDRs of the VH chain and/or VL chain respectively: CDR-H1 as depicted in SEQ ID NO: 994, CDR-H2 as depicted in SEQ ID NO: 995, and CDR-H3 as depicted in SEQ ID NO: 996; CDR-L1 as depicted in SEQ ID NO:997, CDR-L2 as depicted in SEQ ID NO: 998, and CDR-L3 as depicted in SEQ ID NO: 999; CDR-H1 as depicted in SEQ ID NO: 1009, CDR-H2 as depicted in SEQ ID NO: 1010, and CDR-H3 as depicted in SEQ ID NO: 1011, CDR-L1 as depicted in SEQ ID NO: 1012, CDR-L2 as depicted in SEQ ID NO: 1013, and CDR-L3 as depicted in SEQ ID NO: 1014; and CDR-H1 as depicted in SEQ ID NO: 1024, CDR-H2 as depicted in SEQ ID NO: 1025, and CDR-H3 as depicted in SEQ ID NO: 1026, CDR-L1 as depicted in SEQ ID NO: 1027, CDR-L2 as depicted in SEQ ID NO: 1028, and CDR-L3 as depicted in SEQ ID NO: 1029.


      (vi) The combination product for the treatment of and optionally also for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (iv) of Sub-Aspect A-4, comprising a VL region selected from the group of VL regions as depicted in any one of SEQ ID NO: 1001, SEQ ID NO: 1016, and SEQ ID NO: 1031.


      (vii) The combination product for the treatment of and optionally also for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (v) of Sub-Aspect A-4, comprising a VH region selected from the group consisting of a VH region as depicted in any one of SEQ ID NO: 1000, SEQ ID NO: 1015, and SEQ ID NO: 1030.


      (viii) The combination product for the treatment of and optionally also for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (vii) of Sub-Aspect A-4, comprising a VL region that binds to an epitope that is that is selectively bound by an antibody/antibody construct comprising a VL region selected from the group comprising VL regions as depicted in any one of SEQ ID NO: 1001, SEQ ID NO: 1016, and SEQ ID NO: 1031.


      (ix) The combination product for the treatment of and optionally also for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (vii) of Sub-Aspect A-4, comprising a VH region that binds to an epitope that is that is selectively bound by an antibody/antibody construct comprising a VH region selected from the group comprising a VH region as depicted in any one of SEQ ID NO: 1000, SEQ ID NO: 1015, and SEQ ID NO: 1030.


      (x) The combination product for the treatment of and optionally also for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (x) of Sub-Aspect A-4, comprising a VL region and a VH region selected from the group consisting of a VL region as depicted in SEQ ID NO: 1001, SEQ ID NO: 1016, or SEQ ID NO: 1031 and a VH region as depicted in SEQ ID NO: SEQ ID NO: 1000, SEQ ID NO: 1015, or SEQ ID NO: 1030.


      (xi) The combination product for the treatment of and optionally also for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (x) of Sub-Aspect A-4, comprising a pair of a VL region and a VH region that binds to an epitope to an epitope that is that is selectively bound by an antibody/antibody construct that is selected from the group consisting of a pair of a VL region as depicted in SEQ ID NO: 1001, SEQ ID NO: 1016, or SEQ ID NO: 1031 and a VH region as depicted in SEQ ID NO: SEQ ID NO: 1000, SEQ ID NO: 1015, or SEQ ID NO: 1030.


      (xii) The combination product for the treatment of and optionally also for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (x) of Sub-Aspect A-4,


      (xiii) The combination product for the treatment of and optionally also for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (xi) of Sub-Aspect A-4, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to PSMA comprises a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1002, SEQ ID NO: 1017, and SEQ ID NO: 1032, and/or binds to an epitope selectively bound by a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1002, SEQ ID NO: 1017, and SEQ ID NO: 1032.


      (xiv) The combination product for the treatment of and optionally also for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) to (x) of Sub-Aspect A-4, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to PSMA is comprised by a polypeptide selected from the group comprising antibody constructs depicted in SEQ ID Nos: 1003, 1004, 1005, 1006, 1007, 1008, 1018, 1019, 1020, 1021, 1022, 1023, 1033, 1034, 1035, 1036, 1037, and 1038, and/or binds to an epitope selectively bound by a polypeptide selected from the group comprising antibody constructs depicted in SEQ ID NOs: 1003, 1004, 1005, 1006, 1007, 1008, 1018, 1019, 1020, 1021, 1022, 1023, 1033, 1034, 1035, 1036, 1037, and 1038.


Sub-Aspect A-5—Constructs Binding DLL3 in Combination Products of the Invention

In accordance with the present invention, antibody constructs binding to CD3 and DLL3 comprise those exemplified in WO2017021349, the contents of which are hereby incorporated by reference.


As used herein, the DLL3 binding antibody constructs are exemplified by the selective DLL3-binding sequences disclosed explicitly in WO2017021349 and in WO2019200007, both of which are hereby incorporated by reference in their entireties. The protein sequences of different isotypes of DLL3 are shown in SEQ ID Nos: 29 and 30 of WO2017021349, respectively. The DLL3 targeting domains comprise the CDR sequences explicitly disclosed in SEQ ID Nos: 42-69.


The cancer immunotherapy, wherein DLL3 is targeted and for which combination products, kits, uses and methods are envisioned in accordance with the present invention are immunotherapies, wherein the cancer is adrenal, liver, kidney, bladder, breast, gastric, ovarian, cervical, uterine, esophageal, colorectal, prostate (e.g., prostate adenocarcinoma), pancreatic, lung (both small cell and non-small cell), thyroid, carcinomas, sarcomas, glioblastomas, head and neck tumors, large cell neuroendocrine carcinoma (LCNEC), medullary thyroid cancer, glioblastoma, neuroendocrine prostate cancer, (NEPC), high-grade gastroenteropancreatic cancer (GEP) and malignant melanoma, preferably, wherein the cancer is small cell lung cancer.


It is also envisaged for the antibody construct used in accordance with the present invention that the domain which selectively binds to an epitope of DLL3 that it competes with those explicitly recited herein below, i.e. those characterized by specific SEQ ID Nos. Whether or not an antibody construct binds to the same epitope of DLL3 as another given antibody construct can be measured e.g. by epitope mapping with chimeric or truncated target molecules, e.g. as described herein above and in the Examples in WO2017021362. Further, whether an antibody construct competes for binding with another given antibody construct can be measured in a competition assay such as a competitive ELISA or a cell-based competition assay. Avidin-coupled microparticles (beads) can also be used. Like an avidin-coated ELISA plate, when reacted with a biotinylated protein, each of these beads can be used as a substrate on which an assay can be performed. Antigen is coated onto a bead and then precoated with the first antibody. The second antibody is added, and any additional binding is determined. Possible means for the read-out includes flow cytometry.


Further, antibody constructs comprising a binding domain which binds to human DLL3 on the surface of a target cell and a second binding domain which binds to CD3, preferably human CD3, on the surface of a T cell and at least macaque CD3 correspond to those, wherein the first binding domain binds to an epitope of DLL3 which is comprised within the region as depicted in SEQ ID NO: 260 as disclosed in WO2017021349.


The antibody constructs may have a binding domain that binds to an epitope of DLL3 which is comprised within the region as depicted in SEQ ID NO: 258 as disclosed in WO2017021349. The antibody constructs may have a binding domain that comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3 disclosed in the sequence listing in WO2017021349, which are selected from the group consisting of: CDR-H1 as depicted in SEQ ID NO: 1040, CDR-H2 as depicted in SEQ ID NO: 1041, CDR-H3 as depicted in SEQ ID NO: 1042, CDR-L1 as depicted in SEQ ID NO: 1043, CDR-L2 as depicted in SEQ ID NO: 1044 and CDR-L3 as depicted in SEQ ID NO: 1045; CDR-H1 as depicted in SEQ ID NO: 1046, CDR-H2 as depicted in SEQ ID NO: 1047, CDR-H3 as depicted in SEQ ID NO: 1048, CDR-L1 as depicted in SEQ ID NO: 1049, CDR-L2 as depicted in SEQ ID NO: 1050 and CDR-L3 as depicted in SEQ ID NO: 1051; CDR-H1 as depicted in SEQ ID NO: 1052, CDR-H2 as depicted in SEQ ID NO: 1053, CDR-H3 as depicted in SEQ ID NO: 1054, CDR-L1 as depicted in SEQ ID NO: 1055, CDR-L2 as depicted in SEQ ID NO: 1056 and CDR-L3 as depicted in SEQ ID NO: 1057; CDR-H1 as depicted in SEQ ID NO: 1058, CDR-H2 as depicted in SEQ ID NO: 1059, CDR-H3 as depicted in SEQ ID NO: 1060, CDR-L1 as depicted in SEQ ID NO: 1061, CDR-L2 as depicted in SEQ ID NO: 1062 and CDR-L3 as depicted in SEQ ID NO: 1063; CDR-H1 as depicted in SEQ ID NO: 1064, CDR-H2 as depicted in SEQ ID NO: 1065, CDR-H3 as depicted in SEQ ID NO: 1066, CDR-L1 as depicted in SEQ ID NO: 1067, CDR-L2 as depicted in SEQ ID NO: 1068 and CDR-L3 as depicted in SEQ ID NO: 1069; CDR-H1 as depicted in SEQ ID NO: 1070, CDR-H2 as depicted in SEQ ID NO: 1071, CDR-H3 as depicted in SEQ ID NO: 1072, CDR-L1 as depicted in SEQ ID NO: 1073, CDR-L2 as depicted in SEQ ID NO: 1074 and CDR-L3 as depicted in SEQ ID NO: 1075; CDR-H1 as depicted in SEQ ID NO: 1076, CDR-H2 as depicted in SEQ ID NO: 1077, CDR-H3 as depicted in SEQ ID NO: 1078, CDR-L1 as depicted in SEQ ID NO: 1079, CDR-L2 as depicted in SEQ ID NO: 1080 and CDR-L3 as depicted in SEQ ID NO: 1081; CDR-H1 as depicted in SEQ ID NO: 1082, CDR-H2 as depicted in SEQ ID NO: 1083, CDR-H3 as depicted in SEQ ID NO: 1084, CDR-L1 as depicted in SEQ ID NO: 1085, CDR-L2 as depicted in SEQ ID NO: 1086 and CDR-L3 as depicted in SEQ ID NO: 1087; and CDR-H1 as depicted in SEQ ID NO: 1088, CDR-H2 as depicted in SEQ ID NO: 1089, CDR-H3 as depicted in SEQ ID NO: 1090, CDR-L1 as depicted in SEQ ID NO: 1091, CDR-L2 as depicted in SEQ ID NO: 1092 and CDR-L3 as depicted in SEQ ID NO: 1093.


The antibody construct according to claim 5 or 6, wherein the first binding domain comprises a VH region selected from the group consisting of those depicted in SEQ ID NO: 1094, SEQ ID NO: 1095, SEQ ID NO: 1096, SEQ ID NO: 1097, SEQ ID NO: 1098, SEQ ID NO: 1099, SEQ ID NO: 1100, SEQ ID NO: 1101, SEQ ID NO: 1102, SEQ ID NO: 1103 and SEQ ID NO: 1104.


The antibody constructs may have a binding domain that comprises a VL region selected from the group consisting of those depicted in SEQ ID NO: 1105, SEQ ID NO: 1106, SEQ ID NO: 1107, SEQ ID NO: 1108, SEQ ID NO: 1109, SEQ ID NO: 1110, SEQ ID NO: 1111, SEQ ID NO: 1112, SEQ ID NO: 1113, SEQ ID NO: 1114 and SEQ ID NO: 1115.


The antibody constructs may have a binding domain that comprises a VH region and a VL region selected from the group consisting of pairs of a VH region and a VL region as depicted in SEQ ID NOs: 1094+1105; SEQ ID NOs: 1095+1106; SEQ ID NOs: 1096+1107; SEQ ID NOs: 1097+1108; SEQ ID NOs: 1098+1109; SEQ ID NOs: 1099+1110; SEQ ID NOs: 1100+1111; SEQ ID NOs: 1101+1112; SEQ ID NOs: 1102+1113; SEQ ID NOs: 1103+1114; and SEQ ID NOs: 1104+1115.


The antibody constructs may have a binding domain that comprises a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1116, SEQ ID NO: 1117, SEQ ID NO: 1118, SEQ ID NO: 1119, SEQ ID NO: 1120, SEQ ID NO: 1121, SEQ ID NO: 1122, SEQ ID NO: 1123, SEQ ID NO: 1124, SEQ ID NO: 1125 and SEQ ID NO: 1126.


The antibody constructs may have a binding domain that comprises a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1127, SEQ ID NO: 1128, SEQ ID NO: 1129, SEQ ID NO: 1130, SEQ ID NO: 1131, SEQ ID NO: 1132, SEQ ID NO: 1133, SEQ ID NO: 1134, SEQ ID NO: 1135, SEQ ID NO: 1136, SEQ ID NO: 1137, SEQ ID NO: 1139, SEQ ID NO: 1140, SEQ ID NO: 1141, SEQ ID NO: 1142, SEQ ID NO: 1143, SEQ ID NO: 1144 and SEQ ID NO: 1145.


The antibody constructs may have a binding domain that binds to an epitope of DLL3 which is comprised within the region as depicted in SEQ ID NO: 1146.


The antibody constructs may have a binding domain that comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from the group consisting of: CDR-H1 as depicted in SEQ ID NO: 1147, CDR-H2 as depicted in SEQ ID NO: 1148, CDR-H3 as depicted in SEQ ID NO: 1149, CDR-L1 as depicted in SEQ ID NO: 1150, CDR-L2 as depicted in SEQ ID NO: 1151 and CDR-L3 as depicted in SEQ ID NO: 1152; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1154, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1156, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; CDR-H1 as depicted in SEQ ID NO: 1159, CDR-H2 as depicted in SEQ ID NO: 1160, CDR-H3 as depicted in SEQ ID NO: 1161, CDR-L1 as depicted in SEQ ID NO: 1162, CDR-L2 as depicted in SEQ ID NO: 1163 and CDR-L3 as depicted in SEQ ID NO: 1164; CDR-H1 as depicted in SEQ ID NO: 1165, CDR-H2 as depicted in SEQ ID NO: 1166, CDR-H3 as depicted in SEQ ID NO: 1167, CDR-L1 as depicted in SEQ ID NO: 1168, CDR-L2 as depicted in SEQ ID NO: 1169 and CDR-L3 as depicted in SEQ ID NO: 1170; CDR-H1 as depicted in SEQ ID NO: 1171, CDR-H2 as depicted in SEQ ID NO: 1172, CDR-H3 as depicted in SEQ ID NO: 1173, CDR-L1 as depicted in SEQ ID NO: 1174, CDR-L2 as depicted in SEQ ID NO: 1175 and CDR-L3 as depicted in SEQ ID NO: 1176; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1177, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1156, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1178, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1156, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1154, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1179, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1154, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1180, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1154, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1181, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1154, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1182, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1177, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1179, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; and CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1178, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1180, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158.


The antibody constructs may have a binding domain that comprises a VH region selected from the group consisting of those depicted in SEQ ID NO: 1183, SEQ ID NO: 1184, SEQ ID NO: 1185, SEQ ID NO: 1186, SEQ ID NO: 1187, SEQ ID NO: 1188, SEQ ID NO: 1189, SEQ ID NO: 1190, SEQ ID NO: 1191, SEQ ID NO: 1192, SEQ ID NO: 1193, SEQ ID NO: 1194, SEQ ID NO: 1195, SEQ ID NO: 1196, SEQ ID NO: 1197, and SEQ ID NO: 1198.


The antibody constructs may have a binding domain that comprises a VL region selected from the group consisting of those depicted in SEQ ID NO: 1199128, SEQ ID NO: 1200138, SEQ ID NO: 1201148, SEQ ID NO: 1202, SEQ ID NO: 1203, SEQ ID NO: 1204, SEQ ID NO: 1205, SEQ ID NO: 1206, SEQ ID NO: 1207, SEQ ID NO: 1208, SEQ ID NO: 1209, SEQ ID NO: 1210, SEQ ID NO: 1211, SEQ ID NO: 1212, SEQ ID NO: 1213, SEQ ID NO: 1214, SEQ ID NO: 1215, SEQ ID NO: 1216, SEQ ID NO: 1217, and SEQ ID NO: 1218.


The antibody constructs may have a binding domain that comprises a VH region and a VL region selected from the group consisting of pairs of a VH region and a VL region as depicted in SEQ ID NOs: 1183+1199; SEQ ID NOs: 1184+1200; SEQ ID NOs: 1185+1201; SEQ ID NOs: 1186+1202; SEQ ID NOs: 1187+1203; SEQ ID NOs 1184+1204; SEQ ID NOs 1184+1205; SEQ ID NOs 1184+12168; SEQ ID NOs 1184+1207; SEQ ID NOs 1184+1208; SEQ ID NOs 1188+1200; SEQ ID NOs 1189+1200; SEQ ID NOs 1190+1200; SEQ ID NOs 1188+1208; SEQ ID NOs 1191+1209; 1192+1210; SEQ ID NOs 1192+1210; SEQ ID NOs 1193+1211; SEQ ID NOs 1193+1212; SEQ ID NOs 1193+1213; SEQ ID NOs 1193+1214; SEQ ID NOs 1193+1215; SEQ ID NOs 1193+1216; SEQ ID NOs 1194+1211; SEQ ID NOs 1195+1211; SEQ ID NOs 1196+1211; SEQ ID NOs 1194+1216; SEQ ID NOs 1197+1217; and SEQ ID NOs 1198+1218.


The antibody constructs may have a binding domain that comprises a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1219, SEQ ID NO: 1220, SEQ ID NO: 1221, SEQ ID NO: 1222, SEQ ID NO: 1223, SEQ ID NO: 1224, SEQ ID NO: 1225, SEQ ID NO: 1226, SEQ ID NO: 1227, SEQ ID NO: 1228, SEQ ID NO: 1229476, SEQ ID NO: 1230, SEQ ID NO: 1231, SEQ ID NO: 1232, SEQ ID NO: 1233, SEQ ID NO: 1234, SEQ ID NO: 1235, SEQ ID NO: 1236, SEQ ID NO: 1237, SEQ ID NO: 1238, SEQ ID NO: 1239, SEQ ID NO: 1240, SEQ ID NO: 1241, SEQ ID NO: 1242, SEQ ID NO: 1243, SEQ ID NO: 1244, SEQ ID NO: 1245, and SEQ ID NO: 1246.


The antibody constructs may have a binding domain that comprising a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1247, SEQ ID NO: 1248, SEQ ID NO: 1249, SEQ ID NO: 1250, SEQ ID NO: 1251; SEQ ID NO: 1252, SEQ ID NO: 1253, SEQ ID NO: 1254, SEQ ID NO: 1255, SEQ ID NO: 1256, SEQ ID NO: 1257, SEQ ID NO: 1258, SEQ ID NO: 1259, SEQ ID NO: 1260, SEQ ID NO: 1261, SEQ ID NO: 1262, SEQ ID NO: 1263, SEQ ID NO: 1264, SEQ ID NO: 1265, SEQ ID NO: 1266, SEQ ID NO: 1267, SEQ ID NO: 1268, SEQ ID NO: 1269, SEQ ID NO: 1270, SEQ ID NO: 1271, SEQ ID NO: 1272, SEQ ID NO: 1273, SEQ ID NO: 1274, SEQ ID NO: 1275, SEQ ID NO: 1276, and SEQ ID NO: 1277.


The antibody constructs may have a binding domain comprising or consisting of a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1278, SEQ ID NO: 1279, SEQ ID NO: 1280, SEQ ID NO: 1281, SEQ ID NO: 1282, SEQ ID NO: 1283, SEQ ID NO: 1284, SEQ ID NO: 1285.


The antibody constructs binding to DLL3 as disclosed above are intended for use in the prevention, prophylaxis, treatment or amelioration of a cancer, particularly of a cancer referred to supra, and are part of combination products, kits, etc., and/or may be used in or administered in steps of the methods according to the present invention, i.e. together with an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling, wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) is administered to a patient in need thereof prior to administration of said antibody construct (a), wherein the patient is preferably a human being or a non-human primate, and wherein said inhibitor/antagonist is administered to prevent or reduce cytokine release syndrome (CRS) or other adverse effects associated with administration of a CD3-binding construct as disclosed throughout the present invention and as set out below:


(i) A combination product for the treatment of and optionally also for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain (also referred to as “first domain”) which binds to a target antigen on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), comprising

    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the first domain binds selectively to human DLL3.


      (ii) The combination product for the treatment of and optionally also for the prevention or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) of Sub-Aspect A-5, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3, which are selected from the group comprising: CDR-H1 as depicted in SEQ ID NO: 1040, CDR-H2 as depicted in SEQ ID NO: 1041, CDR-H3 as depicted in SEQ ID NO: 1042, CDR-L1 as depicted in SEQ ID NO: 1043, CDR-L2 as depicted in SEQ ID NO: 1044 and CDR-L3 as depicted in SEQ ID NO: 1045; CDR-H1 as depicted in SEQ ID NO: 1046, CDR-H2 as depicted in SEQ ID NO: 1047, CDR-H3 as depicted in SEQ ID NO: 1048, CDR-L1 as depicted in SEQ ID NO: 1049, CDR-L2 as depicted in SEQ ID NO: 1050 and CDR-L3 as depicted in SEQ ID NO: 1051; CDR-H1 as depicted in SEQ ID NO: 1052, CDR-H2 as depicted in SEQ ID NO: 1053, CDR-H3 as depicted in SEQ ID NO: 1054, CDR-L1 as depicted in SEQ ID NO: 1055, CDR-L2 as depicted in SEQ ID NO: 1056 and CDR-L3 as depicted in SEQ ID NO: 1057; CDR-H1 as depicted in SEQ ID NO: 1058, CDR-H2 as depicted in SEQ ID NO: 1059, CDR-H3 as depicted in SEQ ID NO: 1060, CDR-L1 as depicted in SEQ ID NO: 1061, CDR-L2 as depicted in SEQ ID NO: 1062 and CDR-L3 as depicted in SEQ ID NO: 1063; CDR-H1 as depicted in SEQ ID NO: 1064, CDR-H2 as depicted in SEQ ID NO: 1065, CDR-H3 as depicted in SEQ ID NO: 1066, CDR-L1 as depicted in SEQ ID NO: 1067, CDR-L2 as depicted in SEQ ID NO: 1068 and CDR-L3 as depicted in SEQ ID NO: 1069; CDR-H1 as depicted in SEQ ID NO: 1070, CDR-H2 as depicted in SEQ ID NO: 1071, CDR-H3 as depicted in SEQ ID NO: 1072, CDR-L1 as depicted in SEQ ID NO: 1073, CDR-L2 as depicted in SEQ ID NO: 1074 and CDR-L3 as depicted in SEQ ID NO: 1075; CDR-H1 as depicted in SEQ ID NO: 1076, CDR-H2 as depicted in SEQ ID NO: 1077, CDR-H3 as depicted in SEQ ID NO: 1078, CDR-L1 as depicted in SEQ ID NO: 1079, CDR-L2 as depicted in SEQ ID NO: 1080 and CDR-L3 as depicted in SEQ ID NO: 1081; CDR-H1 as depicted in SEQ ID NO: 1082, CDR-H2 as depicted in SEQ ID NO: 1083, CDR-H3 as depicted in SEQ ID NO: 1084, CDR-L1 as depicted in SEQ ID NO: 1085, CDR-L2 as depicted in SEQ ID NO: 1086 and CDR-L3 as depicted in SEQ ID NO: 1087; and CDR-H1 as depicted in SEQ ID NO: 1088, CDR-H2 as depicted in SEQ ID NO: 1089, CDR-H3 as depicted in SEQ ID NO: 1090, CDR-L1 as depicted in SEQ ID NO: 1091, CDR-L2 as depicted in SEQ ID NO: 1092 and CDR-L3 as depicted in SEQ ID NO: 1093.


      (iii) The combination product for the treatment of and optionally also for the prevention or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) and (ii) of Sub-Aspect A-5, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain binds selectively to DLL3, and wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a VH region selected from the group comprising those depicted in SEQ ID NO: 1094, SEQ ID NO: 1095, SEQ ID NO: 1096, SEQ ID NO: 1097, SEQ ID NO: 1098, SEQ ID NO: 1099, SEQ ID NO: 1100, SEQ ID NO: 1101, SEQ ID NO: 1102, SEQ ID NO: 1103 and SEQ ID NO: 1104.


      (iv) The combination product for the treatment of and optionally also for the prevention or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (iii) of Sub-Aspect A-5, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain binds selectively to DLL3, and wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a VL region selected from the group comprising those depicted in SEQ ID NO: 1105, SEQ ID NO: 1106, SEQ ID NO: 1107, SEQ ID NO: 1108, SEQ ID NO: 1109, SEQ ID NO: 1110, SEQ ID NO: 1111, SEQ ID NO: 1112, SEQ ID NO: 1113, SEQ ID NO: 1114 and SEQ ID NO: 1115.


      (v) The combination product for the treatment of and optionally also for the prevention or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (iv) of Sub-Aspect A-5, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain binds selectively to DLL3, and wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a pair of a VH region and a VL region selected from the group consisting of pairs of a VH region and a VL region as depicted in SEQ ID NOs: 1094+1105; SEQ ID NOs: 1095+1106; SEQ ID NOs: 1096+1107; SEQ ID NOs: 1097+1108; SEQ ID NOs: 1098+1109; SEQ ID NOs: 1099+1110; SEQ ID NOs: 1100+1111; SEQ ID NOs: 1101+1112; SEQ ID NOs: 1102+1113; SEQ ID NOs: 1103+1114; and SEQ ID NOs: 1104+1115.


      (vi) The combination product for the treatment of and optionally also for the prevention or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (v) of Sub-Aspect A-5, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), particularly wherein the patient is not a rodent, and more particularly, wherein the patient is either a human being or a non-human primate, and wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1116, SEQ ID NO: 1117, SEQ ID NO: 1118, SEQ ID NO: 1119, SEQ ID NO: 1120, SEQ ID NO: 1121, SEQ ID NO: 1122, SEQ ID NO: 1123, SEQ ID NO: 1124, SEQ ID NO: 1125 and SEQ ID NO: 1126.


      (vii) The combination product for the treatment of and optionally also for the prevention or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (vi) of Sub-Aspect A-5, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1127, SEQ ID NO: 1128, SEQ ID NO: 1129, SEQ ID NO: 1130, SEQ ID NO: 1131, SEQ ID NO: 1132, SEQ ID NO: 1133, SEQ ID NO: 1134, SEQ ID NO: 1135, SEQ ID NO: 1136, SEQ ID NO: 1137, SEQ ID NO: 1139, SEQ ID NO: 1140, SEQ ID NO: 1141, SEQ ID NO: 1142, SEQ ID NO: 1143, and SEQ ID NO: 1144.


      (viii) The combination product for the treatment of and optionally also for the prevention or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (vii) of Sub-Aspect A-5, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a polypeptide binding domain that binds to an epitope of DLL3 which is comprised within the region as depicted in SEQ ID NO: 1145.


      (ix) The combination product for the treatment of and optionally also for the prevention or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (viii) of Sub-Aspect A-5, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a polypeptide binding domain that comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from the group consisting of: CDR-H1 as depicted in SEQ ID NO: 1146, CDR-H2 as depicted in SEQ ID NO: 1147, CDR-H3 as depicted in SEQ ID NO: 1148, CDR-L1 as depicted in SEQ ID NO: 1149, CDR-L2 as depicted in SEQ ID NO: 1150 and CDR-L3 as depicted in SEQ ID NO: 1151; CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1153, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1155, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; CDR-H1 as depicted in SEQ ID NO: 1158, CDR-H2 as depicted in SEQ ID NO: 1159, CDR-H3 as depicted in SEQ ID NO: 1160, CDR-L1 as depicted in SEQ ID NO: 1161, CDR-L2 as depicted in SEQ ID NO: 1162 and CDR-L3 as depicted in SEQ ID NO: 1163; CDR-H1 as depicted in SEQ ID NO: 1164, CDR-H2 as depicted in SEQ ID NO: 1165, CDR-H3 as depicted in SEQ ID NO: 1166, CDR-L1 as depicted in SEQ ID NO: 1167, CDR-L2 as depicted in SEQ ID NO: 1168 and CDR-L3 as depicted in SEQ ID NO: 1169; CDR-H1 as depicted in SEQ ID NO: 1170, CDR-H2 as depicted in SEQ ID NO: 1171, CDR-H3 as depicted in SEQ ID NO: 1172, CDR-L1 as depicted in SEQ ID NO: 1173, CDR-L2 as depicted in SEQ ID NO: 1174 and CDR-L3 as depicted in SEQ ID NO: 1175; CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1176, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1155, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1177, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1155, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1153, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1178, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1153, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1179, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1153, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1180, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1153, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1181, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1176, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1178, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; and CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1177, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1179, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157.


      (x) The combination product for the treatment of and optionally also for the prevention or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (ix) of Sub-Aspect A-5, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct comprising a polypeptide a binding domain that comprises a VH region selected from the group consisting of those depicted in SEQ ID NO: 1182, SEQ ID NO: 1183, SEQ ID NO: 1184, SEQ ID NO: 1185, SEQ ID NO: 1186, SEQ ID NO: 1187, SEQ ID NO: 1188, SEQ ID NO: 1189, SEQ ID NO: 1190, SEQ ID NO: 1191, SEQ ID NO: 1192, SEQ ID NO: 1193, SEQ ID NO: 1194, SEQ ID NO: 1195, SEQ ID NO: 1196, and SEQ ID NO: 1197.


      (xi) The combination product for the treatment of and optionally also for the prevention or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (v) of Sub-Aspect A-5, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct comprising a polypeptide have a binding domain that comprises a VL region selected from the group consisting of those depicted in SEQ ID NO: 1198, SEQ ID NO: 1199, SEQ ID NO: 1200, SEQ ID NO: 1201, SEQ ID NO: 1202, SEQ ID NO: 1203, SEQ ID NO: 1204, SEQ ID NO: 1205, SEQ ID NO: 1206, SEQ ID NO: 1207, SEQ ID NO: 1208, SEQ ID NO: 1209, SEQ ID NO: 1210, SEQ ID NO: 1211, SEQ ID NO: 1212, SEQ ID NO: 1213, SEQ ID NO: 1214, SEQ ID NO: 1215, SEQ ID NO: 1216, and SEQ ID NO: 1217.


      (xii) The combination product for the treatment of and optionally also for the prevention or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (xi) of Sub-Aspect A-5, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), particularly wherein the patient is not a rodent, and more particularly, wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct comprising a polypeptide that comprises a VH region and a VL region selected from the group consisting of pairs of a VH region and a VL region as depicted in SEQ ID NOs: 1182+1198; SEQ ID NOs: 1183+1199; SEQ ID NOs: 1184+1200; SEQ ID NOs: 1185+1201; SEQ ID NOs: 1186+1202; SEQ ID NOs 1183+1203; SEQ ID NOs 1183+1204; SEQ ID NOs 1183+1206; SEQ ID NOs 1183+1206; SEQ ID NOs 1183+1207; SEQ ID NOs 1187+1199; SEQ ID NOs 1188+1199; SEQ ID NOs 1189+1199; SEQ ID NOs 1187+1207; SEQ ID NOs 1190+1208; 1191+1209; SEQ ID NOs 1191+1209; SEQ ID NOs 1192+1210; SEQ ID NOs 1192+1211; SEQ ID NOs 1192+1212; SEQ ID NOs 1192+1213; SEQ ID NOs 1192+1214; SEQ ID NOs 1192+1215; SEQ ID NOs 1193+1210; SEQ ID NOs 1194+1210; SEQ ID NOs 1195+1210; SEQ ID NOs 1193+1215; SEQ ID NOs 1196+1216; and SEQ ID NOs 1197+1217.


      (xiii) The combination product for the treatment of and optionally also for the prevention or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (xii) of Sub-Aspect A-5, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), particularly wherein the patient is not a rodent, and more particularly, wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1218, SEQ ID NO: 1219, SEQ ID NO: 1220, SEQ ID NO: 1221, SEQ ID NO: 1222, SEQ ID NO: 1223, SEQ ID NO: 1224, SEQ ID NO: 1225, SEQ ID NO: 1226, SEQ ID NO: 1227, SEQ ID NO: 1228, SEQ ID NO: 1229, SEQ ID NO: 1230, SEQ ID NO: 1231, SEQ ID NO: 1232, SEQ ID NO: 1233, SEQ ID NO: 1234, SEQ ID NO: 1235, SEQ ID NO: 1236, SEQ ID NO: 1237, SEQ ID NO: 1238, SEQ ID NO: 1239, SEQ ID NO: 1240, SEQ ID NO: 1241, SEQ ID NO: 1242, SEQ ID NO: 1243, SEQ ID NO: 1244, and SEQ ID NO: 1245.


      (xiv) The combination product for the treatment of and optionally also for the prevention or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (xiii) of Sub-Aspect A-5, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), particularly wherein the patient is not a rodent, and more particularly, wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct comprising a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1246, SEQ ID NO: 1247, SEQ ID NO: 1248, SEQ ID NO: 1249, SEQ ID NO: 1250; SEQ ID NO: 1251, SEQ ID NO: 1252, SEQ ID NO: 1253, SEQ ID NO: 1254, SEQ ID NO: 1255, SEQ ID NO: 1256, SEQ ID NO: 1257, SEQ ID NO: 1258, SEQ ID NO: 1259, SEQ ID NO: 1260, SEQ ID NO: 1261, SEQ ID NO: 1262, SEQ ID NO: 1263, SEQ ID NO: 1264, SEQ ID NO: 1265, SEQ ID NO: 1266, SEQ ID NO: 1267, SEQ ID NO: 1268, SEQ ID NO: 1269, SEQ ID NO: 1270, SEQ ID NO: 1271, SEQ ID NO: 1272, SEQ ID NO: 1273, SEQ ID NO: 1274, SEQ ID NO: 1275, and SEQ ID NO: 1276.


      (xv) The combination product for the treatment of and optionally also for the prevention or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (xiv) of Sub-Aspect A-5, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), particularly wherein the patient is not a rodent, and more particularly, wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising binding domain comprising or consisting of a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1277, SEQ ID NO: 1278, SEQ ID NO: 1279, SEQ ID NO: 1280, SEQ ID NO: 1281, SEQ ID NO: 1282, SEQ ID NO: 1283, SEQ ID NO: 1284.


      Aspect B)—Methods of Treatment, Prevention and/or Prophylaxis


The present invention further relates to the treatment, and optionally also to the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy, preferably immunotherapy of a neoplastic disease, with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell, comprising administering a combination product of any one of the preceding embodiments of general Aspect A) to a patient in need thereof as discussed in the following embodiments:


(i) A method of for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy, preferably immunotherapy of a neoplastic disease, with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell, comprising administering a combination product of any one of the preceding embodiments of general Aspect A) to a patient in need thereof, wherein said target antigen is a tumor-associated antigen selected from the group comprising CD19, CD33, FLT3, PSMA, and DLL3.


(ii) The method for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) of Aspect B).


(iii) The method for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiment (i) and/or (ii) of Aspect B) comprising:

    • (a) administering an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell,
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is administered to the patient prior to and optionally also following administration of said antibody construct.


      (iv) The method for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (iii) of Aspect B), wherein the adverse event associated with immunotherapy is CRS or TLS. Adverse events include, but are not limited to a neurological reaction, preferably one or more selected from the group consisting of: confusion, ataxia, disorientation, dysphasia, aphasia, speech impairment, cerebellar symptoms, treor, apraxia, seizure, grand mal convulsion, palsy, and balance disorder.


      (v) The method for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (iv) of Aspect B), wherein the second domain of said antibody construct binds to CD3, preferably human CD3, epsilon and to Callithrix jacchus or Saimiri sciureus CD3 epsilon.


      (vi) The method for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (v) of Aspect B), wherein
    • (a)—the antibody construct is a single chain antibody construct,
    • (b)—the first domain is in the format of an scFv,
    • (c)—the second domain is in the format of an scFv,
    • (d)—the first and the second domain are connected via a linker, and/or
    • (e)—the antibody construct comprises a domain providing an extended serum half-life.


      (vii) The method for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (vi) of Aspect B), wherein the first domain binds to a target antigen selected from the group comprising tumor-associated antigens, viral antigens, bacterial antigens, peptide-MHC complexes presenting a peptide fragments derived from a tumor-associated antigen, viral antigen, bacterial antigen, or a disease-associated antigen.


      (viii) The method for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (vii) of Aspect B), wherein the antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group comprising small molecules, biological molecules, aptamers, antibodies and derivatives thereof.


      (ix) The method for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (viii) of Aspect B), wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group of TNF inhibitors/antagonists comprising etanercept, infliximab, adalimumab, certolizumab Pergol, and golimumab, particularly etanercept.


      (x) The method for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (ix) of Aspect B), wherein said combination product is for administration to a patient at risk of developing adverse events or having an intolerance to one of a group comprising corticosteroids, IL-6-inhibitors, IL-6R-inhibitors, and/or inhibitor/antagonist of TNF/TNFR that are different from the group of inhibitors/antagonists of TNF/TNFR according to (b) in any on of the preceding embodiments, particularly different from etanercept.


      (xi) The method for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (x) of Aspect B), wherein said antibody construct is for administration to a patient at risk of developing adverse events or having an intolerance to corticosteroids, wherein the corticosteroid is dexamethasone.


      (xii) The method for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (xi) of Aspect B), preferably in the immunotherapy of a neoplastic disease, wherein said antibody construct is for administration to a patient at risk of developing adverse events or having an intolerance to IL6-antagonists and/or IL-6R-antagonists, particularly wherein the IL-6R-antagonist is tocilizumab.


      (xiii) The method for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (xii) of Aspect B), preferably immunotherapy of a neoplastic disease, wherein said antibody construct further comprises at least one corticosteroid.


      (xiv) The method for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (xiii) of Aspect B), preferably in the immunotherapy of a neoplastic disease, wherein said corticostoid is dexamethasone.


      (xv) The method for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (xiv), of Aspect B), preferably in the immunotherapy of a neoplastic disease, wherein said combination product further comprises at least one IL-6 antagonist and/or IL-6R-antagonist, wherein said IL-6R-antagonist is tocilizumab.


      (xvi) The method for the treatment of and optionally also for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell according to embodiments (i) to (xv) of Aspect B), preferably in the immunotherapy of a neoplastic disease, further comprising at least one corticosteroid, particularly dexamethasone and/or at least one IL-6 and/or IL-6R-antagonist, particularly tocilizumab, wherein said at least one corticosteroid and/or said IL-6 and/or IL-6R-antagonist is for administration to a patient in need thereof prior of, concomitant to, and/or after administration of said antibody construct (a).


The combination products used in the methods for the prevention, prophylaxis, amelioration, or reduction according of adverse events according to any one of the above embodiments involves combination products comprising antibody constructs as disclosed in the following sections in Sub-Aspects B-1 to B-5.


Sub-Aspect B-1—Immunotherapeutic Methods for the Treatment of Cancer and Prevention, Prophylaxis of Immunotherapy-Related Adverse Events Using Constructs Binding CD19

As discussed above, one target antigen on the surface of a target cell that is bound by the first domain of the antibody constructs, which are part of combination products, kits, etc., and may be used or administered in methods according to the invention, is CD19. According to the invention, antibody contracts that comprise a CD19-binding domain are disclosed, for example, in WO2010052014, which is hereby incorporated by reference in its entirety. Some of the therein disclosed antibody constructs and domains binding, inter alia, to CD19 are also shown in the Sequence Listing below.


Accordingly, methods for the treatment of cancer and additionally for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody are envisaged, wherein the domain of the antibody construct used in accordance with the present invention, which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3, wherein CDR-L1 is depicted in SEQ ID NO:314, CDR-L2 is depicted in SEQ ID NO: 315, and CDR-L3 is depicted in SEQ ID NO: 316.


Also, methods for the treatment of cancer and additionally for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody are envisaged, wherein the domain which binds to CD19 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


Further, methods for the treatment of cancer and additionally for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody are envisaged, wherein the domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


Further, methods for the treatment of cancer and additionally for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody are envisaged, wherein the domain which binds to CD19 comprises a VL region as depicted in SEQ ID NO: 309.


Further, methods for the treatment of cancer and additionally for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody are envisaged, wherein the domain which binds to CD19 comprises a VH region as depicted in any one of SEQ ID NO: 308.


Further, methods for the treatment of cancer and additionally for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody are envisaged, wherein the domain which binds to CD19 comprising a VL region and a VH region consisting a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308.


Further, methods for the treatment of cancer and additionally for the prevention, prophylaxis, amelioration, or reduction of adverse events associated with immunotherapy with an antibody are envisaged, wherein a domain which binds to CD19 comprising a VL region and a VH region consisting a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308, or with an antibody construct having a domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


As mentioned above, the methods for the treatment of cancer and additionally for the prevention, prophylaxis, amelioration, or reduction of adverse events also refer to those wherein antibody constructs may be used which compete with the binding of the above specified antibody constructs or those that bind to the epitope recognized by the above antibody constructs, which are defined by specific SEQ ID Nos.


Further, the term “compete for binding” means, that the binding of the explicitly defined antibodies in the above paragraphs of this sub-aspect is reduced by competition by a competition antibody that binds to CD19, preferably to an epitope that is bound by any of the above explicitly defined antibodies. The competition antibodies may have VL and/or VH regions that differ in their amino acid sequence(s) from the explicitly described antibodies, when both, the competition antibodies and the explicitly described antibodies are co-incubated in a competition assay with target cells that express CD19, wherein both, competition antibody and explicitly defined antibody are used at equimolar concentrations in such competition assays. The competition antibody may be labelled (the explicitly defined antibody may be unlabeled or differently labelled to permit a quantification) to distinguish the number of competition antibody bound to the target antigen at the end of the competition binding assay method. The amount/number of competition antibody that binds under such circumstances to the target should be at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, preferably at least 95% of all antibodies selectively binding to the target antigen. The competition antibody may comprise one or more, e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or even more amino acid residues that are different from the explicitly disclosed antibodies. In preferred aspects of the invention, the competition antibodies have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more amino acid residues that are different from the herein described antibodies characterized by a domain which binds to CD19 comprising a VL region and a VH region consisting a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308, or with an antibody construct having a domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


(i) Therefore, the present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, such as ALL, wherein an antibody construct is administered that comprises at least one domain (also referred to as “first domain”) which binds to CD19 on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as defined in this Sub-Aspect B-1, said method comprising

    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), Further, the present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiment (i) of Sub-Aspect B-1, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that has the VH chain and/or VL chain respectively, that are disclosed in WO2010052014, particularly in the sequence listing, which is hereby incorporated by reference.


      (ii) Further, the present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct as part of a combination product is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in embodiment (i) or (ii) of Sub-Aspect B-1, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is also part of said combination product for administration to a patient prior to administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that has the following VH chains and/or VL chains respectively that are disclosed in WO2010052014, particularly in the sequence listing, which is hereby incorporated by reference.


      (iii) Further, the present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain (also referred to as “first domain”) which binds to CD 19 on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiment (i) to (iii) of Sub-Aspect B-1, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3, wherein CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316.


      (iv) Further, the present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain (also referred to as “first domain”) which binds to CD19 on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiment (i) to (iv) of Sub-Aspect B-1, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to CD19 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


      (v) Further, the present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in embodiment (i) to (v) of Sub-Aspect B-1, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


      (vi) Further, the present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiment (i) to (vi) of Sub-Aspect B-1, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), and wherein the domain which binds to CD19 comprises a VL region as depicted in SEQ ID NO: 309.


      (vii) Further, the present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in embodiment (i) to (vii) of Sub-Aspect B-1, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), and wherein the domain which binds to CD19 comprises a VH region as depicted in any one of SEQ ID NO: 308.


      (viii) Further, the present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in embodiment (i) to (viii) of Sub-Aspect B-1, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to CD19 comprises a VL region and a VH region consisting a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308.


      (ix) Further, the present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in embodiment (i) to (ix) of Sub-Aspect B-1, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the first domain which binds to CD19 competes for binding to CD19 with an antibody construct in accordance with the present invention that is characterized by a domain which binds to CD19 comprising a VL region and a VH region consisting a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308, or with an antibody construct having a domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


Sub-Aspect B-2—Immunotherapeutic Methods for the Treatment of Cancer and Prevention, Prophylaxis of Immunotherapy-Related Adverse Events Using Constructs Binding CD33

The present invention relates also to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, comprising administering antibody constructs binding to CD3 and CD33. Therein disclosed cross-species constructs comprise those exemplified in WO2008119567; in Example 23, and particularly in Example 36, and respective sequences of the Sequence Listing all of which are hereby incorporated by reference.


The functionality of cross-species specific bispecific antibody constructs regarding the capability to bind to human and macaque CD33 and CD3, respectively, may be determined by FACS analysis as described in WO2008119567. Briefly, CHO cells transfected with CD3, preferably human CD3,3 as described in Example 23.1 in WO2008119567 and the CD3, preferably human CD3, positive T cell leukemia cell line HPB-ALL may be used to test the binding to human target antigens. The binding reactivity to macaque antigens may be tested by using the generated macaque CD33 transfectant as described in Example 23.2 in WO2008119567 and macaque PBMC. Flow cytometry can be performed as described in WO2008119567 to acquire and analyze the data. FACS staining and measuring of the fluorescence intensity can be performed as described in Current Protocols in Immunology (Coligan, Kruisbeek, Margulies, Shevach and Strober, Wiley-Interscience, 2002). The binding of single chain molecules, which are cross-species specific for CD33 and cross-species specific for human and non-chimpanzee primate CD3 may be determined as in WO2008119567. Bioactivity of the generated bispecific single chain antibodies can be analyzed by chromium 51 (51Cr) release in vitro cytotoxicity assays using the CD33 positive cell lines described in Examples 36, 23.1 and 23.2 as described in WO2008119567. As shown also in WO2008119567, cross-species specific bispecific single chain antibody constructs demonstrate cytotoxic activity against CD3, preferably human CD3,3 positive target cells elicited by stimulated human CD4/CD56 depleted PBMC and against macaque CD33 positive target cells elicited by the macaque T cell line 4119LnPx.


The present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly immunotherapy of blood cancer, more particularly of leukemia, for example of AML, for the antibody construct used in accordance with the present invention that the domain which selectively binds to CD33 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from: CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, and CDR-L3 as depicted in SEQ ID NO: 319; and CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319.


The present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly immunotherapy of blood cancer, more particularly of leukemia, for example of AML, for the antibody construct used in accordance with the present invention, wherein the domain which selectively binds to CD33 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325, which is preferred; CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325.


The present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly immunotherapy of blood cancer, more particularly of leukemia, for example of AML, for the antibody construct used in accordance with the present invention, wherein the domain which selectively binds to CD33 comprises a VL region selected from the group of VL regions as depicted in any one of SEQ ID NOs 328, 329, 330, 331, and 332.


The present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly immunotherapy of blood cancer, more particularly of leukemia, for example of AML, for the antibody construct used in accordance with the present invention, wherein the domain which selectively binds to CD33 comprises a VH region selected from the group consisting of a VH regions as depicted in any one of SEQ ID Nos. 333, 334, 335, 336, 337, 338 and 339.


The present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly immunotherapy of blood cancer, more particularly of leukemia, for example of AML, for the antibody construct used in accordance with the present invention, wherein the domain which selectively binds to CD33 comprises a VL region and a VH region selected from the group comprising a pair of a VL region and a VH region as depicted in SEQ ID Nos: 328+333, 328+334, 328+335, 328+336, 328+337, 328+338, 328+339, 329+333, 329+334, 329+335, 329+336, 329+337, 329+338, 329+339, 330+333, 330+334, 330+335, 330+336, 330+337, 330+338, 330+339, 331+333, 331+333, 331+334, 331+335, 331+336, 331+337, 331+338, 331+339, 332+333, 332+334, 332+335, 332+336, 332+337, 332+338, and 332+339.


The present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly immunotherapy of blood cancer, more particularly of leukemia, for example of AML, for the antibody construct used in accordance with the present invention, wherein the domain which selectively binds to CD33 comprises CDR-L CDR-L2 and CDR-L3 and CDR-H1, CDR-H2 and CDR-H3 as depicted in the following groups of sequences: CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325, which is the preferred group; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325.


The present invention relates to methods for the treatment of cancer and additionally for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly immunotherapy of blood cancer, more particularly of leukemia, for example of AML, for the antibody construct used in accordance with the present invention, wherein the domain which selectively binds to CD33 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 consisting of pairs selected from the group consisting of SEQ ID Nos. 328+333, 328+334, 328+335, 328+336, 328+337, 328+338, 328+339, 329+333, 329+334, 329+335, 329+336, 329+337, 329+338, 329+339, 330+333, 330+334, 330+335, 330+336, 330+337, 330+338, 330+339, 331+333, 331+333, 331+334, 331+335, 331+336, 331+337, 331+338, 331+339, 332+333, 332+334, 332+335, 332+336, 332+337, 332+338, and 332+339.


It is also envisaged for the antibody construct used in the methods in accordance with the present invention that the domain which selectively binds to an epitope of CD33 that it competes with those explicitly recited herein, i.e. those characterized by specific SEQ ID Nos.


Whether or not an antibody construct binds to the same epitope of CD33 as another given antibody construct can be measured e.g. by epitope mapping with chimeric or truncated target molecules, e.g. as described herein above and in the Examples in WO2017021362.


Further, whether an antibody construct competes for binding with another given antibody construct can be measured in a competition assay such as a competitive ELISA or a cell-based competition assay. Avidin-coupled microparticles (beads) can also be used. Like an avidin-coated ELISA plate, when reacted with a biotinylated protein, each of these beads can be used as a substrate on which an assay can be performed. Antigen is coated onto a bead and then precoated with the first antibody. The second antibody is added, and any additional binding is determined. Possible means for the read-out includes flow cytometry.


(i) Accordingly, methods of the invention for the treatment of cancer and the prevention, prophylaxis, amelioration or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of leukemia, very particularly of AML, comprise the administration of an antibody construct comprising at least one domain (also referred to as “first domain”) which binds to a target antigen on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv), of Aspect A) and/or the introductory sections of Sub-Aspect B-2, said methods comprising

    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the first domain binds selectively to CD33.


      (ii) Further, the present invention relates to methods of the invention for the treatment of cancer and the prevention, prophylaxis, amelioration or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of leukemia, very particularly of AML, comprise the administration of an antibody construct that comprises at least one domain which binds to CD33 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiment (i) of Sub-Aspect B-2, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration/administered to a patient prior to administration of said antibody construct referred to in (a), and wherein said antibody construct binds to CD33 that is selectively bound by an antibody/antibody construct that has the following CDRs of the VH chain and/or VL chain selected from the group comprising: a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from: CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319, which is preferred; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, and CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319; a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325, which is preferred; CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325.


      (iii) Further, to the present invention relates to methods of the invention for the treatment of cancer and the prevention, prophylaxis, amelioration or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of leukemia, very particularly of AML, comprise the administration of an antibody construct that comprises at least one domain which binds to CD33 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiment (i) or (ii) of Sub-Aspect B-2, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to CD33 that is selectively bound by an antibody/antibody construct that comprises a VL chain region selected from the group of VL chain regions as depicted in any one of SEQ ID NOs 328, 329, 330, 331, and 332.


      (iv) Further, the present invention relates to methods of the invention for the treatment of cancer and the prevention, prophylaxis, amelioration or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of leukemia, very particularly of AML, comprise the administration of an antibody construct that comprises at least one domain which binds to CD33 on the surface of a target cell on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiment (i) to (iii) of Sub-Aspect B-2, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), and wherein said antibody construct binds to CD33 that is selectively bound by an antibody/antibody construct that comprises a VH chain region selected from the group of VH chain regions as depicted in any one of SEQ ID Nos. 333, 334, 335, 336, 337, 338 and 339.


      (v) Further, the present invention relates to methods of the invention for the treatment of cancer and the prevention, prophylaxis, amelioration or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of leukemia, very particularly of AML, comprise the administration of an antibody construct that comprises at least one domain which binds to CD33 on the surface of a target cell on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiment (i) to (iv) of Sub-Aspect B-2, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), particularly wherein the patient is not a rodent, and more particularly, wherein the patient is either a human being or a non-human primate, and wherein said domain binding to CD33 comprises a


VL region and a VH region selected from the group of pairs of a VL region and a VH region depicted in SEQ ID Nos: 328+333, 328+334, 328+335, 328+336, 328+337, 328+338, 328+339, 329+333, 329+334, 329+335, 329+336, 329+337, 329+338, 329+339, 330+333, 330+334, 330+335, 330+336, 330+337, 330+338, 330+339, 331+333, 331+333, 331+334, 331+335, 331+336, 331+337, 331+338, 331+339, 332+333, 332+334, 332+335, 332+336, 332+337, 332+338, and 332+339.


(vi) Further, the present invention relates to methods of the invention for the treatment of cancer and the prevention, prophylaxis, amelioration or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of leukemia, very particularly of AML, comprise the administration of an antibody construct that comprises at least one domain which binds to CD33 on the surface of a target cell on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiment (i) to (v) of Sub-Aspect B-2, said method comprising

    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said domain binding to CD33 comprises CDR-L1, CDR-L2 and CDR-L3 and CDR-H1, CDR-H2 and CDR-H3 as depicted in the following groups of sequences: CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325, which is preferred; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325.


      (vii) The present invention relates also to methods of the invention for the treatment of cancer and the prevention, prophylaxis, amelioration or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of leukemia, very particularly of AML, comprise the administration of an antibody construct that comprises at least one domain which binds to CD33 on the surface of a target cell on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiment (i) to (vi) of Sub-Aspect B-2, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said domain binding to CD33 comprises a VL region that comprises CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from SEQ ID NOs: 328+333, 328+334, 328+335, 328+336, 328+337, 328+338, 328+339, 329+333, 329+334, 329+335, 329+336, 329+337, 329+338, 329+339, 330+333, 330+334, 330+335, 330+336, 330+337, 330+338, 330+339, 331+333, 331+333, 331+334, 331+335, 331+336, 331+337, 331+338, 331+339, 332+333, 332+334, 332+335, 332+336, 332+337, 332+338, and 332+339.


      (viii) The present invention relates also to methods of the invention for the treatment of cancer and the prevention, prophylaxis, amelioration or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, particularly of leukemia, very particularly of AML, comprise the administration of an antibody construct that comprises at least one domain which binds to CD33 on the surface of a target cellon the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiment (i) to (vii) of Sub-Aspect B-2, said method comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the first domain which binds to CD33 competes for binding to CD33 with an antibody construct as defined in any one of embodiments (i) to (vii) of Sub-Aspect B-2) or wherein the first domain binds to the same epitope on CD33 as those referred to in any of the above Sub-Aspect B-2).


Sub-Aspect B-3—Immunotherapeutic Methods for the Treatment of Cancer and Prevention, Prophylaxis of Immunotherapy-Related Adverse Events Using Constructs Binding FLT3

In accordance with the present invention, antibody constructs binding to CD3 and FLT3 comprise those exemplified in WO2017021362, the contents of which are hereby incorporated by reference.


Fms-like tyrosine kinase 3 (FLT3) also known as fetal liver kinase 2 (FLK-2), human stem cell kinase 1 (SCK-1) or Cluster of Differentiation antigen (CD135) is a hematopoietic receptor tyrosine kinase that was cloned by two independent groups in the 1990s. The FLT3 gene, located on chromosome 13q12 in humans encodes a Class III receptor tyrosine kinase protein that shares homology with other Class III family members including stem cell factor receptor (c-KIT), macrophage colony-stimulating factor receptor (FMS) and platelet-derived growth factor receptor (PDGFR). Human FLT3 is expressed in CD34+CD38-hematopoietic stem cells (HSC) as well as in a subset of dendritic precursor cells. The most common FLT3 mutation in Acute Myeloid Leukemia (AML) is the FLT3 internal tandem duplication (FLT3-ITD) that is found in 20 to 38% of patients with cytogenetically normal AML. FLT3-ITDs are formed when a portion of the juxtamembrane domain coding sequence gets duplicated and inserted in a head to tail orientation. FLT3 mutations have not been identified in patients with chronic lymphoid leukemia (CLL), non-Hodgkin's lymphoma and multiple myeloma suggesting strong disease specificity for AML. Mutant FLT3 activation is generally observed across all FAB subtypes, however, it is significantly increased in AML patients with FAB M5 (monocytic leukemia), while FAB subtypes M2 and M6 (granulocytic or erythroid leukemia) are significantly less frequently associated with FLT3 activation, in line with normal expression patterns of FLT3. A small percentage of AML patients (5-7%) present with single amino acid mutations in the FLT3 tyrosine kinase domain (FLT3 TKD), most commonly at D835 or in some cases at T842 or 1836 while even fewer patients (˜1%) harbor mutations in the FLT3 juxtamembrane domain involving residues 579, 590, 591 and 594. Patients with FLT3-ITD mutant AML have an aggressive form of disease characterized by early relapse and poor survival, while overall survival and event-free survival are not significantly influenced by presence of FLT3-TKD mutations. Furthermore, AML patients with FLT3-ITD mutation with concurrent TET2 or DNMT3A mutations have an unfavorable overall risk profile compared to FLT3-ITD mutant AML patients with wild-type TET2 or DNMT3A underscoring the clinical and biological heterogeneity of AML. The selective FLT3-targeting antibody domains disclosed in WO2017021362 are also subject matter of the present invention.


Accordingly, antibody constructs used in combination products, kits, or used in methods according to the present invention comprise a first binding domain which binds to human FLT3 on the surface of a target cell and a second binding domain which binds to CD3, preferably human CD3, on the surface of a T cell, wherein the first binding domain binds to an epitope of FLT3 which is comprised within the region of the human FLT3 having a sequence as depicted in SEQ ID NO: 814 (cluster 1) or SEQ ID NO: 816 (cluster 3) that are disclosed in WO2017021362.


The present invention relates to methods for the treatment and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a leukemia, very particularly AML, wherein the first binding domain of the antibody constructs that may be present in combination products, comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from the group comprising: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


The present invention relates to methods for the treatment and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a leukemia, very particularly AML, wherein the first binding domain of the antibody constructs that may be present in form of combination products, binds to human FLT3 on the surface of a target cell binds to the same epitope of FLT3 as an antibody selected from the group consisting of FL-1 to FL-65 disclosed in WO2017021362, i.e., constructs comprising a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from the group comprising: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


The present invention relates to methods for the treatment and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a leukemia, very particularly AML, wherein the first binding domain of the antibody constructs that may be present in combination products, comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from those depicted in: SEQ ID NOs: 344-346, SEQ ID NOs: 354-356, SEQ ID NOs: 364-366, SEQ ID NOs: 374-376, SEQ ID NOs: 384-386, SEQ ID NOs: 394-396, SEQ ID NOs: 404-406, SEQ ID NOs: 414-416, SEQ ID NOs: 424-426, SEQ ID NOs: 434-436, SEQ ID NOs: 444-446, SEQ ID NOs: 454-456, SEQ ID NOs: 464-466, SEQ ID NOs: 474-476, SEQ ID NOs: 484-486, SEQ ID NOs: 494-496, SEQ ID NOs: 504-506, SEQ ID NOs: 514-516, SEQ ID NOs: 524-526, SEQ ID NOs: 534-536, SEQ ID NOs: 544-546, SEQ ID NOs: 554-556, SEQ ID NOs: 564-566, SEQ ID NOs: 574-576, SEQ ID NOs: 584-586, SEQ ID NOs: 594-596, SEQ ID NOs: 604-606, SEQ ID NOs: 614-616, SEQ ID NOs: 624-626, SEQ ID NOs: 634-636, SEQ ID NOs: 644-646, SEQ ID NOs: 654-656, SEQ ID NOs: 664-666, SEQ ID NOs: 674-676, SEQ ID NOs: 684-686, SEQ ID NOs: 694-696, SEQ ID NOs: 704-706, SEQ ID NOs: 714-716, SEQ ID NOs: 724-726, SEQ ID NOs: 734-736, SEQ ID NOs: 744-746, SEQ ID NOs: 754-756, SEQ ID NOs: 764-766, SEQ ID NOs: 774-776, SEQ ID NOs: 784-786, SEQ ID NOs: 794-796, SEQ ID NOs: 804-806, SEQ ID NOs: 814-816, SEQ ID NOs: 824-826, SEQ ID NOs: 834-836, SEQ ID NOs: 844-846, SEQ ID NOs: 854-856, SEQ ID NOs: 864-866, SEQ ID NOs: 874-876, SEQ ID NOs: 884-886, SEQ ID NOs: 894-896, SEQ ID NOs: 904-906, SEQ ID NOs: 914-916, SEQ ID NOs: 924-926, SEQ ID NOs: 934-936, SEQ ID NOs: 944-946, SEQ ID NOs: 954-956, SEQ ID NOs: 964-966, SEQ ID NOs: 974-976, SEQ ID NOs: 984-986, particularly SEQ ID Nos: 564-566, SEQ ID Nos: 754-756, SEQ ID NOs: 724-726, and preferably SEQ ID NOs: 724-726, particularly SEQ ID Nos: 564-566, SEQ ID Nos: 754-756, SEQ ID NOs: 724-726, and preferably SEQ ID NOs: 724-726.


The present invention relates to methods for the treatment and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a leukemia, very particularly AML, wherein the first binding domain of the antibody constructs that may be present in combination products, comprising a VH region that comprises CDR-H1, CDR-H2 and CDR-H3 selected from those depicted in: SEQ ID NOs: 341-343, SEQ ID NOs: 351-353, SEQ ID NOs: 361-363, SEQ ID NOs: 371-373, SEQ ID NOs: 381-383, SEQ ID NOs: 391-393, SEQ ID NOs: 401-403, SEQ ID NOs: 411-413, SEQ ID NOs: 421-423, SEQ ID NOs: 431-433, SEQ ID NOs: 441-443, SEQ ID NOs: 451-453, SEQ ID NOs: 461-463, SEQ ID NOs: 471-473, SEQ ID NOs: 481-483, SEQ ID NOs: 491-493, SEQ ID NOs: 501-503, SEQ ID NOs: 511-513, SEQ ID NOs: 521-523, SEQ ID NOs: 53-533, SEQ ID NOs: 541-543, SEQ ID NOs: 551-553, SEQ ID NOs: 561-563, SEQ ID NOs: 571-573, SEQ ID NOs: 581-583, SEQ ID NOs: 591-593, SEQ ID NOs: 601-603, SEQ ID NOs: 611-613, SEQ ID NOs: 621-623, SEQ ID NOs: 631-633, SEQ ID NOs: 641-643, SEQ ID NOs: 651-653, SEQ ID NOs: 661-663, SEQ ID NOs: 671-673, SEQ ID NOs: 681-683, SEQ ID NOs: 691-693, SEQ ID NOs: 701-703, SEQ ID NOs: 711-713, SEQ ID NOs: 721-723, SEQ ID NOs: 731-733, SEQ ID NOs: 741-743, SEQ ID NOs: 751-753, SEQ ID NOs: 761-763, SEQ ID NOs: 771-773, SEQ ID NOs: 781-783, SEQ ID NOs: 791-793, SEQ ID NOs: 801-803, SEQ ID NOs: 811-813, SEQ ID NOs: 821-823, SEQ ID NOs: 831-833, SEQ ID NOs: 841-843, SEQ ID NOs: 851-853, SEQ ID NOs: 861-863, SEQ ID NOs: 871-873, SEQ ID NOs: 881-883, SEQ ID NOs: 891-896, SEQ ID NOs: 901-903, SEQ ID NOs: 911-913, SEQ ID NOs: 921-923, SEQ ID NOs: 931-933, SEQ ID NOs: 941-943, SEQ ID NOs: 951-953, SEQ ID NOs: 961-963, SEQ ID NOs: 971-973, SEQ ID NOs: 981-983, particularly SEQ ID Nos: 561-563, SEQ ID Nos: 751-753, SEQ ID NOs: 721-723, and preferably SEQ ID NOs: 721-723.


The present invention relates to methods for the treatment and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a leukemia, very particularly AML, wherein the first binding domain of the antibody constructs that may be present in combination products comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from the sequences in the two preceding paragraphs, particularly from the sequences selected from the group of members comprising the following six CDR sequences: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


It is also envisaged for the antibody constructs used in methods according to the present invention that the domain, which selectively binds to an epitope of FLT3, competes with those explicitly recited herein, i.e. those characterized by specific SEQ ID Nos.


Whether or not an antibody construct binds to the same epitope of FLT3 as another given antibody construct can be measured e.g. by epitope mapping with chimeric or truncated target molecules, e.g. as described herein above and in the Examples in WO2017021362.


Further, whether an antibody construct competes for binding with another given antibody construct can be measured in a competition assay such as a competitive ELISA or a cell-based competition assay. Avidin-coupled microparticles (beads) can also be used. Like an avidin-coated ELISA plate, when reacted with a biotinylated protein, each of these beads can be used as a substrate on which an assay can be performed. Antigen is coated onto a bead and then precoated with the first antibody. The second antibody is added, and any additional binding is determined. Possible means for the read-out includes flow cytometry.


A preferred antibody construct used in methods according to the invention can also be defined as a antibody construct comprising a first (preferably human) binding domain which binds to human FLT3 on the surface of a target cell and a second binding domain which binds to CD3, preferably human CD3, wherein the first binding domain competes for binding with an antibody selected from the group consisting of FL-1 to FL-65 as disclosed in WO2017021362, i.e., an antibody comprising a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from the group consisting of those described above.


The present invention relates to methods for the treatment and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a leukemia, very particularly AML, wherein the first binding domain of the antibody constructs that may be present in combination products, comprise a domain bind to FLT3 comprising a VL region selected from the group of VL regions as depicted in any one of SEQ ID NO: 348, SEQ ID NO: 358, SEQ ID NO: 368, SEQ ID NO: 378, SEQ ID NO: 388, SEQ ID NO: 398, SEQ ID NO: 407+408, SEQ ID NO: 418, SEQ ID NO: 428, SEQ ID NO: 438, SEQ ID NO: 448, SEQ ID NO: 458, SEQ ID NO: 468, SEQ ID NO: 478, SEQ ID NO: 488, SEQ ID NO: 498, SEQ ID NO: 508, SEQ ID NO: 518, SEQ ID NO: 528, SEQ ID NO: 538, SEQ ID NO: 548, SEQ ID NO: 558, SEQ ID NO: 568, SEQ ID NO: 578, SEQ ID NO: 588, SEQ ID NO: 598, SEQ ID NO: 608, SEQ ID NO: 618, SEQ ID NO: 628, SEQ ID NO: 638, SEQ ID NO: 648, SEQ ID NO: 658, SEQ ID NO: 668, SEQ ID NO: 678, SEQ ID NO: 688, SEQ ID NO: 698, SEQ ID NO: 708, SEQ ID NO: 718, SEQ ID NO: 728, SEQ ID NO: 738, SEQ ID NO: 748, SEQ ID NO: 758, SEQ ID NO: 768, SEQ ID NO: 778, SEQ ID NO: 788, SEQ ID NO: 798, SEQ ID NO: 808, SEQ ID NO: 818, SEQ ID NO: 828, SEQ ID NO: 838, SEQ ID NO: 848, SEQ ID NO: 858, SEQ ID NO: 868, SEQ ID NO: 878, SEQ ID NO: 888, SEQ ID NO: 898, SEQ ID NO: 908, SEQ ID NO: 918, SEQ ID NO: 928, SEQ ID NO: 938, SEQ ID NO: 948, SEQ ID NO: 958, SEQ ID NO: 968, SEQ ID NO: 978, particularly SEQ ID Nos: 728, 568, 758, preferably SEQ ID NO: 728.


The present invention relates to methods for the treatment and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a leukemia, very particularly AML, wherein the first binding domain of the antibody constructs that may be present in combination products, binds to FLT3 and comprises a VH region selected from the group of VH regions as depicted in any one of SEQ ID NO: 347, SEQ ID NO: 357, SEQ ID NO: 367, SEQ ID NO: 377, SEQ ID NO: 387, SEQ ID NO: 397, SEQ ID NO: 407, SEQ ID NO: 417, SEQ ID NO: 427, SEQ ID NO: 437, SEQ ID NO: 447, SEQ ID NO: 457, SEQ ID NO: 467, SEQ ID NO: 477, SEQ ID NO: 487, SEQ ID NO: 497, SEQ ID NO: 507, SEQ ID NO: 517, SEQ ID NO: 527, SEQ ID NO: 537, SEQ ID NO: 547, SEQ ID NO: 557, SEQ ID NO: 567, SEQ ID NO: 577, SEQ ID NO: 587, SEQ ID NO: 597, SEQ ID NO: 607, SEQ ID NO: 617, SEQ ID NO: 627, SEQ ID NO: 637, SEQ ID NO: 647, SEQ ID NO: 657, SEQ ID NO: 667, SEQ ID NO: 677, SEQ ID NO: 687, SEQ ID NO: 697, SEQ ID NO: 707, SEQ ID NO: 717, SEQ ID NO: 727, SEQ ID NO: 737, SEQ ID NO: 747, SEQ ID NO: 757, SEQ ID NO: 767, SEQ ID NO: 777, SEQ ID NO: 787, SEQ ID NO: 797, SEQ ID NO: 807, SEQ ID NO: 817, SEQ ID NO: 827, SEQ ID NO: 837, SEQ ID NO: 847, SEQ ID NO: 857, SEQ ID NO: 867, SEQ ID NO: 877, SEQ ID NO: 887, SEQ ID NO: 897, SEQ ID NO: 907, SEQ ID NO: 917, SEQ ID NO: 927, SEQ ID NO: 937, SEQ ID NO: 947, SEQ ID NO: 957, SEQ ID NO: 967, SEQ ID NO: 977, particularly SEQ ID Nos: 727, 767, 757, preferably SEQ ID NO: 727.


The present invention relates to methods for the treatment and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a leukemia, very particularly AML, wherein the first binding domain of the antibody constructs that may be present in form of combination products, binds to FLT3 and comprises pairs of a VH region and a VL region selected from the group of pairs as depicted in SEQ ID NO: 347+348, SEQ ID NO: 357+358, SEQ ID NO: 367+368, SEQ ID NO: 377+378, SEQ ID NO: 387+388, SEQ ID NO: 397+398, SEQ ID NO: 407+408, SEQ ID NO: 417+418, SEQ ID NO: 427+428, SEQ ID NO: 437+438, SEQ ID NO: 447+448, SEQ ID NO: 457+458, SEQ ID NO: 467+468, SEQ ID NO: 477+478, SEQ ID NO: 487+488, SEQ ID NO: 497+498, SEQ ID NO: 507+508, SEQ ID NO: 517+518, SEQ ID NO: 527+528, SEQ ID NO: 537+538, SEQ ID NO: 547+548, SEQ ID NO: 557+558, SEQ ID NO: 567+568, SEQ ID NO: 577+578, SEQ ID NO: 587+588, SEQ ID NO: 597+598, SEQ ID NO: 607+608, SEQ ID NO: 617+618, SEQ ID NO: 627+628, SEQ ID NO: 637+638, SEQ ID NO: 647+648, SEQ ID NO: 657+658, SEQ ID NO: 667+668, SEQ ID NO: 677+678, SEQ ID NO: 687+688, SEQ ID NO: 697+698, SEQ ID NO: 707+708, SEQ ID NO: 717+718, SEQ ID NO: 727+728, SEQ ID NO: 737+738, SEQ ID NO: 747+748, SEQ ID NO: 757+758, SEQ ID NO: 767+768, SEQ ID NO: 777+778, SEQ ID NO: 787+788, SEQ ID NO: 797+798, SEQ ID NO: 807+808, SEQ ID NO: 817+818, SEQ ID NO: 827+828, SEQ ID NO: 837+838, SEQ ID NO: 847+848, SEQ ID NO: 857+858, SEQ ID NO: 867+868, SEQ ID NO: 877+878, SEQ ID NO: 887+888, SEQ ID NO: 897+898, SEQ ID NO: 907+908, SEQ ID NO: 917+918, SEQ ID NO: 927+928, SEQ ID NO: 937+938, SEQ ID NO: 947+948, SEQ ID NO: 957+958, SEQ ID NO: 967+968, SEQ ID NO: 977+978, and SEQ ID NO: 987+988, particularly SEQ ID Nos: 727+728, 767+568, 757+758, preferably SEQ ID NO: 727+728.


The present invention relates to methods for the treatment and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a leukemia, very particularly AML, wherein the first binding domain of the antibody constructs that may be present in combination products binds to FLT3 and comprises a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 349, SEQ ID NO: 359, SEQ ID NO: 369, SEQ ID NO: 379, SEQ ID NO: 389, SEQ ID NO: 399, SEQ ID NO: 409, SEQ ID NO: 419, SEQ ID NO: 429, SEQ ID NO: 439, SEQ ID NO: 449, SEQ ID NO: 459, SEQ ID NO: 469, SEQ ID NO: 479, SEQ ID NO: 489, SEQ ID NO: 499, SEQ ID NO: 509, SEQ ID NO: 519, SEQ ID NO: 529, SEQ ID NO: 539, SEQ ID NO: 549, SEQ ID NO: 559, SEQ ID NO: 569, SEQ ID NO: 579, SEQ ID NO: 589, SEQ ID NO: 599, SEQ ID NO: 609, SEQ ID NO: 619, SEQ ID NO: 629, SEQ ID NO: 639, SEQ ID NO: 649, SEQ ID NO: 659, SEQ ID NO: 669, SEQ ID NO: 679, SEQ ID NO: 689, SEQ ID NO: 699, SEQ ID NO: 709, SEQ ID NO: 719, SEQ ID NO: 729, SEQ ID NO: 739, SEQ ID NO: 749, SEQ ID NO: 759, SEQ ID NO: 769, SEQ ID NO: 779, SEQ ID NO: 789, SEQ ID NO: 799, SEQ ID NO: 809, SEQ ID NO: 819, SEQ ID NO: 829, SEQ ID NO: 839, SEQ ID NO: 849, SEQ ID NO: 859, SEQ ID NO: 869, SEQ ID NO: 879, SEQ ID NO: 889, SEQ ID NO: 899, SEQ ID NO: 909, SEQ ID NO: 919, SEQ ID NO: 929, SEQ ID NO: 939, SEQ ID NO: 949, SEQ ID NO: 959, SEQ ID NO: 969, SEQ ID NO: 979, and SEQ ID NO: 989 particularly SEQ ID NOS: 729, 759, 569, preferably SEQ ID NO: 729.


Accordingly, the antibody construct, which may be used in methods or which is used in accordance with the present invention, binds to CD3 and FLT3 and may be selected, for example, from the group comprising SEQ ID Nos: 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850, 860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980, and 990.


The above binding domains (which are specified by their CDRs, VH region and VL region and combinations thereof) may also be characterized as binding domains that bind to an epitope of FLT3 which is comprised within the region as depicted in SEQ ID NO: 991 as disclosed in WO2017021362.


The antibody constructs binding to FLT3 as disclosed above are thus intended for use in methods for the treatment and further for the prevention, prophylaxis, treatment or amelioration of a hematological cancer disease or a metastatic cancer disease, particularly of AML or a metastatic cancer disease derived from AML, and are part of combination products, kits, etc., and/or may be used in or administered in steps of the methods according to the present invention, i.e. together with an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling, wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) is administered to a patient in need thereof prior to administration of said antibody construct (a), and wherein said inhibitor/antagonist is administered to prevent or reduce cytokine release syndrome (CRS) or other adverse effects associated with administration of a CD3-binding construct as disclosed throughout the present invention and as set out below.


(i) A method for the treatment and further for the prevention, prophylaxis, amelioraton or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly AML therapy, with an antibody construct comprising at least one domain (also referred to as “first domain”) which binds to a target antigen on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and the preceding information in Sub-Aspect B-2, comprising

    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the first domain binds selectively to human FLT3 (SEQ ID NO: 989).


      (ii) A method for the treatment and further for the prevention, prophylaxis, amelioraton or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly AML therapy, with an antibody construct comprising at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and embodiment (i) of Sub-Aspect B-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises the following CDRs of the VH chain and/or VL chain respectively, wherein the CDRs are selected from the group comprising the VH-CDR1, VH-CDR2, VH-CDR3, VL-CDR1, VL-CDR2, and VL-CDR3 regions depicted in SEQ ID Nos: SEQ ID NOs: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


      (iii) A method for the treatment and further for the prevention, prophylaxis, amelioraton or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly AML therapy, with an antibody construct comprising at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xvi) of general Aspect A) and embodiments (i) or (ii) of Sub-Aspect B-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct comprises the following CDRs of the VH chain and/or VL chain respectively, wherein the CDRs are selected from the group comprising the VH-CDR1, VH-CDR2, VH-CDR3, VL-CDR1, VL-CDR2, and VL-CDR3 regions depicted in SEQ ID Nos: SEQ ID NOs: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


      (iv) A method for the treatment and further for the prevention, prophylaxis, amelioraton or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly AML therapy, with an antibody construct comprising at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xvi) of general Aspect A) and embodiments (i) to (iii) of Sub-Aspect B-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises the following CDRs of the VH chain and/or VL chain respectively, wherein the CDRs are selected from the group comprising the VH-CDR1, VH-CDR2, VH-CDR3, VL-CDR1, VL-CDR2, and VL-CDR3 regions depicted in SEQ ID Nos: SEQ ID NOs: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


      (v) A method for the treatment and further for the prevention, prophylaxis, amelioraton or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly AML therapy, with an antibody construct comprising at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xvi) of general Aspect A) and embodiments (i) to (iv) of Sub-Aspect B-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct comprises the following CDRs of the VH chain and/or VL chain respectively, wherein the CDRs are selected from the group comprising the VH-CDR1, VH-CDR2, VH-CDR3, VL-CDR1, VL-CDR2, and VL-CDR3 regions depicted in SEQ ID Nos: SEQ ID NOs: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


      (vi) A method for the treatment and further for the prevention, prophylaxis, amelioraton or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly AML therapy, with an antibody construct comprising at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xvi) of general Aspect A) and embodiments (i) to (v) of Sub-Aspect B-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to FLT3 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from those depicted in: SEQ ID NOs: 344-346, SEQ ID NOs: 354-356, SEQ ID NOs: 364-366, SEQ ID NOs: 374-376, SEQ ID NOs: 384-386, SEQ ID NOs: 394-396, SEQ ID NOs: 404-406, SEQ ID NOs: 414-416, SEQ ID NOs: 424-426, SEQ ID NOs: 434-436, SEQ ID NOs: 444-446, SEQ ID NOs: 454-456, SEQ ID NOs: 464-466, SEQ ID NOs: 474-476, SEQ ID NOs: 484-486, SEQ ID NOs: 494-496, SEQ ID NOs: 504-506, SEQ ID NOs: 514-516, SEQ ID NOs: 524-526, SEQ ID NOs: 534-536, SEQ ID NOs: 544-546, SEQ ID NOs: 554-556, SEQ ID NOs: 564-566, SEQ ID NOs: 574-576, SEQ ID NOs: 584-586, SEQ ID NOs: 594-596, SEQ ID NOs: 604-606, SEQ ID NOs: 614-616, SEQ ID NOs: 624-626, SEQ ID NOs: 634-636, SEQ ID NOs: 644-646, SEQ ID NOs: 654-656, SEQ ID NOs: 664-666, SEQ ID NOs: 674-676, SEQ ID NOs: 684-686, SEQ ID NOs: 694-696, SEQ ID NOs: 704-706, SEQ ID NOs: 714-716, SEQ ID NOs: 724-726, SEQ ID NOs: 734-736, SEQ ID NOs: 744-746, SEQ ID NOs: 754-756, SEQ ID NOs: 764-766, SEQ ID NOs: 774-776, SEQ ID NOs: 784-786, SEQ ID NOs: 794-796, SEQ ID NOs: 804-806, SEQ ID NOs: 814-816, SEQ ID NOs: 824-826, SEQ ID NOs: 834-836, SEQ ID NOs: 844-846, SEQ ID NOs: 854-856, SEQ ID NOs: 864-866, SEQ ID NOs: 874-876, SEQ ID NOs: 884-886, SEQ ID NOs: 894-896, SEQ ID NOs: 904-906, SEQ ID NOs: 914-916, SEQ ID NOs: 924-926, SEQ ID NOs: 934-936, SEQ ID NOs: 944-946, SEQ ID NOs: 954-956, SEQ ID NOs: 964-966, SEQ ID NOs: 974-976, SEQ ID NOs: 984-986, particularly SEQ ID Nos: 564-566, SEQ ID Nos: 754-756, SEQ ID NOs: 724-726, and preferably SEQ ID NOs: 724-726.


      (vii) A method for the treatment and further for the prevention, prophylaxis, amelioraton or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly AML therapy, with an antibody construct comprising at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xvi) of general Aspect A) and embodiments (i) to (vi) of Sub-Aspect B-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to FLT3 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from those depicted in: SEQ ID NOs: 341-343; SEQ ID NOs: 351-353, SEQ ID NOs: 361-363, SEQ ID NOs: 371-373, SEQ ID NOs: 381-383, SEQ ID NOs: 391-393, SEQ ID NOs: 401-403, SEQ ID NOs: 411-413, SEQ ID NOs: 421-423, SEQ ID NOs: 431-433, SEQ ID NOs: 441-443, SEQ ID NOs: 451-453, SEQ ID NOs: 461-463, SEQ ID NOs: 471-473, SEQ ID NOs: 481-483, SEQ ID NOs: 491-493, SEQ ID NOs: 501-503, SEQ ID NOs: 511-513, SEQ ID NOs: 521-523, SEQ ID NOs: 531-533, SEQ ID NOs: 541-543, SEQ ID NOs: 551-553, SEQ ID NOs: 561-563, SEQ ID NOs: 571-573, SEQ ID NOs: 581-583, SEQ ID NOs: 591-593, SEQ ID NOs: 601-603, SEQ ID NOs: 611-613, SEQ ID NOs: 621-623, SEQ ID NOs: 631-633, SEQ ID NOs: 641-643, SEQ ID NOs: 651-653, SEQ ID NOs: 661-663, SEQ ID NOs: 671-673, SEQ ID NOs: 681-683, SEQ ID NOs: 691-693, SEQ ID NOs: 701-703, SEQ ID NOs: 711-713, SEQ ID NOs: 721-723, SEQ ID NOs: 731-733, SEQ ID NOs: 741-743, SEQ ID NOs: 751-753, SEQ ID NOs: 761-763, SEQ ID NOs: 771-773, SEQ ID NOs: 781-783, SEQ ID NOs: 791-793, SEQ ID NOs: 801-803, SEQ ID NOs: 811-813, SEQ ID NOs: 821-823, SEQ ID NOs: 831-833, SEQ ID NOs: 841-843, SEQ ID NOs: 851-853, SEQ ID NOs: 861-863, SEQ ID NOs: 871-873, SEQ ID NOs: 881-883, SEQ ID NOs: 891-896, SEQ ID NOs: 901-903, SEQ ID NOs: 911-913, SEQ ID NOs: 921-923, SEQ ID NOs: 931-933, SEQ ID NOs: 941-943, SEQ ID NOs: 951-953, SEQ ID NOs: 961-963, SEQ ID NOs: 971-973, SEQ ID NOs: 981-983, particularly SEQ ID Nos: 561-563, SEQ ID Nos: 751-753, SEQ ID NOs: 721-723, and preferably SEQ ID NOs: 721-723.


      (viii) A method for the treatment and further for the prevention, prophylaxis, amelioraton or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly AML therapy, with an antibody construct comprising at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xvi) of general Aspect A) and embodiments (i) to (vii) of Sub-Aspect B-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to FLT3 comprises a VL region selected from the group of VL regions as depicted in any one of SEQ ID NO: 348, SEQ ID NO: 358, SEQ ID NO: 368, SEQ ID NO: 378, SEQ ID NO: 388, SEQ ID NO: 398, SEQ ID NO: 407+408, SEQ ID NO: 418, SEQ ID NO: 428, SEQ ID NO: 438, SEQ ID NO: 448, SEQ ID NO: 458, SEQ ID NO: 468, SEQ ID NO: 478, SEQ ID NO: 488, SEQ ID NO: 498, SEQ ID NO: 508, SEQ ID NO: 518, SEQ ID NO: 528, SEQ ID NO: 538, SEQ ID NO: 548, SEQ ID NO: 558, SEQ ID NO: 568, SEQ ID NO: 578, SEQ ID NO: 588, SEQ ID NO: 598, SEQ ID NO: 608, SEQ ID NO: 618, SEQ ID NO: 628, SEQ ID NO: 638, SEQ ID NO: 648, SEQ ID NO: 658, SEQ ID NO: 668, SEQ ID NO: 678, SEQ ID NO: 688, SEQ ID NO: 698, SEQ ID NO: 708, SEQ ID NO: 718, SEQ ID NO: 728, SEQ ID NO: 738, SEQ ID NO: 748, SEQ ID NO: 758, SEQ ID NO: 768, SEQ ID NO: 778, SEQ ID NO: 788, SEQ ID NO: 798, SEQ ID NO: 808, SEQ ID NO: 818, SEQ ID NO: 828, SEQ ID NO: 838, SEQ ID NO: 848, SEQ ID NO: 858, SEQ ID NO: 868, SEQ ID NO: 878, SEQ ID NO: 888, SEQ ID NO: 898, SEQ ID NO: 908, SEQ ID NO: 918, SEQ ID NO: 928, SEQ ID NO: 938, SEQ ID NO: 948, SEQ ID NO: 958, SEQ ID NO: 968, SEQ ID NO: 978, particularly SEQ ID Nos: 728, 568, 758, preferably SEQ ID NO: 728.


      (ix) A method for the treatment and further for the prevention, prophylaxis, amelioraton or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly AML therapy, with an antibody construct comprising at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xvi) of general Aspect A) and embodiment (viii) of Sub-Aspect B-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to FLT3 comprises a VH region selected from the group consisting of a VH region as depicted in any one of SEQ ID NO: 347, SEQ ID NO: 357, SEQ ID NO: 367, SEQ ID NO: 377, SEQ ID NO: 387, SEQ ID NO: 397, SEQ ID NO: 407, SEQ ID NO: 417, SEQ ID NO: 427, SEQ ID NO: 437, SEQ ID NO: 447, SEQ ID NO: 457, SEQ ID NO: 467, SEQ ID NO: 477, SEQ ID NO: 487, SEQ ID NO: 497, SEQ ID NO: 507, SEQ ID NO: 517, SEQ ID NO: 527, SEQ ID NO: 537, SEQ ID NO: 547, SEQ ID NO: 557, SEQ ID NO: 567, SEQ ID NO: 577, SEQ ID NO: 587, SEQ ID NO: 597, SEQ ID NO: 607, SEQ ID NO: 617, SEQ ID NO: 627, SEQ ID NO: 637, SEQ ID NO: 647, SEQ ID NO: 657, SEQ ID NO: 667, SEQ ID NO: 677, SEQ ID NO: 687, SEQ ID NO: 697, SEQ ID NO: 707, SEQ ID NO: 717, SEQ ID NO: 727, SEQ ID NO: 737, SEQ ID NO: 747, SEQ ID NO: 757, SEQ ID NO: 767, SEQ ID NO: 777, SEQ ID NO: 787, SEQ ID NO: 797, SEQ ID NO: 807, SEQ ID NO: 817, SEQ ID NO: 827, SEQ ID NO: 837, SEQ ID NO: 847, SEQ ID NO: 857, SEQ ID NO: 867, SEQ ID NO: 877, SEQ ID NO: 887, SEQ ID NO: 897, SEQ ID NO: 907, SEQ ID NO: 917, SEQ ID NO: 927, SEQ ID NO: 937, SEQ ID NO: 947, SEQ ID NO: 957, SEQ ID NO: 967, SEQ ID NO: 977, particularly SEQ ID Nos: 727, 767, 757, preferably SEQ ID NO: 727.


      (x) A method for the treatment and further for the prevention, prophylaxis, amelioraton or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly AML therapy, with an antibody construct comprising at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xvi) of general Aspect A) and embodiments (i) to (ix) of Sub-Aspect B-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to FLT3 comprises pairs of a VH region and a VL region as depicted in SEQ ID NO: 347+348, SEQ ID NO: 357+358, SEQ ID NO: 367+368, SEQ ID NO: 377+378, SEQ ID NO: 387+388, SEQ ID NO: 397+398, SEQ ID NO: 407+408, SEQ ID NO: 417+418, SEQ ID NO: 427+428, SEQ ID NO: 437+438, SEQ ID NO: 447+448, SEQ ID NO: 457+458, SEQ ID NO: 467+468, SEQ ID NO: 477+478, SEQ ID NO: 487+488, SEQ ID NO: 497+498, SEQ ID NO: 507+508, SEQ ID NO: 517+518, SEQ ID NO: 527+528, SEQ ID NO: 537+538, SEQ ID NO: 547+548, SEQ ID NO: 557+558, SEQ ID NO: 567+568, SEQ ID NO: 577+578, SEQ ID NO: 587+588, SEQ ID NO: 597+598, SEQ ID NO: 607+608, SEQ ID NO: 617+618, SEQ ID NO: 627+628, SEQ ID NO: 637+638, SEQ ID NO: 647+648, SEQ ID NO: 657+658, SEQ ID NO: 667+668, SEQ ID NO: 677+678, SEQ ID NO: 687+688, SEQ ID NO: 697+698, SEQ ID NO: 707+708, SEQ ID NO: 717+718, SEQ ID NO: 727+728, SEQ ID NO: 737+738, SEQ ID NO: 747+748, SEQ ID NO: 757+758, SEQ ID NO: 767+768, SEQ ID NO: 777+778, SEQ ID NO: 787+788, SEQ ID NO: 797+798, SEQ ID NO: 807+808, SEQ ID NO: 817+818, SEQ ID NO: 827+828, SEQ ID NO: 837+838, SEQ ID NO: 847+848, SEQ ID NO: 857+858, SEQ ID NO: 867+868, SEQ ID NO: 877+878, SEQ ID NO: 887+888, SEQ ID NO: 897+898, SEQ ID NO: 907+908, SEQ ID NO: 917+918, SEQ ID NO: 927+928, SEQ ID NO: 937+938, SEQ ID NO: 947+948, SEQ ID NO: 957+958, SEQ ID NO: 967+968, SEQ ID NO: 977+978, and SEQ ID NO: 987+988.


      (xi) A method for the treatment and further for the prevention, prophylaxis, amelioraton or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly AML therapy, with an antibody construct comprising at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xvi) of general Aspect A) and embodiments (i) to (x) of Sub-Aspect B-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to FLT3 comprises a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 349, SEQ ID NO: 359, SEQ ID NO: 369, SEQ ID NO: 379, SEQ ID NO: 389, SEQ ID NO: 399, SEQ ID NO: 409, SEQ ID NO: 419, SEQ ID NO: 429, SEQ ID NO: 439, SEQ ID NO: 449, SEQ ID NO: 459, SEQ ID NO: 469, SEQ ID NO: 479, SEQ ID NO: 489, SEQ ID NO: 499, SEQ ID NO: 509, SEQ ID NO: 519, SEQ ID NO: 529, SEQ ID NO: 539, SEQ ID NO: 549, SEQ ID NO: 559, SEQ ID NO: 569, SEQ ID NO: 579, SEQ ID NO: 589, SEQ ID NO: 599, SEQ ID NO: 609, SEQ ID NO: 619, SEQ ID NO: 629, SEQ ID NO: 639, SEQ ID NO: 649, SEQ ID NO: 659, SEQ ID NO: 669, SEQ ID NO: 679, SEQ ID NO: 689, SEQ ID NO: 699, SEQ ID NO: 709, SEQ ID NO: 719, SEQ ID NO: 729, SEQ ID NO: 739, SEQ ID NO: 749, SEQ ID NO: 759, SEQ ID NO: 769, SEQ ID NO: 779, SEQ ID NO: 789, SEQ ID NO: 799, SEQ ID NO: 809, SEQ ID NO: 819, SEQ ID NO: 829, SEQ ID NO: 839, SEQ ID NO: 849, SEQ ID NO: 859, SEQ ID NO: 869, SEQ ID NO: 879, SEQ ID NO: 889, SEQ ID NO: 899, SEQ ID NO: 909, SEQ ID NO: 919, SEQ ID NO: 929, SEQ ID NO: 939, SEQ ID NO: 949, SEQ ID NO: 959, SEQ ID NO: 969, SEQ ID NO: 979, and SEQ ID NO: 989, particularly SEQ ID NOS: 729, 759, 569, preferably SEQ ID NO: 729.


      (xii) A method for the treatment and further for the prevention, prophylaxis, amelioraton or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly AML therapy, with an antibody construct comprising at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xvi) of general Aspect A) and embodiments (i) to (xi) of Sub-Aspect B-3, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to FLT3 comprises binding to CD3 and FLT3 as used herein may be selected, for example, from the group comprising SEQ ID Nos: 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850, 860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980, and 990.


Sub-Aspect B-4—Immunotherapeutic Methods for the Cancer Treatment and Prevention, Prophylaxis of Immunotherapy-Related Adverse Events Using Constructs Binding PSMA

In accordance with the present invention, methods for the cancer treatment and further for the prevention and/or prophylaxis of cancer immunotherapy-related adverse events are contemplated which relate to antibody constructs binding to CD3 and PSMA comprising those exemplified in WO2017134158, the contents of which are hereby incorporated by reference.


Several markers for prostate cancer have been identified, including e.g. prostate-specific antigen (PSA), the six transmembrane epithelial antigen of the prostate (STEAP) (Hubert et al., PNAS 96 (1999), 14523-14528), the prostate stem cell antigen (PSCA) (Reiter et al., Proc. Nat. Acad. Sci. 95: 1735-1740, 1998) and the prostate-specific membrane antigen (PSMA; PSM) (Israeli et al., Cancer Res. 53 (1993). PSMA was originally defined by the monoclonal antibody (MAb) 7E11 derived from immunization with a partially purified membrane preparation from the lymph node prostatic adenocarcinoma (LNCaP) cell line (Horoszewicz et al., Anticancer Res. 7 (1987), 927-35). A 2.65-kb cDNA fragment encoding the PSMA protein was cloned and subsequently mapped to chromosome 1 1 p1 1.2 (Israeli et al., loc. cit; O'Keefe et al., Biochem. Biophys. Acta 1443 (1998), 1 13-127). Initial analysis of PSMA demonstrated widespread expression within the cells of the prostatic secretory epithelium. Immunohistochemical staining demonstrated that PSMA was absent to moderately expressed in hyperplastic and benign tissues, while malignant tissues stained with the greatest intensity (Horoszewicz et al., loc. cit.). Consistent with the correlation between PSMA expression and tumor stage, increased levels of PSMA are associated with androgen-independent prostate cancer (PCa). Analysis of tissue samples from patients with prostate cancer has demonstrated elevated PSMA levels after physical castration or androgen-deprivation therapy. Unlike expression of prostate specific antigen, which is downregulated after androgen ablation, PSMA expression is significantly increased in both primary and metastatic tumor specimens (Kawakami et al., Wright et al., loc. cit.). PSMA is also highly expressed in secondary prostatic tumors and occult metastatic disease. Immunohistochemical analysis has revealed relatively intense and homogeneous expression of PSMA within metastatic lesions localized to lymph nodes, bone, soft tissue, and lungs compared with benign prostatic tissues (Chang et al. (2001), loc. cit.; Murphy et al., Cancer 78 (1996), 809-818; Sweat et al., loc. cit.). PSMA is also expressed in the tumor-associated neovasculature of most solid cancers examined yet is absent in the normal vascular endothelium (Chang et al. (1999), Liu et al., Silver et al., loc. cit.). Although the significance of PSMA expression within the vasculature is unknown, the specificity for tumor-associated endothelium makes PSMA a potential target for the treatment of many forms of malignancy.


The present invention thus relates to methods for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, which comprise antibody constructs having a PSMA binding domain corresponding to PSMA binders, wherein each may be a polypeptide monomer that has an amino acid sequence that is at least 90% identical to, or consists of, a sequence selected from the group from the group consisting of: SEQ ID NO: 17-24 in the sequence listing in WO2017134158, incorporated explicitly be reference. Further, the PSMA binding domain may have an amino acid sequence selected from the group consisting of SEQ ID NOs: 50, 56, 68, 74, 86, 92, 104, 1 10, 122, 128, 140, 146, 158, 164, 176, 182, 194, 200, 212, 218, 230, 236, 248, 254, 266, 272, 284, 290, 302, 308, 320, 335, 350, 365, 380, 395, 410, 425, 440, 455, 470 in the sequence listing disclosed in WO2017134158, which is also incorporated by reference in its entirety.


The methods for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, comprise the administration of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling to a patient prior to administration and optionally also following administration of the herein disclosed antibody constructs binding selectively to PSMA.


It is envisaged for the methods for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, that an antibody construct, which may be used according to the present invention, comprise a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from: CDR-L1 as depicted in SEQ ID NO:997, CDR-L2 as depicted in SEQ ID NO: 998, and CDR-L3 as depicted in SEQ ID NO: 999; CDR-L1 as depicted in SEQ ID NO: 1012, CDR-L2 as depicted in SEQ ID NO: 1013, and CDR-L3 as depicted in SEQ ID NO: 1014; and CDR-L1 as depicted in SEQ ID NO: 1027, CDR-L2 as depicted in SEQ ID NO: 1028, and CDR-L3 as depicted in SEQ ID NO: 1029.


It is envisaged for the methods for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, that an antibody construct, which may be used according to the present invention, comprise a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-H1 as depicted in SEQ ID NO: 994, CDR-H2 as depicted in SEQ ID NO: 995, and CDR-H3 as depicted in SEQ ID NO: 996; CDR-H1 as depicted in SEQ ID NO: 1009, CDR-H2 as depicted in SEQ ID NO: 1010, and CDR-H3 as depicted in SEQ ID NO: 1011, CDR-H1 as depicted in SEQ ID NO: 1024, CDR-H2 as depicted in SEQ ID NO: 1025, and CDR-H3 as depicted in SEQ ID NO: 1026.


It is envisaged for the methods for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, that an antibody construct, which may be used according to the present invention, comprise a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:997, CDR-L2 as depicted in SEQ ID NO: 998, and CDR-L3 as depicted in SEQ ID NO: 999; CDR-L1 as depicted in SEQ ID NO: 1012, CDR-L2 as depicted in SEQ ID NO: 1013, and CDR-L3 as depicted in SEQ ID NO: 1014; and CDR-L1 as depicted in SEQ ID NO: 1027, CDR-L2 as depicted in SEQ ID NO: 1028, and CDR-L3 as depicted in SEQ ID NO: 1029, and CDR-H1 as depicted in SEQ ID NO: 994, CDR-H2 as depicted in SEQ ID NO: 995, and CDR-H3 as depicted in SEQ ID NO: 996; CDR-H1 as depicted in SEQ ID NO: 1009, CDR-H2 as depicted in SEQ ID NO: 1010, and CDR-H3 as depicted in SEQ ID NO: 1011, CDR-H1 as depicted in SEQ ID NO: 1024, CDR-H2 as depicted in SEQ ID NO: 1025, and CDR-H3 as depicted in SEQ ID NO: 1026.


It is envisaged for the methods for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, that an antibody construct, which may be used according to the present invention, comprise a VL region selected from the group of VL regions as depicted in any one of SEQ ID NO: 1001, SEQ ID NO: 1016, and SEQ ID NO: 1031.


It is envisaged for the methods for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, that an antibody construct, which may be used according to the present invention, comprise a VH region selected from the group consisting of a VH region as depicted in any one of SEQ ID NO: 1000, SEQ ID NO: 1015, and SEQ ID NO: 1030.


It is envisaged for the methods for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, that an antibody construct, which may be used according to the present invention, comprise a VL region and a VH region selected from the group consisting of a VL region as depicted in SEQ ID NO: 1001, SEQ ID NO: 1016, or SEQ ID NO: 1031 and a VH region as depicted in SEQ ID NO: SEQ ID NO: 1000, SEQ ID NO: 1015, or SEQ ID NO: 1030.


It is also envisaged for the antibody construct used in the above methods for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, that an antibody construct, which may be used according to the present invention, that the domain which selectively binds to an epitope of PSMA competes with those explicitly recited herein, i.e. those characterized by specific SEQ ID Nos.


Whether or not an antibody construct binds to the same epitope of PSMA as another given antibody construct can be measured e.g. by epitope mapping with chimeric or truncated target molecules, e.g. as described herein above and in the Examples in WO2017021362.


Further, whether an antibody construct competes for binding with another given antibody construct can be measured in a competition assay such as a competitive ELISA or a cell-based competition assay. Avidin-coupled microparticles (beads) can also be used. Like an avidin-coated ELISA plate, when reacted with a biotinylated protein, each of these beads can be used as a substrate on which an assay can be performed. Antigen is coated onto a bead and then precoated with the first antibody. The second antibody is added, and any additional binding is determined. Possible means for the read-out includes flow cytometry.


The antibody constructs binding to PSMA as disclosed above are administered in methods for the treatment of cancer and further for the prevention, prophylaxis, or amelioration of a adverse events associated with the treatment of cancer disease using antibody constructs engaging CD3+ T cells as defined herein, particularly of prostate cancer or a metastatic cancer disease derived from prostate cancer, and which may be part of combination products, kits, etc., and/or may be administered in steps of the methods according to the present invention together with an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling, wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling in a patient in need thereof, said inhibitor/antagonist being administered prior to administration of said antibody construct, wherein the patient is preferably a human being or a non-human primate, and wherein said inhibitor/antagonist is administered to prevent or reduce cytokine release syndrome (CRS) and/or tumor lysis syndrome (TLS) or other adverse effects associated with administration of a CD3-binding construct as disclosed throughout the present invention and as set out below:


(i) A method for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, with an antibody construct comprising at least one domain (also referred to as “first domain”) which binds to a target antigen on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), comprising

    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the target antigen is PSMA, and wherein the first domain binds to human PSMA (SEQ ID NO: 993) as disclosed in WO2017134158, more particularly, as disclosed in the sequence listing in WO2017134158, herein preferably those CDRs, VLs, VHs, and antibody constructs shown in SEQ ID Nos: 42 to 474, which selectively bind to PSMA epitopes.


      (ii) The method for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), and embodiment (i) of Sub-Aspect B-4, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that has the following CDRs of the VH chain and/or VL chain respectively: CDR-L1 as depicted in SEQ ID NO:997, CDR-L2 as depicted in SEQ ID NO: 998, and CDR-L3 as depicted in SEQ ID NO: 999; CDR-L1 as depicted in SEQ ID NO: 1012, CDR-L2 as depicted in SEQ ID NO: 1013, and CDR-L3 as depicted in SEQ ID NO: 1014; CDR-L1 as depicted in SEQ ID NO: 1027, CDR-L2 as depicted in SEQ ID NO: 1028, and CDR-L3 as depicted in SEQ ID NO: 1029, and/or CDR-H1 as depicted in SEQ ID NO: 994, CDR-H2 as depicted in SEQ ID NO: 995, and CDR-H3 as depicted in SEQ ID NO: 996; CDR-H1 as depicted in SEQ ID NO: 1009, CDR-H2 as depicted in SEQ ID NO: 1010, and CDR-H3 as depicted in SEQ ID NO: 1011, CDR-H1 as depicted in SEQ ID NO: 1024, CDR-H2 as depicted in SEQ ID NO: 1025, and CDR-H3 as depicted in SEQ ID NO: 1026.


      (iii) The method for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), and embodiments (i) or (ii) of Sub-Aspect B-4, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that has the following CDRs of the VH chain and/or VL chain respectively: CDR-H1 as depicted in SEQ ID NO: 994, CDR-H2 as depicted in SEQ ID NO: 995, and CDR-H3 as depicted in SEQ ID NO: 996; CDR-L1 as depicted in SEQ ID NO:997, CDR-L2 as depicted in SEQ ID NO: 998, and CDR-L3 as depicted in SEQ ID NO: 999; CDR-H1 as depicted in SEQ ID NO: 1009, CDR-H2 as depicted in SEQ ID NO: 1010, and CDR-H3 as depicted in SEQ ID NO: 1011, CDR-L1 as depicted in SEQ ID NO: 1012, CDR-L2 as depicted in SEQ ID NO: 1013, and CDR-L3 as depicted in SEQ ID NO: 1014; and CDR-H1 as depicted in SEQ ID NO: 1024, CDR-H2 as depicted in SEQ ID NO: 1025, and CDR-H3 as depicted in SEQ ID NO: 1026, CDR-L1 as depicted in SEQ ID NO: 1027, CDR-L2 as depicted in SEQ ID NO: 1028, and CDR-L3 as depicted in SEQ ID NO: 1029.


      (iv) The method for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), and embodiments (i) to (iii) of Sub-Aspect B-4, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct has the following CDRs of the VH chain and/or VL chain respectively: CDR-L1 as depicted in SEQ ID NO:997, CDR-L2 as depicted in SEQ ID NO: 998, and CDR-L3 as depicted in SEQ ID NO: 999; CDR-L1 as depicted in SEQ ID NO: 1012, CDR-L2 as depicted in SEQ ID NO: 1013, and CDR-L3 as depicted in SEQ ID NO: 1014; CDR-L1 as depicted in SEQ ID NO: 1027, CDR-L2 as depicted in SEQ ID NO: 1028, and CDR-L3 as depicted in SEQ ID NO: 1029, and/or CDR-H1 as depicted in SEQ ID NO: 994, CDR-H2 as depicted in SEQ ID NO: 995, and CDR-H3 as depicted in SEQ ID NO: 996; CDR-H1 as depicted in SEQ ID NO: 1009, CDR-H2 as depicted in SEQ ID NO: 1010, and CDR-H3 as depicted in SEQ ID NO: 1011, CDR-H1 as depicted in SEQ ID NO: 1024, CDR-H2 as depicted in SEQ ID NO: 1025, and CDR-H3 as depicted in SEQ ID NO: 1026.


      (v) The method for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), and embodiments (i) to (iv) of Sub-Aspect B-4, comprising
    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct has the following CDRs of the VH chain and/or VL chain respectively: CDR-H1 as depicted in SEQ ID NO: 994, CDR-H2 as depicted in SEQ ID NO: 995, and CDR-H3 as depicted in SEQ ID NO: 996; CDR-L1 as depicted in SEQ ID NO:997, CDR-L2 as depicted in SEQ ID NO: 998, and CDR-L3 as depicted in SEQ ID NO: 999; CDR-H1 as depicted in SEQ ID NO: 1009, CDR-H2 as depicted in SEQ ID NO: 1010, and CDR-H3 as depicted in SEQ ID NO: 1011, CDR-L1 as depicted in SEQ ID NO: 1012, CDR-L2 as depicted in SEQ ID NO: 1013, and CDR-L3 as depicted in SEQ ID NO: 1014; and CDR-H1 as depicted in SEQ ID NO: 1024, CDR-H2 as depicted in SEQ ID NO: 1025, and CDR-H3 as depicted in SEQ ID NO: 1026, CDR-L1 as depicted in SEQ ID NO: 1027, CDR-L2 as depicted in SEQ ID NO: 1028, and CDR-L3 as depicted in SEQ ID NO: 1029.


      (vi) The method for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), and embodiments (i) to (v) of Sub-Aspect B-4, comprising administering an antibody construct comprising a VL region selected from the group of VL regions as depicted in any one of SEQ ID NO: 1001, SEQ ID NO: 1016, and SEQ ID NO: 1031.


      (vii) The method for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), and embodiments (i) to (vi) of Sub-Aspect B-4, comprising administering an antibody construct comprising a VH region selected from the group consisting of a VH region as depicted in any one of SEQ ID NO: 1000, SEQ ID NO: 1015, and SEQ ID NO: 1030.


      (viii) The method for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), and embodiments (i) to (vii) of Sub-Aspect B-4, comprising administering an antibody construct comprising a VL region that binds to an epitope that is that is selectively bound by an antibody/antibody construct comprising a VL region selected from the group comprising VL regions as depicted in any one of SEQ ID NO: 1001, SEQ ID NO: 1016, and SEQ ID NO: 1031.


      (ix) The method for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), and embodiments (i) to (viii) of Sub-Aspect B-4, comprising administering an antibody construct comprising a VH region that binds to an epitope that is that is selectively bound by an antibody/antibody construct comprising a VH region selected from the group comprising a VH region as depicted in any one of SEQ ID NO: 1000, SEQ ID NO: 1015, and SEQ ID NO: 1030.


      (x) The method for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), and embodiments (i) to (ix) of Sub-Aspect B-4, comprising administering an antibody construct comprising a VL region and a VH region selected from the group consisting of a VL region as depicted in SEQ ID NO: 1001, SEQ ID NO: 1016, or SEQ ID NO: 1031 and a VH region as depicted in SEQ ID NO: SEQ ID NO: 1000, SEQ ID NO: 1015, or SEQ ID NO: 1030.


      (xi) The method for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), and embodiments (i) to (x) of Sub-Aspect B-4, comprising administering an antibody construct comprising a pair of a VL region and a VH region that binds to an epitope to an epitope that is that is selectively bound by an antibody/antibody construct that is selected from the group consisting of a pair of a VL region as depicted in SEQ ID NO: 1001, SEQ ID NO: 1016, or SEQ ID NO: 1031 and a VH region as depicted in SEQ ID NO: SEQ ID NO: 1000, SEQ ID NO: 1015, or SEQ ID NO: 1030.


      (xii) The method for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), and embodiments (i) to (xi) of Sub-Aspect B-4, comprising
    • (a) administering an antibody construct comprising at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to PSMA comprises a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1002, SEQ ID NO: 1017, and SEQ ID NO: 1032, and/or binds to an epitope selectively bound by a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1002, SEQ ID NO: 1017, and SEQ ID NO: 1032.


      (xiii) The method for the treatment of cancer and further for the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, very particularly prostate cancer or metastatic diseases originating from prostate cancer, more particularly prostate cancer that is characterized by an increased expression of PSMA on the surface of target cells, with an antibody construct comprising at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), and embodiments (i) to (xii) of Sub-Aspect B-4, comprising
    • (a) administering an antibody construct comprising at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the domain which binds to PSMA is comprised by a polypeptide selected from the group comprising antibody constructs depicted in SEQ ID Nos: 1003, 1004, 1005, 1006, 1007, 1008, 1018, 1019, 1020, 1021, 1022, 1023, 1033, 1034, 1035, 1036, 1037, and 1038, and/or binds to an epitope selectively bound by a polypeptide selected from the group comprising antibody constructs depicted in SEQ ID NOs: 1003, 1004, 1005, 1006, 1007, 1008, 1018, 1019, 1020, 1021, 1022, 1023, 1033, 1034, 1035, 1036, 1037, and 1038.


Sub-Aspect B-5—Immunotherapeutic Methods for the Treatment of Cancer and Prevention, Prophylaxis of Immunotherapy-Related Adverse Events Using Constructs Binding DLL3

In accordance with the present invention, antibody constructs binding to CD3 and DLL3 comprise those exemplified in WO2017021349, the contents of which are hereby incorporated by reference are used in methods for treatment of cancer cells that are DLL3+ and further for the prevention, prophylaxis or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy.


As used herein, the DLL3 binding antibody constructs are exemplified by the selective DLL3-binding sequences disclosed explicitly in WO2017021349 and in WO2019200007, both of which are hereby incorporated by reference in their entireties. The protein sequences of different isotypes of DLL3 are shown in SEQ ID Nos: 29 and 30 of WO2017021349, respectively. The DLL3 targeting domains comprise the CDR sequences explicitly disclosed in SEQ ID Nos: 42-69.


The methods according to the present invention, wherein DLL3 is targeted and for which combination products, kits, etc. are envisioned are immunotherapies, wherein the cancer is adrenal, liver, kidney, bladder, breast, gastric, ovarian, cervical, uterine, esophageal, colorectal, prostate (e.g., prostate adenocarcinoma), pancreatic, lung (both small cell and non-small cell), thyroid, carcinomas, sarcomas, glioblastomas, head and neck tumors, large cell neuroendocrine carcinoma (LCNEC), medullary thyroid cancer, glioblastoma, neuroendocrine prostate cancer, (NEPC), high-grade gastroenteropancreatic cancer (GEP) and malignant melanoma, preferably, wherein the cancer is small cell lung cancer.


It is also envisaged for the antibody construct used in methods in accordance with the present invention that the domain which selectively binds to an epitope of DLL3 that it competes with those explicitly recited herein below, i.e. those characterized by specific SEQ ID Nos. Whether or not an antibody construct binds to the same epitope of DLL3 as another given antibody construct can be measured e.g. by epitope mapping with chimeric or truncated target molecules, e.g. as described herein above and in the Examples in WO2017021362. Further, whether an antibody construct competes for binding with another given antibody construct can be measured in a competition assay such as a competitive ELISA or a cell-based competition assay. Avidin-coupled microparticles (beads) can also be used. Like an avidin-coated ELISA plate, when reacted with a biotinylated protein, each of these beads can be used as a substrate on which an assay can be performed. Antigen is coated onto a bead and then precoated with the first antibody. The second antibody is added, and any additional binding is determined. Possible means for the read-out includes flow cytometry.


Further, antibody constructs comprising a binding domain which binds to human DLL3 on the surface of a target cell and a second binding domain which binds to CD3, preferably human CD3, on the surface of a T cell and at least macaque CD3 correspond to those, wherein the first binding domain binds to an epitope of DLL3 which is comprised within the region as depicted in SEQ ID NO: 260 as disclosed in WO2017021349. The antibody constructs may have a binding domain that binds to an epitope of DLL3 which is comprised within the region as depicted in SEQ ID NO: 258 as disclosed in WO2017021349.


The antibody constructs used in the methods of the present invention may have a binding domain that comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3 disclosed in the sequence listing in WO2017021349, which are selected from the group consisting of: CDR-H1 as depicted in SEQ ID NO: 1040, CDR-H2 as depicted in SEQ ID NO: 1041, CDR-H3 as depicted in SEQ ID NO: 1042, CDR-L1 as depicted in SEQ ID NO: 1043, CDR-L2 as depicted in SEQ ID NO: 1044 and CDR-L3 as depicted in SEQ ID NO: 1045; CDR-H1 as depicted in SEQ ID NO: 1046, CDR-H2 as depicted in SEQ ID NO: 1047, CDR-H3 as depicted in SEQ ID NO: 1048, CDR-L1 as depicted in SEQ ID NO: 1049, CDR-L2 as depicted in SEQ ID NO: 1050 and CDR-L3 as depicted in SEQ ID NO: 1051; CDR-H1 as depicted in SEQ ID NO: 1052, CDR-H2 as depicted in SEQ ID NO: 1053, CDR-H3 as depicted in SEQ ID NO: 1054, CDR-L1 as depicted in SEQ ID NO: 1055, CDR-L2 as depicted in SEQ ID NO: 1056 and CDR-L3 as depicted in SEQ ID NO: 1057; CDR-H1 as depicted in SEQ ID NO: 1058, CDR-H2 as depicted in SEQ ID NO: 1059, CDR-H3 as depicted in SEQ ID NO: 1060, CDR-L1 as depicted in SEQ ID NO: 1061, CDR-L2 as depicted in SEQ ID NO: 1062 and CDR-L3 as depicted in SEQ ID NO: 1063; CDR-H1 as depicted in SEQ ID NO: 1064, CDR-H2 as depicted in SEQ ID NO: 1065, CDR-H3 as depicted in SEQ ID NO: 1066, CDR-L1 as depicted in SEQ ID NO: 1067, CDR-L2 as depicted in SEQ ID NO: 1068 and CDR-L3 as depicted in SEQ ID NO: 1069; CDR-H1 as depicted in SEQ ID NO: 1070, CDR-H2 as depicted in SEQ ID NO: 1071, CDR-H3 as depicted in SEQ ID NO: 1072, CDR-L1 as depicted in SEQ ID NO: 1073, CDR-L2 as depicted in SEQ ID NO: 1074 and CDR-L3 as depicted in SEQ ID NO: 1075; CDR-H1 as depicted in SEQ ID NO: 1076, CDR-H2 as depicted in SEQ ID NO: 1077, CDR-H3 as depicted in SEQ ID NO: 1078, CDR-L1 as depicted in SEQ ID NO: 1079, CDR-L2 as depicted in SEQ ID NO: 1080 and CDR-L3 as depicted in SEQ ID NO: 1081; CDR-H1 as depicted in SEQ ID NO: 1082, CDR-H2 as depicted in SEQ ID NO: 1083, CDR-H3 as depicted in SEQ ID NO: 1084, CDR-L1 as depicted in SEQ ID NO: 1085, CDR-L2 as depicted in SEQ ID NO: 1086 and CDR-L3 as depicted in SEQ ID NO: 1087; and CDR-H1 as depicted in SEQ ID NO: 1088, CDR-H2 as depicted in SEQ ID NO: 1089, CDR-H3 as depicted in SEQ ID NO: 1090, CDR-L1 as depicted in SEQ ID NO: 1091, CDR-L2 as depicted in SEQ ID NO: 1092 and CDR-L3 as depicted in SEQ ID NO: 1093.


The antibody constructs used in the methods of the present invention may have a binding domain that comprises a VH region selected from the group consisting of those depicted in SEQ ID NO: 1094, SEQ ID NO: 1095, SEQ ID NO: 1096, SEQ ID NO: 1097, SEQ ID NO: 1098, SEQ ID NO: 1099, SEQ ID NO: 1100, SEQ ID NO: 1101, SEQ ID NO: 1102, SEQ ID NO: 1103 and SEQ ID NO: 1104.


The antibody constructs used in the methods of the present invention may have a binding domain that comprises a VL region selected from the group consisting of those depicted in SEQ ID NO: 1105, SEQ ID NO: 1106, SEQ ID NO: 1107, SEQ ID NO: 1108, SEQ ID NO: 1109, SEQ ID NO: 1110, SEQ ID NO: 1111, SEQ ID NO: 1112, SEQ ID NO: 1113, SEQ ID NO: 1114 and SEQ ID NO: 1115.


The antibody constructs used in the methods of the present invention may have a binding domain that comprises a VH region and a VL region selected from the group consisting of pairs of a VH region and a VL region as depicted in SEQ ID NOs: 1094+1105; SEQ ID NOs: 1095+1106; SEQ ID NOs: 1096+1107; SEQ ID NOs: 1097+1108; SEQ ID NOs: 1098+1109; SEQ ID NOs: 1099+1110; SEQ ID NOs: 1100+1111; SEQ ID NOs: 1101+1112; SEQ ID NOs: 1102+1113; SEQ ID NOs: 1103+1114; and SEQ ID NOs: 1104+1115.


The antibody constructs used in the methods of the present invention may have a binding domain that comprises a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1116, SEQ ID NO: 1117, SEQ ID NO: 1118, SEQ ID NO: 1119, SEQ ID NO: 1120, SEQ ID NO: 1121, SEQ ID NO: 1122, SEQ ID NO: 1123, SEQ ID NO: 1124, SEQ ID NO: 1125 and SEQ ID NO: 1126.


The antibody constructs used in the methods of the present invention may have a binding domain that comprises a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1127, SEQ ID NO: 1128, SEQ ID NO: 1129, SEQ ID NO: 1130, SEQ ID NO: 1131, SEQ ID NO: 1132, SEQ ID NO: 1133, SEQ ID NO: 1134, SEQ ID NO: 1135, SEQ ID NO: 1136, SEQ ID NO: 1137, SEQ ID NO: 1139, SEQ ID NO: 1140, SEQ ID NO: 1141, SEQ ID NO: 1142, SEQ ID NO: 1143, SEQ ID NO: 1144 and SEQ ID NO: 1145.


The antibody constructs used in the methods of the present invention may have a binding domain that binds to an epitope of DLL3 which is comprised within the region as depicted in SEQ ID NO: 1146.


The antibody constructs used in the methods of the present invention may have a binding domain that comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from the group consisting of: CDR-H1 as depicted in SEQ ID NO: 1147, CDR-H2 as depicted in SEQ ID NO: 1148, CDR-H3 as depicted in SEQ ID NO: 1149, CDR-L1 as depicted in SEQ ID NO: 1150, CDR-L2 as depicted in SEQ ID NO: 1151 and CDR-L3 as depicted in SEQ ID NO: 1152; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1154, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1156, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; CDR-H1 as depicted in SEQ ID NO: 1159, CDR-H2 as depicted in SEQ ID NO: 1160, CDR-H3 as depicted in SEQ ID NO: 1161, CDR-L1 as depicted in SEQ ID NO: 1162, CDR-L2 as depicted in SEQ ID NO: 1163 and CDR-L3 as depicted in SEQ ID NO: 1164; CDR-H1 as depicted in SEQ ID NO: 1165, CDR-H2 as depicted in SEQ ID NO: 1166, CDR-H3 as depicted in SEQ ID NO: 1167, CDR-L1 as depicted in SEQ ID NO: 1168, CDR-L2 as depicted in SEQ ID NO: 1169 and CDR-L3 as depicted in SEQ ID NO: 1170; CDR-H1 as depicted in SEQ ID NO: 1171, CDR-H2 as depicted in SEQ ID NO: 1172, CDR-H3 as depicted in SEQ ID NO: 1173, CDR-L1 as depicted in SEQ ID NO: 1174, CDR-L2 as depicted in SEQ ID NO: 1175 and CDR-L3 as depicted in SEQ ID NO: 1176; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1177, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1156, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1178, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1156, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1154, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1179, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1154, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1180, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1154, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1181, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1154, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1182, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1177, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1179, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158; and CDR-H1 as depicted in SEQ ID NO: 1153, CDR-H2 as depicted in SEQ ID NO: 1178, CDR-H3 as depicted in SEQ ID NO: 1155, CDR-L1 as depicted in SEQ ID NO: 1180, CDR-L2 as depicted in SEQ ID NO: 1157 and CDR-L3 as depicted in SEQ ID NO: 1158.


The antibody constructs used in the methods of the present invention may have a binding domain that comprises a VH region selected from the group consisting of those depicted in SEQ ID NO: 1183, SEQ ID NO: 1184, SEQ ID NO: 1185, SEQ ID NO: 1186, SEQ ID NO: 1187, SEQ ID NO: 1188, SEQ ID NO: 1189, SEQ ID NO: 1190, SEQ ID NO: 1191, SEQ ID NO: 1192, SEQ ID NO: 1193, SEQ ID NO: 1194, SEQ ID NO: 1195, SEQ ID NO: 1196, SEQ ID NO: 1197, and SEQ ID NO: 1198.


The antibody constructs used in the methods of the present invention may have a binding domain that comprises a VL region selected from the group consisting of those depicted in SEQ ID NO: 1199, SEQ ID NO: 1200, SEQ ID NO: 1201, SEQ ID NO: 1202, SEQ ID NO: 1203, SEQ ID NO: 1204, SEQ ID NO: 1205, SEQ ID NO: 1206, SEQ ID NO: 1207, SEQ ID NO: 1208, SEQ ID NO: 1209, SEQ ID NO: 1210, SEQ ID NO: 1211, SEQ ID NO: 1212, SEQ ID NO: 1213, SEQ ID NO: 1214, SEQ ID NO: 1215, SEQ ID NO: 1216, SEQ ID NO: 1217, and SEQ ID NO: 1218.


The antibody constructs used in the methods of the present invention may have a binding domain that comprises a VH region and a VL region selected from the group consisting of pairs of a VH region and a VL region as depicted in SEQ ID NOs: 1183+1199; SEQ ID NOs: 1184+1200; SEQ ID NOs: 1185+1201; SEQ ID NOs: 1186+1202; SEQ ID NOs: 1187+1203; SEQ ID NOs 1184+1204; SEQ ID NOs 1184+1205; SEQ ID NOs 1184+12168; SEQ ID NOs 1184+1207; SEQ ID NOs 1184+1208; SEQ ID NOs 1188+1200; SEQ ID NOs 1189+1200; SEQ ID NOs 1190+1200; SEQ ID NOs 1188+1208; SEQ ID NOs 1191+1209; 1192+1210; SEQ ID NOs 1192+1210; SEQ ID NOs 1193+1211; SEQ ID NOs 1193+1212; SEQ ID NOs 1193+1213; SEQ ID NOs 1193+1214; SEQ ID NOs 1193+1215; SEQ ID NOs 1193+1216; SEQ ID NOs 1194+1211; SEQ ID NOs 1195+1211; SEQ ID NOs 1196+1211; SEQ ID NOs 1194+1216; SEQ ID NOs 1197+1217; and SEQ ID NOs 1198+1218.


The antibody constructs used in the methods of the present invention may have a binding domain that comprises a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1219, SEQ ID NO: 1220, SEQ ID NO: 1221, SEQ ID NO: 1222, SEQ ID NO: 1223, SEQ ID NO: 1224, SEQ ID NO: 1225, SEQ ID NO: 1226, SEQ ID NO: 1227, SEQ ID NO: 1228, SEQ ID NO: 1229476, SEQ ID NO: 1230, SEQ ID NO: 1231, SEQ ID NO: 1232, SEQ ID NO: 1233, SEQ ID NO: 1234, SEQ ID NO: 1235, SEQ ID NO: 1236, SEQ ID NO: 1237, SEQ ID NO: 1238, SEQ ID NO: 1239, SEQ ID NO: 1240, SEQ ID NO: 1241, SEQ ID NO: 1242, SEQ ID NO: 1243, SEQ ID NO: 1244, SEQ ID NO: 1245, and SEQ ID NO: 1246.


The antibody constructs used in the methods of the present invention may have a binding domain that comprises a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1247, SEQ ID NO: 1248, SEQ ID NO: 1249, SEQ ID NO: 1250, SEQ ID NO: 1251; SEQ ID NO: 1252, SEQ ID NO: 1253, SEQ ID NO: 1254, SEQ ID NO: 1255, SEQ ID NO: 1256, SEQ ID NO: 1257, SEQ ID NO: 1258, SEQ ID NO: 1259, SEQ ID NO: 1260, SEQ ID NO: 1261, SEQ ID NO: 1262, SEQ ID NO: 1263, SEQ ID NO: 1264, SEQ ID NO: 1265, SEQ ID NO: 1266, SEQ ID NO: 1267, SEQ ID NO: 1268, SEQ ID NO: 1269, SEQ ID NO: 1270, SEQ ID NO: 1271, SEQ ID NO: 1272, SEQ ID NO: 1273, SEQ ID NO: 1274, SEQ ID NO: 1275, SEQ ID NO: 1276, and SEQ ID NO: 1277.


The antibody constructs used in the methods of the present invention may have a binding domain that comprises or consists of a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1278, SEQ ID NO: 1279, SEQ ID NO: 1280, SEQ ID NO: 1281, SEQ ID NO: 1282, SEQ ID NO: 1283, SEQ ID NO: 1284, SEQ ID NO: 1285.


The antibody constructs binding to DLL3 as disclosed above are used in methods for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, particularly of a cancer referred to supra, and may be parts of combination products, kits, etc., and/or may be used in or administered in steps of the methods according to the present invention, i.e. together with an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling, wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is administered to a patient in need thereof prior to administration of said antibody construct, wherein the patient is preferably a human being or a non-human primate, and wherein said inhibitor/antagonist is administered to prevent or reduce cytokine release syndrome (CRS) or other adverse effects associated with administration of a CD3-binding construct as disclosed throughout the present invention and as set out below:


(i) A method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain (also referred to as “first domain”) which binds to a target antigen on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A), comprising

    • (a) at least one antibody construct referred to in the preamble, and
    • (b) an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein the first domain binds selectively to human DLL3.


      (ii) The method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and according to embodiment (i) of Sub-Aspect B-5, comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling, wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for


      administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3, which are selected from the group comprising: a) CDR-H1 as depicted in SEQ ID NO: 1040, CDR-H2 as depicted in SEQ ID NO: 1041, CDR-H3 as depicted in SEQ ID NO: 1042, CDR-L1 as depicted in SEQ ID NO: 1043, CDR-L2 as depicted in SEQ ID NO: 1044 and CDR-L3 as depicted in SEQ ID NO: 1045; b) CDR-H1 as depicted in SEQ ID NO: 1046, CDR-H2 as depicted in SEQ ID NO: 1047, CDR-H3 as depicted in SEQ ID NO: 1048, CDR-L1 as depicted in SEQ ID NO: 1049, CDR-L2 as depicted in SEQ ID NO: 1050 and CDR-L3 as depicted in SEQ ID NO: 1051; c) CDR-H1 as depicted in SEQ ID NO: 1052, CDR-H2 as depicted in SEQ ID NO: 1053, CDR-H3 as depicted in SEQ ID NO: 1054, CDR-L1 as depicted in SEQ ID NO: 1055, CDR-L2 as depicted in SEQ ID NO: 1056 and CDR-L3 as depicted in SEQ ID NO: 1057; d) CDR-H1 as depicted in SEQ ID NO: 1058, CDR-H2 as depicted in SEQ ID NO: 1059, CDR-H3 as depicted in SEQ ID NO: 1060, CDR-L1 as depicted in SEQ ID NO: 1061, CDR-L2 as depicted in SEQ ID NO: 1062 and CDR-L3 as depicted in SEQ ID NO: 1063; e) CDR-H1 as depicted in SEQ ID NO: 1064, CDR-H2 as depicted in SEQ ID NO: 1065, CDR-H3 as depicted in SEQ ID NO: 1066, CDR-L1 as depicted in SEQ ID NO: 1067, CDR-L2 as depicted in SEQ ID NO: 1068 and CDR-L3 as depicted in SEQ ID NO: 1069; f) CDR-H1 as depicted in SEQ ID NO: 1070, CDR-H2 as depicted in SEQ ID NO: 1071, CDR-H3 as depicted in SEQ ID NO: 1072, CDR-L1 as depicted in SEQ ID NO: 1073, CDR-L2 as depicted in SEQ ID NO: 1074 and CDR-L3 as depicted in SEQ ID NO: 1075; g) CDR-H1 as depicted in SEQ ID NO: 1076, CDR-H2 as depicted in SEQ ID NO: 1077, CDR-H3 as depicted in SEQ ID NO: 1078, CDR-L1 as depicted in SEQ ID NO: 1079, CDR-L2 as depicted in SEQ ID NO: 1080 and CDR-L3 as depicted in SEQ ID NO: 1081; h) CDR-H1 as depicted in SEQ ID NO: 1082, CDR-H2 as depicted in SEQ ID NO: 1083, CDR-H3 as depicted in SEQ ID NO: 1084, CDR-L1 as depicted in SEQ ID NO: 1085, CDR-L2 as depicted in SEQ ID NO: 1086 and CDR-L3 as depicted in SEQ ID NO: 1087; and i) CDR-H1 as depicted in SEQ ID NO: 1088, CDR-H2 as depicted in SEQ ID NO: 1089, CDR-H3 as depicted in SEQ ID NO: 1090, CDR-L1 as depicted in SEQ ID NO: 1091, CDR-L2 as depicted in SEQ ID NO: 1092 and CDR-L3 as depicted in SEQ ID NO: 1093.


      (iii) The method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and according to embodiments (i) or (ii) of Sub-Aspect B-5, comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a VH region selected from the group comprising those depicted in SEQ ID NO: 1094, SEQ ID NO: 1095, SEQ ID NO: 1096, SEQ ID NO: 1097, SEQ ID NO: 1098, SEQ ID NO: 1099, SEQ ID NO: 1100, SEQ ID NO: 1101, SEQ ID NO: 1102, SEQ ID NO: 1103 and SEQ ID NO: 1104.


      (iv) The method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and according to embodiments (i) to (iii) of Sub-Aspect B-5, comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a VL region selected from the group comprising those depicted in SEQ ID NO: 1105, SEQ ID NO: 1106, SEQ ID NO: 1107, SEQ ID NO: 1108, SEQ ID NO: 1109, SEQ ID NO: 1110, SEQ ID NO: 1111, SEQ ID NO: 1112, SEQ ID NO: 1113, SEQ ID NO: 1114 and SEQ ID NO: 1115.


      (v) The method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and according to embodiments (i) to (iv) of Sub-Aspect B-5, comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a pair of a VH region and a VL region selected from the group consisting of pairs of a VH region and a VL region as depicted in SEQ ID NOs: 1094+1105; SEQ ID NOs: 1095+1106; SEQ ID NOs: 1096+1107; SEQ ID NOs: 1097+1108; SEQ ID NOs: 1098+1109; SEQ ID NOs: 1099+1110; SEQ ID NOs: 1100+1111; SEQ ID NOs: 1101+1112; SEQ ID NOs: 1102+1113; SEQ ID NOs: 1103+1114; and SEQ ID NOs: 1104+1115.


      (vi) The method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and according to embodiments (i) to (v) of Sub-Aspect B-5, comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1116, SEQ ID NO: 1117, SEQ ID NO: 1118, SEQ ID NO: 1119, SEQ ID NO: 1120, SEQ ID NO: 1121, SEQ ID NO: 1122, SEQ ID NO: 1123, SEQ ID NO: 1124, SEQ ID NO: 1125 and SEQ ID NO: 1126.


      (vii) The method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and according to embodiments (i) to (vi) of Sub-Aspect B-5, comprising
    • a) administering at least one antibody construct referred to in the preamble, and
    • b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1127, SEQ ID NO: 1128, SEQ ID NO: 1129, SEQ ID NO: 1130, SEQ ID NO: 1131, SEQ ID NO: 1132, SEQ ID NO: 1133, SEQ ID NO: 1134, SEQ ID NO: 1135, SEQ ID NO: 1136, SEQ ID NO: 1137, SEQ ID NO: 1139, SEQ ID NO: 1140, SEQ ID NO: 1141, SEQ ID NO: 1142, SEQ ID NO: 1143, and SEQ ID NO: 1144.


      (viii) The method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and according to embodiments (i) to (vii) of Sub-Aspect B-5, comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a polypeptide binding domain that binds to an epitope of DLL3 which is comprised within the region as depicted in SEQ ID NO: 1145.


      (ix) The method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and according to embodiments (i) to (iv) of Sub-Aspect B-5, comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a polypeptide binding domain that comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from the group consisting of: a) CDR-H1 as depicted in SEQ ID NO: 1146, CDR-H2 as depicted in SEQ ID NO: 1147, CDR-H3 as depicted in SEQ ID NO: 1148, CDR-L1 as depicted in SEQ ID NO: 1149, CDR-L2 as depicted in SEQ ID NO: 1150 and CDR-L3 as depicted in SEQ ID NO: 1151; b) CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1153, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1155, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; c) CDR-H1 as depicted in SEQ ID NO: 1158, CDR-H2 as depicted in SEQ ID NO: 1159, CDR-H3 as depicted in SEQ ID NO: 1160, CDR-L1 as depicted in SEQ ID NO: 1161, CDR-L2 as depicted in SEQ ID NO: 1162 and CDR-L3 as depicted in SEQ ID NO: 1163; d) CDR-H1 as depicted in SEQ ID NO: 1164, CDR-H2 as depicted in SEQ ID NO: 1165, CDR-H3 as depicted in SEQ ID NO: 1166, CDR-L1 as depicted in SEQ ID NO: 1167, CDR-L2 as depicted in SEQ ID NO: 1168 and CDR-L3 as depicted in SEQ ID NO: 1169; e) CDR-H1 as depicted in SEQ ID NO: 1170, CDR-H2 as depicted in SEQ ID NO: 1171, CDR-H3 as depicted in SEQ ID NO: 1172, CDR-L1 as depicted in SEQ ID NO: 1173, CDR-L2 as depicted in SEQ ID NO: 1174 and CDR-L3 as depicted in SEQ ID NO: 1175; f) CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1176, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1155, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; g) CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1177, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1155, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; h) CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1153, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1178, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; i) CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1153, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1179, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; j) CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1153, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1180, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; k) CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1153, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1181, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; 1) CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1176, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1178, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157; and m) CDR-H1 as depicted in SEQ ID NO: 1152, CDR-H2 as depicted in SEQ ID NO: 1177, CDR-H3 as depicted in SEQ ID NO: 1154, CDR-L1 as depicted in SEQ ID NO: 1179, CDR-L2 as depicted in SEQ ID NO: 1156 and CDR-L3 as depicted in SEQ ID NO: 1157.


      (x) The method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and according to embodiments (i) to (ix) of Sub-Aspect B-5, comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct comprising a polypeptide a binding domain that comprises a VH region selected from the group consisting of those depicted in SEQ ID NO: 1182, SEQ ID NO: 1183, SEQ ID NO: 1184, SEQ ID NO: 1185, SEQ ID NO: 1186, SEQ ID NO: 1187, SEQ ID NO: 1188, SEQ ID NO: 1189, SEQ ID NO: 1190, SEQ ID NO: 1191, SEQ ID NO: 1192, SEQ ID NO: 1193, SEQ ID NO: 1194, SEQ ID NO: 1195, SEQ ID NO: 1196, and SEQ ID NO: 1197.


      (xi) The method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and according to embodiments (i) to (x) of Sub-Aspect B-5, comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct comprising a polypeptide have a binding domain that comprises a VL region selected from the group consisting of those depicted in SEQ ID NO: 1198, SEQ ID NO: 1199, SEQ ID NO: 1200, SEQ ID NO: 1201, SEQ ID NO: 1202, SEQ ID NO: 1203, SEQ ID NO: 1204, SEQ ID NO: 1205, SEQ ID NO: 1206, SEQ ID NO: 1207, SEQ ID NO: 1208, SEQ ID NO: 1209, SEQ ID NO: 1210, SEQ ID NO: 1211, SEQ ID NO: 1212, SEQ ID NO: 1213, SEQ ID NO: 1214, SEQ ID NO: 1215, SEQ ID NO: 1216, and SEQ ID NO: 1217.


      (xii) The method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and according to embodiments (i) to (xi) of Sub-Aspect B-5, comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct n comprising a polypeptide that comprises a VH region and a VL region selected from the group consisting of pairs of a VH region and a VL region as depicted in SEQ ID NOs: 1182+1198; SEQ ID NOs: 1183+1199; SEQ ID NOs: 1184+1200; SEQ ID NOs: 1185+1201; SEQ ID NOs: 1186+1202; SEQ ID NOs 1183+1203; SEQ ID NOs 1183+1204; SEQ ID NOs 1183+1206; SEQ ID NOs 1183+1206; SEQ ID NOs 1183+1207; SEQ ID NOs 1187+1199; SEQ ID NOs 1188+1199; SEQ ID NOs 1189+1199; SEQ ID NOs 1187+1207; SEQ ID NOs 1190+1208; 1191+1209; SEQ ID NOs 1191+1209; SEQ ID NOs 1192+1210; SEQ ID NOs 1192+1211; SEQ ID NOs 1192+1212; SEQ ID NOs 1192+1213; SEQ ID NOs 1192+1214; SEQ ID NOs 1192+1215; SEQ ID NOs 1193+1210; SEQ ID NOs 1194+1210; SEQ ID NOs 1195+1210; SEQ ID NOs 1193+1215; SEQ ID NOs 1196+1216; and SEQ ID NOs 1197+1217.


      (xiii) The method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and according to embodiments (i) to (xii) of Sub-Aspect B-5, comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1218, SEQ ID NO: 1219, SEQ ID NO: 1220, SEQ ID NO: 1221, SEQ ID NO: 1222, SEQ ID NO: 1223, SEQ ID NO: 1224, SEQ ID NO: 1225, SEQ ID NO: 1226, SEQ ID NO: 1227, SEQ ID NO: 1228, SEQ ID NO: 1229, SEQ ID NO: 1230, SEQ ID NO: 1231, SEQ ID NO: 1232, SEQ ID NO: 1233, SEQ ID NO: 1234, SEQ ID NO: 1235, SEQ ID NO: 1236, SEQ ID NO: 1237, SEQ ID NO: 1238, SEQ ID NO: 1239, SEQ ID NO: 1240, SEQ ID NO: 1241, SEQ ID NO: 1242, SEQ ID NO: 1243, SEQ ID NO: 1244, and SEQ ID NO: 1245.


      (xiv) The method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and according to embodiments (i) to (xiii) of Sub-Aspect B-5, comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct comprising a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1246, SEQ ID NO: 1247, SEQ ID NO: 1248, SEQ ID NO: 1249, SEQ ID NO: 1250; SEQ ID NO: 1251, SEQ ID NO: 1252, SEQ ID NO: 1253, SEQ ID NO: 1254, SEQ ID NO: 1255, SEQ ID NO: 1256, SEQ ID NO: 1257, SEQ ID NO: 1258, SEQ ID NO: 1259, SEQ ID NO: 1260, SEQ ID NO: 1261, SEQ ID NO: 1262, SEQ ID NO: 1263, SEQ ID NO: 1264, SEQ ID NO: 1265, SEQ ID NO: 1266, SEQ ID NO: 1267, SEQ ID NO: 1268, SEQ ID NO: 1269, SEQ ID NO: 1270, SEQ ID NO: 1271, SEQ ID NO: 1272, SEQ ID NO: 1273, SEQ ID NO: 1274, SEQ ID NO: 1275, and SEQ ID NO: 1276.


      (xv) The method for the treatment of DLL3+ positive cancers and further for the prevention, prophylaxis, or amelioration of adverse events associated with immunotherapy, wherein the cancer is selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing, with an antibody construct comprising at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell according to any one of embodiments (i) to (xiv) of general Aspect A) and according to embodiments (i) to (xiv) of Sub-Aspect B-5, comprising
    • (a) administering at least one antibody construct referred to in the preamble, and
    • (b) administering an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling,


      wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling referred to in (b) is for administration to a patient prior to and optionally also following administration of said antibody construct referred to in (a), wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that comprises a binding domain comprising binding domain comprising or consisting of a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 1277, SEQ ID NO: 1278, SEQ ID NO: 1279, SEQ ID NO: 1280, SEQ ID NO: 1281, SEQ ID NO: 1282, SEQ ID NO: 1283, SEQ ID NO: 1284.


Aspect C)—Kits

The present invention relates also to a kit comprising a combination product as defined in any of the preceding embodiments (i) to (xiv) of general Aspect A), or according to any of the embodiments of any of the foregoing Sub-Aspects A-1 to A-5, in a package, wherein the combination product is present in a single container, or the components of said combination product are present individually, said kit optionally also further comprising at least one of a group comprising instructions for use, a device for administration of said combination product or a component thereof, at least one separately packed medium for reconstitution, a pharmaceutical carrier for at least one of said combination products or components thereof.


Aspect D)—Products for Use in Preventive, Prophylactic, Therapeutic Methods

The present invention relates also to an antibody construct, which may be part of a combination product as defined in any of the preceding embodiments (i) to (xiv) of general Aspect A) or according to any of the embodiments of any of the foregoing Sub-Aspects A-1 to A-5, for the use in a method of preventing, prophylaxis, therapeutic treatment, amelioration or alleviation of cancer, further particularly of adverse events associated with immunotherapy, very particularly of cancer immunotherapy according to any of the methods as defined explicitly in Aspect B, particularly in Sub-Aspects B-1 to B5, which comprise an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) of Aspect A), wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is for the prevention of CRS in a patient suffering from a neoplastic disease, and wherein said inhibitor/antagonists is for administration prior to and optionally also following administration of an immunotherapeutic antibody construct as defined herein.


The present invention relates also to the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling which may be part of a combination product as defined in any of the preceding embodiments (i) to (xiv) of general Aspect A) or according to any of the embodiments of any of the foregoing Sub-Aspects A-1 to A-5, for the use in a method of treatment of cancer and particularly for preventing, prophylaxis, amelioration or alleviation of adverse events associated with immunotherapy, very particularly of cancer immunotherapy according to any of the methods as defined explicitly in Aspect B, particularly in Sub-Aspects B-1 to B5, particularly for use in the prevention or prophylaxis of CRS in a patient suffering from a neoplastic disease as defined in the preceding embodiment, and/or wherein said patient is at risk of developing CRS.


The present invention relates also to the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling which may be part of a combination product as defined in any of the preceding embodiments (i) to (xiv) of general Aspect A) or according to any of the embodiments of any of the foregoing Sub-Aspects A-1 to A-5, for the use in a method of treatment of cancer and particularly for preventing, prophylaxis, amelioration or alleviation of adverse events associated with immunotherapy, very particularly of cancer immunotherapy according to any of the methods as defined explicitly in Aspect B, particularly in Sub-Aspects B-1 to B5, particularly for use in the prevention of CRS in a patient suffering from a neoplastic disease who is at risk of developing CRS as defined in the preceding embodiments, wherein said patient is a person subjected to therapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell as defined in any of the foregoing embodiments, wherein the target antigen is selected from the group as defined supra, i.e. comprising the antigens CD19, CD33, FLT3, PSMA, and DLL3.


Aspect E)—Second Medical Uses

The present invention relates also to the use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) of general Aspect A), and in each and any of the Sub-Aspects A-1 to A-5, and/or in each and any one of Aspect B, particularly in Sub-Aspects B-1 to B-5, for the preparation of a medicament for the treatment or prevention of CRS in a patient suffering from a neoplastic disease, particularly in a patient suffering from a neoplastic disease who is treated with an antibody construct as defined above, i.e. patient is a person subjected to therapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell as defined in any of the foregoing embodiments, wherein the target antigen is selected from the group as defined supra, i.e. comprising the antigens CD19, CD33, FLT3, PSMA, and DLL3.


Aspect F)—Dosing

The present invention relates also to a method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the treatment of cancer and particularly for the prevention or prophylaxis, the amelioration and alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, very particularly wherein the adverse event is CRS or TLS, in accordance with any of the methods as defined explicitly in Aspect B, particularly in Sub-Aspects B-1 to B5, in a patient suffering from a neoplastic disease and who is at risk of CRS as defined in the preceding embodiments, wherein said patient is a person subjected to therapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell as defined in any of the foregoing embodiments, wherein a first dose of said inhibitor is administered before administration of a first dose of said antibody construct and optionally also following administration of said first dose.


The present invention relates also to a method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the treatment of cancer and particularly for the prevention or prophylaxis, the amelioration and alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, very particularly wherein the adverse event is CRS or TLS, in accordance with any of the methods as defined explicitly in Aspect B, particularly in Sub-Aspects B-1 to B5, in a patient suffering from a neoplastic disease and who is at risk of CRS as defined in the preceding embodiments, wherein said patient is a person subjected to therapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell as defined in any of the foregoing embodiments, wherein a first dose of said inhibitor is administered before administration of a first dose of said antibody construct and optionally also following administration of said first dose, and wherein said antibody construct binds to a target selected from the group comprising CD19, CD33, FLT3, PSMA, and DLL3.


Sub-Aspect F-1—Dosing of an TNF/TNFR Inhibitor/Antagonist Together with Antibody Constructs Binding CD19


The present invention relates also to a method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer and for the prevention of adverse events associated with immunotherapy, particularly of cancer immunotherapy, very particularly wherein the adverse event is CRS, in accordance with any of the methods as defined explicitly in Aspect B, particularly in Sub-Aspect B-1, in a patient suffering from a neoplastic disease, particularly of a blood cancer, such as a leukemia, particularly of ALL, and who is at risk of CRS as defined in the preceding embodiments, wherein said patient is a person subjected to therapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell as defined in any of the foregoing embodiments, wherein a first dose of said inhibitor is administered before administration of a first dose of said antibody construct, and wherein said antibody construct binds CD19.


The present invention relates also to a method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer and for the prevention, prophylaxis, alleviation or reduction of adverse events associated with immunotherapy, particularly of cancer immunotherapy, very particularly wherein the adverse event is CRS, in accordance with any of the methods as defined explicitly in Aspect B, particularly in Sub-Aspect B-1, in a patient suffering from a neoplastic disease, particularly of a blood cancer, such as a leukemia, particularly of ALL, and who is at risk of CRS as defined in the preceding embodiments, wherein said patient is a person subjected to therapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell as defined in any of the foregoing embodiments, wherein a first dose of said inhibitor is administered before administration of a first dose of said antibody construct and optionally also after administration of said first dose or any other dose, and wherein said antibody construct binds CD19, wherein the method may be further defined as in the following embodiments:


(i) A method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer and for the prevention, prophylaxis, alleviation or reduction of adverse events associated with immunotherapy, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, wherein said method comprises the steps:

    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell, wherein a first dose of said inhibitor is administered before administration of a first dose of said antibody construct.


      (ii) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to embodiment (i), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a cancer disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS.


      (iii) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) and (ii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a cancer disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein at least one further dose, for example a second dose, of said inhibitor is administered before administration of said antibody construct.


      (iv) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (iii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a cancer disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein a further dose of said inhibitor is administered following administration of said antibody construct.


      (v) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (iv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct.


      (vi) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (v), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct,


      wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 7 days prior to administration of the antibody construct.


      (vii) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (vi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 6 days prior to administration of the antibody construct.


      (viii) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (vii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 5 days prior to administration of the antibody construct.


      (ix) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (viii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 4 days prior to administration of the antibody construct.


      (x) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly ALL, according to any one of embodiments (i) to (ix), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 3 days prior to administration of the antibody construct.


      (xi) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (x), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 2 days prior to administration of the antibody construct.


      (xii) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 1 day prior to administration of the antibody construct.


      (xiii) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 60 minutes to 1 day prior to administration of the antibody construct.


      (xiv) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least on further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a second period, for example within a second period before administration of the antibody construct, wherein said period is shorter than the first period of administration of the inhibitor.


      (xv) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xiv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a second period ranging from 30 minutes to 5 days prior to administration of the antibody construct.


      (xvi) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiments, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 4 days prior to administration of the antibody construct.


      (xvii) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xvi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 3 days prior to administration of the antibody construct.


      (xviii) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xvii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 2 days prior to administration of the antibody construct.


      (xix) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xviii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 1 day prior to administration of the antibody construct.


      (xx) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xix), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose and at least one further dose of said inhibitor comprise different quantities of inhibitor and/or different quantities of the antibody construct.


      (xxi) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xx), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose and at least one further dose of said inhibitor comprise identical quantities of inhibitor and/or identical quantities of the antibody construct.


      (xxii) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xxi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 7 days following a first administration of a dose of said antibody construct.


      (xxiii) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xxii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiments, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 6 days following a first administration of a dose of said antibody construct.


      (xxiv) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xxiii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiments, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 5 days following a first administration of a dose of said antibody construct.


      (xxv) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xxiv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 4 days following a first administration of a dose of said antibody construct.


      (xxvi) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xxv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiments, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 3 days following a first administration of a dose of said antibody construct.


      (xxvii) The method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the immunotherapeutic treatment of cancer, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly of ALL, according to any one of embodiments (i) to (xxvi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNF-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD19 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiments, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 2 days following a first administration of a dose of said antibody construct.


      (xxviii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly ALL, and for the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, according to any one of embodiments (i) to (xxvii), wherein the domain of the antibody construct used in accordance with the present invention that which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3, wherein CDR-L1 is depicted in SEQ ID NO:314, CDR-L2 is depicted in SEQ ID NO: 315, and CDR-L3 is depicted in SEQ ID NO: 316.


      (xxix) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly ALL, and for the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, according to any one of embodiments (i) to (xxviii), wherein the domain which binds to CD19 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


      (xxx) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly ALL, and for the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy according to any one of embodiments (i) to (xxviii), wherein the domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


      (xxxi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly ALL, and for the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy according to any one of embodiments (i) to (xxx), wherein the domain which binds to CD19 comprises a VL region as depicted in SEQ ID NO: 309.


      (xxxii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly ALL, and for the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy according to any one of embodiments (i) to (xxxi), wherein the domain which binds to CD19 comprises a VH region as depicted in SEQ ID NO: 308.


      (xxxiii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly ALL, and for the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy according to any one of embodiments (i) to (xxxii), wherein the domain which binds to CD19 comprises a VL region and a VH region consisting of a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308.


      (xxxiv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly ALL, and for the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy according to any one of embodiments (i) to (xxxiii), wherein a domain which binds to CD19 comprises a VL region and a VH region consisting of a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308, or with an antibody construct having a domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


      (xxxv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly ALL, and for the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy according to any one of embodiments (i) to (xxxiv), wherein the domain that is part of an antibody construct which binds to CD19 competes for binding to an epitope of CD19 with an antibody construct that binds to CD19, wherein said competing antibody construct that binds to CD19 may have VL and/or VH regions that differ in their amino acid sequence(s) from the said antibody constructs as defined in the preceding embodiments, when both, the competing antibody constructs and the antibody constructs as defined in the preceding embodiments are co-incubated in a competition assay with target cells that express CD19, wherein both, competition antibody construct and antibody constructs as defined in the preceding embodiments are used at equimolar concentrations in such competition assays, wherein the competition antibody construct may be labelled and the antibody constructs as defined in the preceding embodiments may be unlabeled or differently labelled to permit a quantification to be able to distinguish the number of competition antibody construct bound to the target antigen at the end of the competition assay method, and/or wherein the amount/number of competition antibody construct that binds under such circumstances to the target is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, preferably at least 95% of all antibody constructs selectively binding to the target antigen, and/or wherein the competition antibody construct may comprise one or more, e.g. at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or even more amino acid residues that are different from the antibody constructs as defined in the preceding embodiments.


      (xxxvi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly ALL, and for the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy according to any one of embodiments (i) to (xxxv), wherein the competing antibody constructs have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more amino acid residues that are different from the herein described antibody constructs that are characterized by a domain which binds to CD19 comprising a VL region and a VH region consisting of a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308, or with an antibody construct having a domain which binds to CD19 that comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, such as leukemia and/or lymphoma, particularly ALL, and for the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, according to any one of embodiments (i) to (xxxvi), wherein an antibody construct is administered that comprises at least one domain (also referred to as “first domain”) which binds to CD19 on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as defined in Sub-Aspect B-1.


(xxxvii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (xxxvii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in Sub-Aspect B-1, wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that has the VH chain and/or VL chain respectively, that are disclosed in WO2010052014, particularly in the sequence listing, which is hereby incorporated by reference.


(xxxviii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (xxxviii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in Sub-Aspect B-1, wherein the domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3, wherein CDR-L1 is depicted in SEQ ID NO:314, CDR-L2 is depicted in SEQ ID NO: 315, and CDR-L3 is depicted in SEQ ID NO: 316.


Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (xxxix), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in Sub-Aspect B-1, wherein the domain which binds to CD19 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313. Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (xl), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in Sub-Aspect B-1, wherein the domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313. Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (xli), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in Sub-Aspect B-1, wherein the domain which binds to CD19 comprises a VL region as depicted in SEQ ID NO: 309.


(xxxix) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (xlii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in Sub-Aspect B-1, wherein the domain which binds to CD19 comprises a VH region as depicted in SEQ ID NO: 308.


(xl) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (xliii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in Sub-Aspect B-1, wherein the domain which binds to CD19 comprises a VL region and a VH region consisting a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308.


(xli) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (xliv), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL), wherein an antibody construct is administered that comprises at least one domain which binds to CD19 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in Sub-Aspect B-1, wherein the first domain which binds to CD19 competes for binding to CD19 with an antibody construct in accordance with the present invention that is characterized by a domain which binds to CD19 comprising a VL region and a VH region consisting a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308, or with an antibody construct having a domain which binds to CD19 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 310, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313; and CDR-L1 as depicted in SEQ ID NO:314, CDR-L2 as depicted in SEQ ID NO: 315, and CDR-L3 as depicted in SEQ ID NO: 316, CDR-H1 as depicted in SEQ ID NO: 311, CDR-H2 as depicted in SEQ ID NO: 312, and CDR-H3 as depicted in SEQ ID NO: 313.


(xlii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, wherein the adverse event associated with immunotherapy is increased cytokine release of TNF, IL-1, MCP-1, and/or IL-6, particularly wherein the adverse event is cytokine release syndrome (CRS) or tumor lysis syndrome (TLS), wherein the adverse events may also include a neurological reaction, selected from the group comprising confusion, ataxia, disorientation, dysphasia, aphasia, speech impairment, cerebellar symptoms, tremor, apraxia, seizure, grand mal convulsion, palsy, and balance disorder.


(xliii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL) according to any one of embodiments (i) to (xlvi), wherein the second domain of said antibody construct binds to CD3, preferably human CD3, epsilon and to Callithrix jacchus or Saimiri sciureus CD3 epsilon.


(xliv) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL) according to any one of embodiments (i) to (xlvii), wherein

    • (a) the antibody construct is a single chain antibody construct,
    • (b) the first domain is in the format of an scFv,
    • (c) the second domain is in the format of an scFv,
    • (d) the first and the second domain are connected via a linker, and/or
    • (e) the antibody construct comprises a domain providing an extended serum half-life.


      (xlv) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL) according to any one of embodiments (i) to (xlviii), wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group comprising small molecules, biological molecules, antibodies and derivatives thereof, aptamers, and the like.


      (xlvi) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia or lymphoma, particularly of acute lymphoblastic leukemia (ALL) according to any one of embodiments (i) to (xlix), wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group of TNF inhibitors comprising etanercept, infliximab, adalimumab, certolizumab Pergol, and golimumab, particularly etanercept.


      (xlvii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (l), particularly for administration to a patient at risk of developing adverse events or having an intolerance to at least one of a group comprising corticosteroids, IL-6-inhibitors, IL-6R-inhibitors, and/or TNF/TNFR inhibitors different from an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling according to any of the preceding embodiments.


      (xlviii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (li), particularly for administration to a patient at risk of developing adverse events or having an intolerance to corticosteroids, wherein the corticosteroid is dexamethasone.


      (xlix) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (lii), particularly for administration to a patient at risk of developing adverse events or having an intolerance to IL-6-antagonists and/or IL-6R-antagonists, wherein the IL-6-antagonists and/or IL-6R-antagonists are selected from the group comprising tocilizumab, siltuximab, olokizumab, elsilimomab, clazakizumab, sirukumab, particularly tocilizumab, and/or wherein said combination product is for administration to a patient at risk of developing adverse events or having an intolerance to TNF/TNFR inhibitors, wherein the TNF/TNFR inhibitor is selected from the group comprising infliximab, adalimumab, certolizumab Pergol, and/or golimumab.


      (l) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (liii), further comprising administering at least one corticosteroid, particularly wherein said corticostoid is dexamethasone.


      (li) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (liv), further comprising administering an IL-6R-antagonist, wherein said IL-6R-antagonist is tocilizumab.


      (lii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (lv), further comprising administering at least one corticosteroid, particularly dexamethasone and/or at least one IL-6 and/or IL-6R-antagonist, particularly tocilizumab, wherein said at least one corticosteroid and/or said IL-6 and/or IL-6R-antagonist is for administration to a patient in need thereof prior to, concomitant with, and/or after administration of said antibody construct.


      (liii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (lvi), further comprising administering the antibody construct as defined in any of the above embodiments, or administering a composition for the use of any one of the preceding embodiments that comprises the antibody construct as defined in the preceding embodiments of Sections Sub-Aspect A1, Sub-Aspect B1, i.e. relating to antibody constructs selectively binding CD19, wherein a first dose of the antibody construct or a composition as defined in any of the above embodiments is administered for a first period of time and consecutively a second dose of the composition is administered for a second period of time, wherein the second dose exceeds the first dose.


      (liv) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (lvii), further comprising administering the antibody construct as defined in any of the above embodiments, or administering a composition for the use of any one of the preceding embodiments that comprises the antibody construct as defined in the preceding embodiments of Sections Sub-Aspect A1, Sub-Aspect B1, i.e. relating to antibody constructs selectively binding CD19, wherein a first dose of the antibody construct or a composition as defined in any of the above embodiments is administered for a first period of time, wherein said first dose is between 1 and 15 μg/m2/d, 5, 10 or 15 μg/m2/d being preferred.


      (1v) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (lix), further comprising administering the antibody construct as defined in any of the above embodiments, or administering a composition for the use of any one of the preceding embodiments that comprises the antibody construct as defined in the preceding embodiments of Sections Sub-Aspect A1, Sub-Aspect B1, i.e. relating to antibody constructs selectively binding CD19, wherein a first dose of the antibody construct or a composition as defined in any of the above embodiments is administered for a first period of time, and consecutively a second dose of the composition is administered for a second period of time, wherein said second dose is between 15 and 60 μg/m2/d, 60 μg/m2/d being preferred.


      (lvi) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (lix), further comprising administering the antibody construct as defined in any of the above embodiments, or administering a composition for the use of any one of the preceding embodiments that comprises the antibody construct as defined in the preceding embodiments of Sections Sub-Aspect A1, Sub-Aspect B1, i.e. relating to antibody constructs selectively binding CD19, wherein a first dose of construct is administered, further comprising administering after a first and second dose for a first and second period of time a third dose of the construct for a third period of time.


      (lvii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (liv), further comprising administering the antibody construct as defined in any of the above embodiments, or administering a composition for the use of any one of the preceding embodiments that comprises the antibody construct as defined in the preceding embodiments of Sections Sub-Aspect A1, Sub-Aspect B1, i.e. relating to antibody constructs selectively binding CD19, wherein the third period of time exceeds the first and second period of time, whereby the second dose exceeds said first dose.


      (lviii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (liv), further comprising administering the antibody construct as defined in any of the above embodiments, or administering a composition for the use of any one of the preceding embodiments that comprises the antibody construct as defined in the preceding embodiments of Sections Sub-Aspect A1, Sub-Aspect B1, i.e. relating to antibody constructs selectively binding CD19, wherein the third dose exceeds the first and second dose


      (lix) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (liv), further comprising administering the antibody construct as defined in any of the above embodiments, or administering a composition for the use of any one of the preceding embodiments that comprises the antibody construct as defined in the preceding embodiments of Sections Sub-Aspect A1, Sub-Aspect B1, i.e. relating to antibody constructs selectively binding CD19, wherein said first dose is between 1 and 15 μg/m2/d, 5 μg/m2/d being preferred.


      (lx) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (liv), further comprising administering the antibody construct as defined in any of the above embodiments, or administering a composition for the use of any one of the preceding embodiments that comprises the antibody construct as defined in the preceding embodiments of Sections Sub-Aspect A1, Sub-Aspect B1, i.e. relating to antibody constructs selectively binding CD19, wherein said second dose is between 1 and 15 μg/m2/d, 15 μg/m2/d being preferred.


      (lxi) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (liv), further comprising administering the antibody construct as defined in any of the above embodiments, or administering a composition for the use of any one of the preceding embodiments that comprises the antibody construct as defined in the preceding embodiments of Sections Sub-Aspect A1, Sub-Aspect B1, i.e. relating to antibody constructs selectively binding CD19, wherein said third dose is between 15 and 60 μg/m2/d or 15 and 90 or 120 μg/m2/d, 60 μg/m2/d being preferred.


      (lxii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD19+ target cells according to any one of embodiments (i) to (liv), further comprising administering the antibody construct as defined in any of the above embodiments, or administering a composition for the use of any one of the preceding embodiments that comprises the antibody construct as defined in the preceding embodiments of Sections Sub-Aspect A1, Sub-Aspect B1, i.e. relating to antibody constructs selectively binding CD19, wherein during treatment, the antibody is dosed at a constant dose selected from the group consisting of 5 μg/m2/d, 15 μg/m2/d or 60 μg/m2/d, 60 μg/m2/d being preferred.


      Sub-Aspect F-2—Dosing of an TNF/TNFR Inhibitor/Antagonist Together with Antibody Constructs Binding CD33


The present invention relates also to a method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A in the treatment of cancer, and particularly for the prevention of adverse events associated with immunotherapy, particularly of cancer immunotherapy, very particularly of CRS, in accordance with any of the methods as defined explicitly in Aspect B, particularly in Sub-Aspect B-2, in a patient suffering from a neoplastic disease and who is at risk of CRS as defined in the preceding embodiments, wherein said patient is a person subjected to therapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell as defined in any of the foregoing embodiments, wherein a first dose of said inhibitor is administered before administration of a first dose of said antibody construct, and wherein said antibody construct binds CD33.


It is preferred for this aspect, and for all other aspects of the invention relating to CD33 as target antigen that the neoplastic disease is a myeloid leukemia that is selected from the group consisting of acute myeloblastic leukemia, chronic neutrophilic leukemia, myeloid dendritic cell leukemia, accelerated phase chronic myelogenous leukemia, acute myelomonocytic leukemia, juvenile myelomonocytic leukemia, chronic myelomonocytic leukemia, acute basophilic leukemia, acute eosinophilic leukemia, chronic eosinophilic leukemia, acute megakaryoblastic leukemia, essential thrombocytosis, acute erythroid leukemia, polycythemia vera, myelodysplastic syndrome, acute panmyeloic leukemia, myeloid sarcoma, and acute biphenotypic leukaemia. More preferably, the myeloid leukemia is an acute myeloid leukemia (AML). The definition of AML, inter alia, comprises acute myeloblastic leukemia, acute myeloid dendritic cell leukemia, acute myelomonocytic leukemia, acute basophilic leukemia, acute eosinophilic leukemia, acute megakaryoblastic leukemia, acute erythroid leukemia, and acute panmyeloic leukemia.


The present invention relates to methods/uses of the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A for the prevention of adverse events associated with immunotherapy, particularly of cancer immunotherapy, very particularly of CRS, in accordance with any of the methods as defined explicitly in Aspect B, particularly in Sub-Aspect B-2, in a patient suffering from a neoplastic disease and who is at risk of CRS as defined in the preceding embodiments, wherein said patient is a person subjected to therapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell as defined in any of the foregoing embodiments, wherein a first dose of said inhibitor is administered before administration of a first dose of said antibody construct, and wherein said antibody construct binds CD33, which may be further defined as in the following embodiments:


(i) A method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein said method comprises the steps:

    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein a first dose of said inhibitor is administered before administration of a first dose of said antibody construct.


      (ii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to embodiment (i), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS.


      (iii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to embodiment (i) or (ii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein at least one further dose, preferably a second dose, of said inhibitor is administered before administration of said antibody construct.


      (iv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (iii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein a further dose of said inhibitor is administered following administration of said antibody construct.


      (v) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (iv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct.


      (vi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (v), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly in a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 7 days prior to administration of the antibody construct.


      (vii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (vi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 6 days prior to administration of the antibody construct.


      (viii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (vii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 5 days prior to administration of the antibody construct.


      (ix) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (viii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 4 days prior to administration of the antibody construct.


      (x) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (ix), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 3 days prior to administration of the antibody construct.


      (xi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (x), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 2 days prior to administration of the antibody construct.


      (xii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 1 day prior to administration of the antibody construct.


      (xiii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNF-Receptor reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 60 minutes to 1 day prior to administration of the antibody construct.


      (xiv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xiii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a second period, for example within a second period before administration of the antibody construct, wherein said period is shorter than the first period of administration of the inhibitor.


      (xv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xvi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a second period ranging from 30 minutes to 5 days prior to administration of the antibody construct.


      (xvi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 4 days prior to administration of the antibody construct.


      (xvii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xvi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell, wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 3 days prior to administration of the antibody construct.


      (xviii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xvii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from minutes to 2 days prior to administration of the antibody construct.


      (xix) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xviii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 1 day prior to administration of the antibody construct.


      (xx) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xix), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose and at least one further dose of said inhibitor comprise different quantities of inhibitor and/or different quantities of the antibody construct.


      (xxi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xx), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of INF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose and at least one further dose of said inhibitor comprise identical quantities of inhibitor and/or identical quantities of the antibody construct.


      (xxii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 7 days following a first administration of a dose of said antibody construct.


      (xxiii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 6 days following a first administration of a dose of said antibody construct.


      (xxiv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxiii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 5 days following a first administration of a dose of said antibody construct.


      (xxv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxiv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 4 days following a first administration of a dose of said antibody construct.


      (xxvi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 3 days following a first administration of a dose of said antibody construct.


      (xxvii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxvi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds CD33 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 2 days following a first administration of a dose of said antibody construct.


      (xxviii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxvii), wherein the domain of the antibody construct used in accordance with the present invention that binds to CD33 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from: CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319, which is preferred; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, and CDR-L3 as depicted in SEQ ID NO: 319; and CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319.


      (xxix) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxviii), wherein the domain which binds to CD33 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325, which is preferred; CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325.


      (xxx) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxix), wherein the domain which binds to CD33 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325, which is preferred; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325.


      (xxxi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxx), wherein the domain which binds to CD33 comprises a VL region selected from the group of VL regions depicted in any one of SEQ ID NOs 328, 329, 330, 331, and 332.


      (xxxii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxxi), wherein the domain which binds to CD33 comprises a VH region selected from the group of VH regions depicted in any one of SEQ ID Nos. 333, 334, 335, 336, 337, 338 and 339.


      (xxxiii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxxii), wherein the domain which binds to CD33 comprises a pair comprising a VL region and a VH region selected from the group consisting of a VL region and a VH region as depicted in SEQ ID Nos: 328+333, 328+334, 328+335, 328+336, 328+337, 328+338, 328+339, 329+333, 329+334, 329+335, 329+336, 329+337, 329+338, 329+339, 330+333, 330+334, 330+335, 330+336, 330+337, 330+338, 330+339, 331+333, 331+333, 331+334, 331+335, 331+336, 331+337, 331+338, 331+339, 332+333, 332+334, 332+335, 332+336, 332+337, 332+338, and 332+339.


      (xxxiv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxxiii), wherein a domain which binds to CD33 comprising a VL region and a VH region consisting a VL region as depicted in of SEQ ID NOs 328, 329, 330, 331, and 332, and a VH region as depicted in SEQ ID NO: 333, 334, 335, 336, 337, 338 and 339, or with an antibody construct having a domain which binds to CD33 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from: CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319, which is preferred; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, and CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, and CDR-L3 as depicted in SEQ ID NO: 319; and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325, which is preferred; CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325.


      (xxxv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxxiv), wherein a domain which binds to CD33 competes for binding to an epitope of CD33 with an antibody construct that binds to CD33, wherein said competing antibody construct that binds to CD33 may have VL and/or VH regions that differ in their amino acid sequence(s) from the said antibody constructs as defined in the preceding embodiments, when both, the competing antibody constructs and the antibody constructs as defined in the preceding embodiments are co-incubated in a competition assay with target cells that express CD33, wherein both, competition antibody construct and antibody constructs as defined in the preceding embodiments are used at equimolar concentrations in such competition assays, wherein the competition antibody construct may be labelled and the antibody constructs as defined in the preceding embodiments may be unlabeled or differently labelled to permit a quantification to be able to distinguish the number of competition antibody construct bound to the target antigen at the end of the competition assay method, and/or wherein the amount/number of competition antibody construct that binds under such circumstances to the target is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, preferably at least 95% of all antibody constructs selectively binding to the target antigen, and/or wherein the competition antibody construct may comprise one or more, e.g. at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or even more amino acid residues that are different from the antibody constructs as defined in the preceding embodiments.


      (xxxvi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxxv), wherein the competition antibody constructs have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more amino acid residues that are different from the herein described antibody constructs that are characterized by a domain which binds to CD33 comprising a VL region and a VH region consisting of a VL region as depicted in any one of SEQ ID NOs 328, 329, 330, 331, and 332 and a VH region as depicted in any one of SEQ ID Nos. 333, 334, 335, 336, 337, 338 and 339, or with an antibody construct having a domain which binds to CD33 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from the group of pairs comprising SEQ ID NOs: 328+333, 328+334, 328+335, 328+336, 328+337, 328+338, 328+339, 329+333, 329+334, 329+335, 329+336, 329+337, 329+338, 329+339, 330+333, 330+334, 330+335, 330+336, 330+337, 330+338, 330+339, 331+333, 331+333, 331+334, 331+335, 331+336, 331+337, 331+338, 331+339, 332+333, 332+334, 332+335, 332+336, 332+337, 332+338, and 332+339.


      (xxxvii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells according to any one of embodiments (i) to (xxxvi), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein an antibody construct is administered that comprises at least one domain (also referred to as “first domain”) which binds to CD33 on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as defined in Sub-Aspect B-2.


The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells according to any one of embodiments (i) to (xxxvii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein an antibody construct is administered that comprises at least one domain which binds to CD33 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in Sub-Aspect B-2, wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that has the VH chain and/or VL chain respectively, that are disclosed in WO2010052014, particularly in the sequence listing, which is hereby incorporated by reference. Further, the present invention relates to the method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells according to any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein an antibody construct is administered that comprises at least one domain which binds to CD33 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiments (i) to (iii) of Sub-Aspect B-2, wherein the domain which binds to CD33 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from the group comprising: CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, which is preferred; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319.


(xxxviii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells according to any one of any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein an antibody construct is administered that comprises at least one domain which binds to CD33 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in embodiments of Sub-Aspect B-2, wherein the domain which binds to CD33 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from the group comprising: CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325, which is preferred; CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325.


(xxxix) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells according to any one of any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein an antibody construct is administered that comprises at least one domain which binds to CD33 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiments of Sub-Aspect B-2, wherein the domain which binds to CD33 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325, which is preferred; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 324, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323, CDR-H2 as depicted in SEQ ID NO: 326, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 320, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 317, CDR-L2 as depicted in SEQ ID NO: 321, CDR-L3 as depicted in SEQ ID NO: 319; and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325; CDR-L1 as depicted in SEQ ID NO: 322, CDR-L2 as depicted in SEQ ID NO: 318, CDR-L3 as depicted in SEQ ID NO: 319, and CDR-H1 as depicted in SEQ ID NO: 323; CDR-H2 as depicted in SEQ ID NO: 327, and CDR-H3 as depicted in SEQ ID NO: 325.


(xl) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, more particularly of CD33+ target cells according to any one of any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein the adverse event associated with immunotherapy is increased cytokine release of TNF, MCP-1, and/or IL-6, particularly wherein the adverse event is cytokine release syndrome (CRS), wherein the adverse events may also include a neurological reaction, selected from the group comprising confusion, ataxia, disorientation, dysphasia, aphasia, speech impairment, cerebellar symptoms, tremor, apraxia, seizure, grand mal convulsion, palsy, and balance disorder.


(xli) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells according to any one of any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein the second domain of said antibody construct binds to CD3, preferably human CD3, epsilon and to Callithrix jacchus or Saimiri sciureus CD3 epsilon.


(xlii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells according to any one of any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein

    • (a) the antibody construct is a single chain antibody construct,
    • (b) the first domain is in the format of an scFv,
    • (c) the second domain is in the format of an scFv,
    • (d) the first and the second domain are connected via a linker, and/or
    • (e) the antibody construct comprises a domain providing an extended serum half-life.


      (xliii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells according to any one of any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group comprising small molecules, biological molecules, antibodies and derivatives thereof, aptamers, and the like.


      (xliv) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of CD33+ target cells according to any one of any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group of TNF inhibitors comprising etanercept, infliximab, adalimumab, certolizumab Pergol, and golimumab, particularly etanercept.


      (xlv) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly in a cancer immunotherapy, more particularly immunotherapy of CD33+ target cells according to any one of any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, comprising the administration to a patient at risk of developing adverse events or having an intolerance to at least one of a group comprising corticosteroids, IL-6-inhibitors, IL-6R-inhibitors, and/or TNF/TNFR inhibitors different from an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling according to any of the preceding embodiments.


      (xlvi) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly in a cancer immunotherapy, more particularly immunotherapy of CD33+ target cells according to any one of any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of any one of the preceding embodiments, for a patient at risk of developing adverse events or having an intolerance to corticosteroids, particularly wherein the corticosteroid is dexamethasone.


      (xlvii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly in a cancer immunotherapy, more particularly immunotherapy of CD33+ target cells according to any one of any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, for administration for a patient at risk of developing adverse events or having an intolerance to IL-6-antagonists and/or IL-6R-antagonists, wherein the IL-6-antagonists and/or IL-6R-antagonists are selected from the group comprising tocilizumab, siltuximab, olokizumab, elsilimomab, clazakizumab, sirukumab, particularly tocilizumab, and/or wherein said combination product is for administration to a patient at risk of developing adverse events or having an intolerance to TNF/TNFR inhibitors, wherein the TNF/TNFR inhibitor is selected from the group comprising infliximab, adalimumab, certolizumab Pergol, and/or golimumab.


      (xlviii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly in a cancer immunotherapy, more particularly immunotherapy of CD33+ target cells according to any one of any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, for administration for a patient at risk of developing adverse events or having an intolerance to IL-6-antagonists and/or IL-6R-antagonists, further comprising administering at least one corticosteroid, particularly wherein said corticostoid is dexamethasone.


      (xlix) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly in a cancer immunotherapy, more particularly immunotherapy of CD33+ target cells according to any one of any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of any one of the preceding embodiments, for a patient at risk of developing adverse events or having an intolerance to corticosteroids, particularly wherein the corticosteroid is dexamethasone, further comprising administering an IL-6R-antagonist, particularly wherein said IL-6R-antagonist is tocilizumab.


      (l) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly in a cancer immunotherapy, more particularly immunotherapy of CD33+ target cells according to any one of any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to the preceding embodiments, further comprising administering at least one corticosteroid, particularly dexamethasone and/or at least one IL-6 and/or IL-6R-antagonist, particularly tocilizumab, wherein said at least one corticosteroid and/or said IL-6 and/or IL-6R-antagonist is for administration to a patient in need thereof prior to, concomitant with, and/or after administration of said antibody construct.


      (li) In preferred embodiments of the any of the above dosing regimens, the antibody constructs correspond to those as defined above, particularly wherein the antibody construct is used in a cancer immunotherapy, more particularly immunotherapy of CD33+ target cells according to any one of any one of the preceding embodiments, further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly of a blood cell-related cancer immunotherapy, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, and wherein the antibody construct is administered according to the dosing schemes as published in WO2020025532, particularly according to the claims as filed, and as disclosed explicitly on pages 3 to 8 of the description, which are incorporated herein by reference, more particularly wherein the antibody construct is administered in at least one of the one or more treatment cycles according to a schedule comprising the following steps:
    • (a) administration of a first dosage of the antibody construct, followed by
    • (b) administration of a second dosage of the antibody construct, wherein said second dosage exceeds said first dose, followed by
    • (c) administration of a third dosage of the antibody construct, wherein said third dosage exceeds said second dosage, optionally also followed by
    • (d) administration of a fourth dosage of the antibody construct, wherein said optional fourth dose exceeds said third dosage.


      (lii) In preferred embodiments of any of the above embodiments relating to dosing regimens, the antibody construct is administered in one treatment cycle of at least 15 days, preferably 15 to 60 days, more preferably 28 to 56 days, preferably 28 days.


      (liii) In preferred embodiments of any of the above dosing regimens, the antibody construct is administered in a first dosage in step (a) is at least μg per day, preferably in the range of 5 to 20 mg per day, more preferably 10 μg per day, the second dosage in step (b) is at least 30 μg per day, preferably in the range of 30 to 240 μg per day, more preferably 60 or 240 mg per day and the third dosage in step (c) and the optional forth dosage in step (d) is at least 240 μs per day, preferably in the range of 240 to 1500 μg per day, preferably in the range of 240 to 960 μg per day, more preferably in the range of 480 to 960 μg per day.


      (liv) In preferred embodiments of any of the above dosing regimens, the period of administration of the first dosage in step (a) is 1 to 4 days, preferably 2 or 3 days, the period of administration of the second dosage in step (b) is 2 to 5 days, preferably 2 or 3 days, and the period of administration of the third dosage in step (c) and the optional forth dosage in step (d) together is 7 to 52 days, preferably 14 to 52 days, more preferably 22, 23 or 52 days.


      (lv) In preferred embodiments of any of the above dosing regimens, the treatment of the myeloid leukemia comprises two or more treatment cycles, preferably two, three, four, five, six or seven treatment cycles, whereof at least one, two, three, four five, six or seven treatment cycles comprise more than 14 days of bispecific antibody construct administration.


      (lvi) In preferred embodiments of any of the above dosing regimens, at least one treatment cycle is followed by the period without administration of the construct, preferably at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 days without treatment.


      (lvii) In preferred embodiments of any of the above dosing regimens, at least one treatment cycle is not followed by the period without administration of the construct.


      (lviii) In preferred embodiments of any of the above dosing regimens, only the first cycle of the treatment comprises the administration according to step (a), whereas the following cycles start with the dose according to step (b).


      (lix) In preferred embodiments of any of the above dosing regimens, the construct is a single chain bispecific antibody construct.


      (lx) In preferred embodiments of any of the above dosing regimens, the first binding domain of the bispecific antibody construct comprises groups of six CDRs selected from the group consisting of SEQ ID NOs: 10 to 12 and 14 to 16, 22 to 24 and 26 to 28, 34 to 36 and 38 to 40, 46 to 48 and 50 to 52, 58 to 60 and 62 to 64, 70 to 72 and 74 to 76, 82 to 84 and 86 to 88, 94 to 96 an 98 to 100, preferably 94 to 96 an 98 to 100 disclosed in WO2020025532.


      (lxi) In preferred embodiments of any of the above dosing regimens, the second binding domain of the bispecific antibody construct comprises groups of six CDRs selected from the group consisting of SEQ ID NOs: 148-153, 154-159, 160-165, 166-171, 172-177, 178-183, 184-189, 190-195, 196-201 and 202-207, preferably 202-207 disclosed in WO2020025532.


      (lxii) In further embodiments of the above dosing regimes, the antibody construct is a single chain construct comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 18, 19, 20, 30, 31, 32, 42, 43, 44, 54, 55, 56, 66, 67, 68, 78, 79, 80, 90, 91, 92, 102, 103, 104, 105, 106, 107 and 108, preferably selected from the group consisting of SEQ ID NOs: 104, 105, 106, 107 and 108, more preferably SEQ ID NO 104 disclosed in WO2020025532.


      Sub-Aspect F-3—Dosing of an TNF/TNFR Inhibitor/Antagonist Together with Antibody Constructs Binding FLT3


The present invention relates also to a method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xvi) in general Aspect A for the treatment of FLT3+ cancers and for the prevention of adverse events associated with immunotherapy, particularly of cancer immunotherapy, very particularly of CRS, in accordance with any of the methods as defined explicitly in Aspect B, particularly in Sub-Aspect B-3, in a patient, particularly a patient who is at risk of CRS as defined in the preceding embodiments, wherein said patient is a person subjected to therapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell as defined in any of the foregoing embodiments, wherein a first dose of said inhibitor is administered before administration of a first dose of said antibody construct, and wherein said antibody construct binds to the target antigen FLT3. Embodiments of respective methods and dosing regimen are set forth below.


(i) A method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia such as AML, wherein said method comprises the steps:

    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell, wherein a first dose of said inhibitor is administered before administration of a first dose of said antibody construct.


      (ii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to embodiment (i), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS.


      (iii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) and (ii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein at least one further dose, particularly a second dose of said inhibitor is administered before administration of said antibody construct.


      (iv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (iii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct.


      (v) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (iv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct.


      (vi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (v), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 7 days prior to administration of the antibody construct.


      (vii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (vi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 6 days prior to administration of the antibody construct.


      (viii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (vii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 5 days prior to administration of the antibody construct.


      (ix) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (viii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 4 days prior to administration of the antibody construct.


      (x) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (ix), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 3 days prior to administration of the antibody construct.


      (xi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (x), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 2 days prior to administration of the antibody construct.


      (xii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient s defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 1 day prior to administration of the antibody construct.


      (xiii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 60 minutes to 1 day prior to administration of the antibody construct.


      (xiv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xiii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a second period, for example within a second period before administration of the antibody construct, wherein said period is shorter than the first period of administration of the inhibitor.


      (xv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xvi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a second period ranging from 30 minutes to 5 days prior to administration of the antibody construct.


      (xvi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 4 days prior to administration of the antibody construct.


      (xvii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xvi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 3 days prior to administration of the antibody construct.


      (xviii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xvii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 2 days prior to administration of the antibody construct.


      (xix) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xviii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 1 day prior to administration of the antibody construct.


      (xx) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xix), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose and at least one further dose of said inhibitor comprise different quantities of inhibitor and/or different quantities of the antibody construct.


      (xxi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xx), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose and at least one further dose of said inhibitor comprise identical quantities of inhibitor and/or identical quantities of the antibody construct.


      (xxii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein said other dose of said inhibitor that is administered following administration of said antibody construct is administered within a period from 1 day to 7 days following a first administration of a dose of said antibody construct.


      (xxiii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein said other dose of said inhibitor that is administered following administration of said antibody construct is administered within a period from 1 day to 6 days following a first administration of a dose of said antibody construct.


      (xxiv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxiii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein said other dose of said inhibitor that is administered following administration of said antibody construct is administered within a period from 1 day to 5 days following a first administration of a dose of said antibody construct.


      (xxv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxiv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein said other dose of said inhibitor that is administered following administration of said antibody construct is administered within a period from 1 day to 4 days following a first administration of a dose of said antibody construct.


      (xxvi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein said other dose of said inhibitor that is administered following administration of said antibody construct is administered within a period from 1 day to 3 days following a first administration of a dose of said antibody construct.


      (xxvii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxvi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds FLT3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein at least one other dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein said other dose of said inhibitor that is administered following administration of said antibody construct is administered within a period from 1 day to 2 days following a first administration of a dose of said antibody construct.


      (xxviii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxvii), wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein the domain of the antibody construct used in accordance with the present invention that which binds to FLT3 comprises a VL region, or wherein the domain comprises VL regions that bind an epitope of FLT3 that is bound by an antibody construct comprising a VL region, comprising the CDR-L-sequences selected from those depicted in: SEQ ID NOs: 344-346, SEQ ID NOs: 354-356, SEQ ID NOs: 364-366, SEQ ID NOs: 374-376, SEQ ID NOs: 384-386, SEQ ID NOs: 394-396, SEQ ID NOs: 404-406, SEQ ID NOs: 414-416, SEQ ID NOs: 424-426, SEQ ID NOs: 434-436, SEQ ID NOs: 444-446, SEQ ID NOs: 454-456, SEQ ID NOs: 464-466, SEQ ID NOs: 474-476, SEQ ID NOs: 484-486, SEQ ID NOs: 494-496, SEQ ID NOs: 504-506, SEQ ID NOs: 514-516, SEQ ID NOs: 524-526, SEQ ID NOs: 534-536, SEQ ID NOs: 544-546, SEQ ID NOs: 554-556, SEQ ID NOs: 564-566, SEQ ID NOs: 574-576, SEQ ID NOs: 584-586, SEQ ID NOs: 594-596, SEQ ID NOs: 604-606, SEQ ID NOs: 614-616, SEQ ID NOs: 624-626, SEQ ID NOs: 634-636, SEQ ID NOs: 644-646, SEQ ID NOs: 654-656, SEQ ID NOs: 664-666, SEQ ID NOs: 674-676, SEQ ID NOs: 684-686, SEQ ID NOs: 694-696, SEQ ID NOs: 704-706, SEQ ID NOs: 714-716, SEQ ID NOs: 724-726, SEQ ID NOs: 734-736, SEQ ID NOs: 744-746, SEQ ID NOs: 754-756, SEQ ID NOs: 764-766, SEQ ID NOs: 774-776, SEQ ID NOs: 784-786, SEQ ID NOs: 794-796, SEQ ID NOs: 804-806, SEQ ID NOs: 814-816, SEQ ID NOs: 824-826, SEQ ID NOs: 834-836, SEQ ID NOs: 844-846, SEQ ID NOs: 854-856, SEQ ID NOs: 864-866, SEQ ID NOs: 874-876, SEQ ID NOs: 884-886, SEQ ID NOs: 894-896, SEQ ID NOs: 904-906, SEQ ID NOs: 914-916, SEQ ID NOs: 924-926, SEQ ID NOs: 934-936, SEQ ID NOs: 944-946, SEQ ID NOs: 954-956, SEQ ID NOs: 964-966, SEQ ID NOs: 974-976, SEQ ID NOs: 984-986, particularly SEQ ID Nos: 564-566, SEQ ID Nos: 754-756, SEQ ID NOs: 724-726, and preferably SEQ ID NOs: 724-726.


      (xxix) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxviii), wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein the domain which binds to FLT3 comprises a VH region, or wherein the domain comprises VH regions that bind an epitope of FLT3 that is bound by an antibody construct comprising a CDR-H-sequences selected from those depicted in: SEQ ID NOs: 341-343; SEQ ID NOs: 351-353, SEQ ID NOs: 361-363, SEQ ID NOs: 371-373, SEQ ID NOs: 381-383, SEQ ID NOs: 391-393, SEQ ID NOs: 401-403, SEQ ID NOs: 411-413, SEQ ID NOs: 421-423, SEQ ID NOs: 431-433, SEQ ID NOs: 441-443, SEQ ID NOs: 451-453, SEQ ID NOs: 461-463, SEQ ID NOs: 471-473, SEQ ID NOs: 481-483, SEQ ID NOs: 491-493, SEQ ID NOs: 501-503, SEQ ID NOs: 511-513, SEQ ID NOs: 521-523, SEQ ID NOs: 531-533, SEQ ID NOs: 541-543, SEQ ID NOs: 551-553, SEQ ID NOs: 561-563, SEQ ID NOs: 571-573, SEQ ID NOs: 581-583, SEQ ID NOs: 591-593, SEQ ID NOs: 601-603, SEQ ID NOs: 611-613, SEQ ID NOs: 621-623, SEQ ID NOs: 631-633, SEQ ID NOs: 641-643, SEQ ID NOs: 651-653, SEQ ID NOs: 661-663, SEQ ID NOs: 671-673, SEQ ID NOs: 681-683, SEQ ID NOs: 691-693, SEQ ID NOs: 701-703, SEQ ID NOs: 711-713, SEQ ID NOs: 721-723, SEQ ID NOs: 731-733, SEQ ID NOs: 741-743, SEQ ID NOs: 751-753, SEQ ID NOs: 761-763, SEQ ID NOs: 771-773, SEQ ID NOs: 781-783, SEQ ID NOs: 791-793, SEQ ID NOs: 801-803, SEQ ID NOs: 811-813, SEQ ID NOs: 821-823, SEQ ID NOs: 831-833, SEQ ID NOs: 841-843, SEQ ID NOs: 851-853, SEQ ID NOs: 861-863, SEQ ID NOs: 871-873, SEQ ID NOs: 881-883, SEQ ID NOs: 891-896, SEQ ID NOs: 901-903, SEQ ID NOs: 911-913, SEQ ID NOs: 921-923, SEQ ID NOs: 931-933, SEQ ID NOs: 941-943, SEQ ID NOs: 951-953, SEQ ID NOs: 961-963, SEQ ID NOs: 971-973, SEQ ID NOs: 981-983, particularly SEQ ID Nos: 561-563, SEQ ID Nos: 751-753, SEQ ID NOs: 721-723, and preferably SEQ ID NOs: 721-723.


      (xxx) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxviii), wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient as defined in the preceding embodiments, particularly a patient who is at risk of developing CRS, wherein the domain which binds to FLT3 comprises a VL region, or binds to an epitope that is bound by a VL region comprising CDR-L1, CDR-L2 and CDR-L3 sequences and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from those depicted in the group comprising:


SEQ ID Nos: SEQ ID NOs: 341-346, SEQ ID NOs: 351-356, SEQ ID NOs: 361-366, SEQ ID NOs: 371-376, SEQ ID NOs: 381-386, SEQ ID NOs: 391-396, SEQ ID NOs: 401-406, SEQ ID NOs: 411-416, SEQ ID NOs: 421-426, SEQ ID NOs: 431-436, SEQ ID NOs: 441-446, SEQ ID NOs: 451-456, SEQ ID NOs: 461-466, SEQ ID NOs: 471-476, SEQ ID NOs: 481-486, SEQ ID NOs: 491-496, SEQ ID NOs: 501-506, SEQ ID NOs: 511-516, SEQ ID NOs: 521-526, SEQ ID NOs: 531-536, SEQ ID NOs: 541-546, SEQ ID NOs: 551-556, SEQ ID NOs: 561-566, SEQ ID NOs: 571-576, SEQ ID NOs: 581-586, SEQ ID NOs: 591-596, SEQ ID NOs: 601-606, SEQ ID NOs: 611-616, SEQ ID NOs: 621-626, SEQ ID NOs: 631-636, SEQ ID NOs: 641-646, SEQ ID NOs: 651-656, SEQ ID NOs: 661-666, SEQ ID NOs: 671-676, SEQ ID NOs: 681-686, SEQ ID NOs: 691-696, SEQ ID NOs: 701-706, SEQ ID NOs: 711-716, SEQ ID NOs: 721-726, SEQ ID NOs: 731-736, SEQ ID NOs: 741-746, SEQ ID NOs: 751-756, SEQ ID NOs: 761-766, SEQ ID NOs: 771-776, SEQ ID NOs: 781-786, SEQ ID NOs: 791-796, SEQ ID NOs: 801-806, SEQ ID NOs: 811-816, SEQ ID NOs: 821-826, SEQ ID NOs: 831-836, SEQ ID NOs: 841-846, SEQ ID NOs: 851-856, SEQ ID NOs: 861-866, SEQ ID NOs: 871-876, SEQ ID NOs: 881-886, SEQ ID NOs: 891-896, SEQ ID NOs: 901-906, SEQ ID NOs: 911-916, SEQ ID NOs: 921-926, SEQ ID NOs: 931-936, SEQ ID NOs: 941-946, SEQ ID NOs: 951-956, SEQ ID NOs: 961-966, SEQ ID NOs: 971-976, SEQ ID NOs: 981-986, particularly SEQ ID Nos: 561-566, SEQ ID Nos: 751-756, SEQ ID NOs: 721-726, and preferably SEQ ID NOs: 721-726.


(xxxi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxx), wherein the domain which binds to FLT3 comprises a VL region, or wherein the domain binds to an epitope that is bound by a VL region, selected from the group of VL regions as depicted in any one of SEQ ID NO: 348, SEQ ID NO: 358, SEQ ID NO: 368, SEQ ID NO: 378, SEQ ID NO: 388, SEQ ID NO: 398, SEQ ID NO: 407+408, SEQ ID NO: 418, SEQ ID NO: 428, SEQ ID NO: 438, SEQ ID NO: 448, SEQ ID NO: 458, SEQ ID NO: 468, SEQ ID NO: 478, SEQ ID NO: 488, SEQ ID NO: 498, SEQ ID NO: 508, SEQ ID NO: 518, SEQ ID NO: 528, SEQ ID NO: 538, SEQ ID NO: 548, SEQ ID NO: 558, SEQ ID NO: 568, SEQ ID NO: 578, SEQ ID NO: 588, SEQ ID NO: 598, SEQ ID NO: 608, SEQ ID NO: 618, SEQ ID NO: 628, SEQ ID NO: 638, SEQ ID NO: 648, SEQ ID NO: 658, SEQ ID NO: 668, SEQ ID NO: 678, SEQ ID NO: 688, SEQ ID NO: 698, SEQ ID NO: 708, SEQ ID NO: 718, SEQ ID NO: 728, SEQ ID NO: 738, SEQ ID NO: 748, SEQ ID NO: 758, SEQ ID NO: 768, SEQ ID NO: 778, SEQ ID NO: 788, SEQ ID NO: 798, SEQ ID NO: 808, SEQ ID NO: 818, SEQ ID NO: 828, SEQ ID NO: 838, SEQ ID NO: 848, SEQ ID NO: 858, SEQ ID NO: 868, SEQ ID NO: 878, SEQ ID NO: 888, SEQ ID NO: 898, SEQ ID NO: 908, SEQ ID NO: 918, SEQ ID NO: 928, SEQ ID NO: 938, SEQ ID NO: 948, SEQ ID NO: 958, SEQ ID NO: 968, SEQ ID NO: 978 particularly SEQ ID Nos: 728, 568, 758, preferably SEQ ID NO: 728.


(xxxii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxxi), wherein the domain which binds to FLT3 comprises a VH region, or wherein the domain binds to an epitope that is bound by a VH region, selected from the group consisting of VH regions as depicted in any one of SEQ ID NO: 347, SEQ ID NO: 357, SEQ ID NO: 367, SEQ ID NO: 377, SEQ ID NO: 387, SEQ ID NO: 397, SEQ ID NO: 407, SEQ ID NO: 417, SEQ ID NO: 427, SEQ ID NO: 437, SEQ ID NO: 447, SEQ ID NO: 457, SEQ ID NO: 467, SEQ ID NO: 477, SEQ ID NO: 487, SEQ ID NO: 497, SEQ ID NO: 507, SEQ ID NO: 517, SEQ ID NO: 527, SEQ ID NO: 537, SEQ ID NO: 547, SEQ ID NO: 557, SEQ ID NO: 567, SEQ ID NO: 577, SEQ ID NO: 587, SEQ ID NO: 597, SEQ ID NO: 607, SEQ ID NO: 617, SEQ ID NO: 627, SEQ ID NO: 637, SEQ ID NO: 647, SEQ ID NO: 657, SEQ ID NO: 667, SEQ ID NO: 677, SEQ ID NO: 687, SEQ ID NO: 697, SEQ ID NO: 707, SEQ ID NO: 717, SEQ ID NO: 727, SEQ ID NO: 737, SEQ ID NO: 747, SEQ ID NO: 757, SEQ ID NO: 767, SEQ ID NO: 777, SEQ ID NO: 787, SEQ ID NO: 797, SEQ ID NO: 807, SEQ ID NO: 817, SEQ ID NO: 827, SEQ ID NO: 837, SEQ ID NO: 847, SEQ ID NO: 857, SEQ ID NO: 867, SEQ ID NO: 877, SEQ ID NO: 887, SEQ ID NO: 897, SEQ ID NO: 907, SEQ ID NO: 917, SEQ ID NO: 927, SEQ ID NO: 937, SEQ ID NO: 947, SEQ ID NO: 957, SEQ ID NO: 967, SEQ ID NO: 977, particularly SEQ ID Nos: 727, 767, 757, preferably SEQ ID NO: 727.


(xxxiii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxxii), wherein the domain which binds to FLT3 comprises a VL region and a VH region, wherein the VL region is selected from the group of sequences depicted in any one of SEQ ID NO: 348, SEQ ID NO: 358, SEQ ID NO: 368, SEQ ID NO: 378, SEQ ID NO: 388, SEQ ID NO: 398, SEQ ID NO: 407+408, SEQ ID NO: 418, SEQ ID NO: 428, SEQ ID NO: 438, SEQ ID NO: 448, SEQ ID NO: 458, SEQ ID NO: 468, SEQ ID NO: 478, SEQ ID NO: 488, SEQ ID NO: 498, SEQ ID NO: 508, SEQ ID NO: 518, SEQ ID NO: 528, SEQ ID NO: 538, SEQ ID NO: 548, SEQ ID NO: 558, SEQ ID NO: 568, SEQ ID NO: 578, SEQ ID NO: 588, SEQ ID NO: 598, SEQ ID NO: 608, SEQ ID NO: 618, SEQ ID NO: 628, SEQ ID NO: 638, SEQ ID NO: 648, SEQ ID NO: 658, SEQ ID NO: 668, SEQ ID NO: 678, SEQ ID NO: 688, SEQ ID NO: 698, SEQ ID NO: 708, SEQ ID NO: 718, SEQ ID NO: 728, SEQ ID NO: 738, SEQ ID NO: 748, SEQ ID NO: 758, SEQ ID NO: 768, SEQ ID NO: 778, SEQ ID NO: 788, SEQ ID NO: 798, SEQ ID NO: 808, SEQ ID NO: 818, SEQ ID NO: 828, SEQ ID NO: 838, SEQ ID NO: 848, SEQ ID NO: 858, SEQ ID NO: 868, SEQ ID NO: 878, SEQ ID NO: 888, SEQ ID NO: 898, SEQ ID NO: 908, SEQ ID NO: 918, SEQ ID NO: 928, SEQ ID NO: 938, SEQ ID NO: 948, SEQ ID NO: 958, SEQ ID NO: 968, SEQ ID NO: 978, particularly SEQ ID Nos: 728, 568, 758, preferably SEQ ID NO: 728, and wherein the VH region is selected from the group of sequences depicted in any one of SEQ ID NO: 347, SEQ ID NO: 357, SEQ ID NO: 367, SEQ ID NO: 377, SEQ ID NO: 387, SEQ ID NO: 397, SEQ ID NO: 407, SEQ ID NO: 417, SEQ ID NO: 427, SEQ ID NO: 437, SEQ ID NO: 447, SEQ ID NO: 457, SEQ ID NO: 467, SEQ ID NO: 477, SEQ ID NO: 487, SEQ ID NO: 497, SEQ ID NO: 507, SEQ ID NO: 517, SEQ ID NO: 527, SEQ ID NO: 537, SEQ ID NO: 547, SEQ ID NO: 557, SEQ ID NO: 567, SEQ ID NO: 577, SEQ ID NO: 587, SEQ ID NO: 597, SEQ ID NO: 607, SEQ ID NO: 617, SEQ ID NO: 627, SEQ ID NO: 637, SEQ ID NO: 647, SEQ ID NO: 657, SEQ ID NO: 667, SEQ ID NO: 677, SEQ ID NO: 687, SEQ ID NO: 697, SEQ ID NO: 707, SEQ ID NO: 717, SEQ ID NO: 727, SEQ ID NO: 737, SEQ ID NO: 747, SEQ ID NO: 757, SEQ ID NO: 767, SEQ ID NO: 777, SEQ ID NO: 787, SEQ ID NO: 797, SEQ ID NO: 807, SEQ ID NO: 817, SEQ ID NO: 827, SEQ ID NO: 837, SEQ ID NO: 847, SEQ ID NO: 857, SEQ ID NO: 867, SEQ ID NO: 877, SEQ ID NO: 887, SEQ ID NO: 897, SEQ ID NO: 907, SEQ ID NO: 917, SEQ ID NO: 927, SEQ ID NO: 937, SEQ ID NO: 947, SEQ ID NO: 957, SEQ ID NO: 967, SEQ ID NO: 977, particularly SEQ ID Nos: 727, 767, 757, preferably SEQ ID NO: 727, or wherein the VL region and the VH region bind to an epitope that is recognized by any of the above depicted VL and VH regions or compete with an antibody construct the comprises such regions.


The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxxiii), wherein the domain which binds to FLT3 comprises a VL region and a VH, wherein the VL region is selected from the group of sequences depicted in any one of SEQ ID NO: 348, SEQ ID NO: 358, SEQ ID NO: 368, SEQ ID NO: 378, SEQ ID NO: 388, SEQ ID NO: 398, SEQ ID NO: 407+408, SEQ ID NO: 418, SEQ ID NO: 428, SEQ ID NO: 438, SEQ ID NO: 448, SEQ ID NO: 458, SEQ ID NO: 468, SEQ ID NO: 478, SEQ ID NO: 488, SEQ ID NO: 498, SEQ ID NO: 508, SEQ ID NO: 518, SEQ ID NO: 528, SEQ ID NO: 538, SEQ ID NO: 548, SEQ ID NO: 558, SEQ ID NO: 568, SEQ ID NO: 578, SEQ ID NO: 588, SEQ ID NO: 598, SEQ ID NO: 608, SEQ ID NO: 618, SEQ ID NO: 628, SEQ ID NO: 638, SEQ ID NO: 648, SEQ ID NO: 658, SEQ ID NO: 668, SEQ ID NO: 678, SEQ ID NO: 688, SEQ ID NO: 698, SEQ ID NO: 708, SEQ ID NO: 718, SEQ ID NO: 728, SEQ ID NO: 738, SEQ ID NO: 748, SEQ ID NO: 758, SEQ ID NO: 768, SEQ ID NO: 778, SEQ ID NO: 788, SEQ ID NO: 798, SEQ ID NO: 808, SEQ ID NO: 818, SEQ ID NO: 828, SEQ ID NO: 838, SEQ ID NO: 848, SEQ ID NO: 858, SEQ ID NO: 868, SEQ ID NO: 878, SEQ ID NO: 888, SEQ ID NO: 898, SEQ ID NO: 908, SEQ ID NO: 918, SEQ ID NO: 928, SEQ ID NO: 938, SEQ ID NO: 948, SEQ ID NO: 958, SEQ ID NO: 968, SEQ ID NO: 978, particularly SEQ ID Nos: 728, 568, 758, preferably SEQ ID NO: 728, wherein the VH region is selected from the group of sequences depicted in any one of SEQ ID NO: 347, SEQ ID NO: 357, SEQ ID NO: 367, SEQ ID NO: 377, SEQ ID NO: 387, SEQ ID NO: 397, SEQ ID NO: 407, SEQ ID NO: 417, SEQ ID NO: 427, SEQ ID NO: 437, SEQ ID NO: 447, SEQ ID NO: 457, SEQ ID NO: 467, SEQ ID NO: 477, SEQ ID NO: 487, SEQ ID NO: 497, SEQ ID NO: 507, SEQ ID NO: 517, SEQ ID NO: 527, SEQ ID NO: 537, SEQ ID NO: 547, SEQ ID NO: 557, SEQ ID NO: 567, SEQ ID NO: 577, SEQ ID NO: 587, SEQ ID NO: 597, SEQ ID NO: 607, SEQ ID NO: 617, SEQ ID NO: 627, SEQ ID NO: 637, SEQ ID NO: 647, SEQ ID NO: 657, SEQ ID NO: 667, SEQ ID NO: 677, SEQ ID NO: 687, SEQ ID NO: 697, SEQ ID NO: 707, SEQ ID NO: 717, SEQ ID NO: 727, SEQ ID NO: 737, SEQ ID NO: 747, SEQ ID NO: 757, SEQ ID NO: 767, SEQ ID NO: 777, SEQ ID NO: 787, SEQ ID NO: 797, SEQ ID NO: 807, SEQ ID NO: 817, SEQ ID NO: 827, SEQ ID NO: 837, SEQ ID NO: 847, SEQ ID NO: 857, SEQ ID NO: 867, SEQ ID NO: 877, SEQ ID NO: 887, SEQ ID NO: 897, SEQ ID NO: 907, SEQ ID NO: 917, SEQ ID NO: 927, SEQ ID NO: 937, SEQ ID NO: 947, SEQ ID NO: 957, SEQ ID NO: 967, SEQ ID NO: 977, particularly SEQ ID Nos: 727, 767, 757, preferably SEQ ID NO: 727, or wherein the antibody construct has a domain which binds to FLT3 that comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from those depicted in: SEQ ID NOs: 344-346, SEQ ID NOs: 354-356, SEQ ID NOs: 364-366, SEQ ID NOs: 374-376, SEQ ID NOs: 384-386, SEQ ID NOs: 394-396, SEQ ID NOs: 404-406, SEQ ID NOs: 414-416, SEQ ID NOs: 424-426, SEQ ID NOs: 434-436, SEQ ID NOs: 444-446, SEQ ID NOs: 454-456, SEQ ID NOs: 464-466, SEQ ID NOs: 474-476, SEQ ID NOs: 484-486, SEQ ID NOs: 494-496, SEQ ID NOs: 504-506, SEQ ID NOs: 514-516, SEQ ID NOs: 524-526, SEQ ID NOs: 534-536, SEQ ID NOs: 544-546, SEQ ID NOs: 554-556, SEQ ID NOs: 564-566, SEQ ID NOs: 574-576, SEQ ID NOs: 584-586, SEQ ID NOs: 594-596, SEQ ID NOs: 604-606, SEQ ID NOs: 614-616, SEQ ID NOs: 624-626, SEQ ID NOs: 634-636, SEQ ID NOs: 644-646, SEQ ID NOs: 654-656, SEQ ID NOs: 664-666, SEQ ID NOs: 674-676, SEQ ID NOs: 684-686, SEQ ID NOs: 694-696, SEQ ID NOs: 704-706, SEQ ID NOs: 714-716, SEQ ID NOs: 724-726, SEQ ID NOs: 734-736, SEQ ID NOs: 744-746, SEQ ID NOs: 754-756, SEQ ID NOs: 764-766, SEQ ID NOs: 774-776, SEQ ID NOs: 784-786, SEQ ID NOs: 794-796, SEQ ID NOs: 804-806, SEQ ID NOs: 814-816, SEQ ID NOs: 824-826, SEQ ID NOs: 834-836, SEQ ID NOs: 844-846, SEQ ID NOs: 854-856, SEQ ID NOs: 864-866, SEQ ID NOs: 874-876, SEQ ID NOs: 884-886, SEQ ID NOs: 894-896, SEQ ID NOs: 904-906, SEQ ID NOs: 914-916, SEQ ID NOs: 924-926, SEQ ID NOs: 934-936, SEQ ID NOs: 944-946, SEQ ID NOs: 954-956, SEQ ID NOs: 964-966, SEQ ID NOs: 974-976, SEQ ID NOs: 984-986, particularly SEQ ID Nos: 564-566, SEQ ID Nos: 754-756, SEQ ID NOs: 724-726, and preferably SEQ ID NOs: 724-726, and wherein the antibody construct has a domain which binds to FLT3 that comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from those depicted in: SEQ ID NOs: 341-343; SEQ ID NOs: 351-353, SEQ ID NOs: 361-363, SEQ ID NOs: 371-373, SEQ ID NOs: 381-383, SEQ ID NOs: 391-393, SEQ ID NOs: 401-403, SEQ ID NOs: 411-413, SEQ ID NOs: 421-423, SEQ ID NOs: 431-433, SEQ ID NOs: 441-443, SEQ ID NOs: 451-453, SEQ ID NOs: 461-463, SEQ ID NOs: 471-473, SEQ ID NOs: 481-483, SEQ ID NOs: 491-493, SEQ ID NOs: 501-503, SEQ ID NOs: 511-513, SEQ ID NOs: 521-523, SEQ ID NOs: 531-533, SEQ ID NOs: 541-543, SEQ ID NOs: 551-553, SEQ ID NOs: 561-563, SEQ ID NOs: 571-573, SEQ ID NOs: 581-583, SEQ ID NOs: 591-593, SEQ ID NOs: 601-603, SEQ ID NOs: 611-613, SEQ ID NOs: 621-623, SEQ ID NOs: 631-633, SEQ ID NOs: 641-643, SEQ ID NOs: 651-653, SEQ ID NOs: 661-663, SEQ ID NOs: 671-673, SEQ ID NOs: 681-683, SEQ ID NOs: 691-693, SEQ ID NOs: 701-703, SEQ ID NOs: 711-713, SEQ ID NOs: 721-723, SEQ ID NOs: 731-733, SEQ ID NOs: 741-743, SEQ ID NOs: 751-753, SEQ ID NOs: 761-763, SEQ ID NOs: 771-773, SEQ ID NOs: 781-783, SEQ ID NOs: 791-793, SEQ ID NOs: 801-803, SEQ ID NOs: 811-813, SEQ ID NOs: 821-823, SEQ ID NOs: 831-833, SEQ ID NOs: 841-843, SEQ ID NOs: 851-853, SEQ ID NOs: 861-863, SEQ ID NOs: 871-873, SEQ ID NOs: 881-883, SEQ ID NOs: 891-896, SEQ ID NOs: 901-903, SEQ ID NOs: 911-913, SEQ ID NOs: 921-923, SEQ ID NOs: 931-933, SEQ ID NOs: 941-943, SEQ ID NOs: 951-953, SEQ ID NOs: 961-963, SEQ ID NOs: 971-973, SEQ ID NOs: 981-983, particularly SEQ ID Nos: 561-563, SEQ ID Nos: 751-753, SEQ ID NOs: 721-723, and preferably SEQ ID NOs: 721-723; or wherein the VL region and the VH region bind to an epitope that is selectively bound by any of the above depicted sequences.


(xxxiv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxxiv), wherein a domain which binds to FLT3 competes for binding to an epitope of FLT3 with an antibody construct that binds to FLT3, wherein said competing antibody construct that binds to FLT3 may have VL and/or VH regions that differ in their amino acid sequence(s) from the said antibody constructs as defined in the preceding embodiments, when both, the competing antibody constructs and the antibody constructs as defined in the preceding embodiments are co-incubated in a competition assay with target cells that express FLT3, wherein both, competition antibody construct and antibody constructs as defined in the preceding embodiments are used at equimolar concentrations in such competition assays, wherein the competition antibody construct may be labelled, and the antibody constructs as defined in the preceding embodiments may be unlabeled or differently labelled to permit a quantification to be able to distinguish the number of competition antibody construct bound to the target antigen at the end of the competition assay method, and/or wherein the amount/number of competition antibody construct that binds under such circumstances to the target is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, preferably at least 95% of all antibody constructs selectively binding to the target antigen, and/or wherein the competition antibody construct may comprise one or more, e.g. at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or even more amino acid residues that are different from the antibody constructs as defined in the preceding embodiments.


(xxxv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, according to any one of embodiments (i) to (xxxv), wherein the competition antibody constructs have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more amino acid residues that are different from the herein described antibody constructs that are characterized by a domain which binds to FLT3 comprising a VL region and a VH region comprising CDR-LL CDR-L2 and CDR-L3 sequences and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 sequences selected from: SEQ ID NOs: 341-343; SEQ ID NOs: 351-353, SEQ ID NOs: 361-363, SEQ ID NOs: 371-373, SEQ ID NOs: 381-383, SEQ ID NOs: 391-393, SEQ ID NOs: 401-403, SEQ ID NOs: 411-413, SEQ ID NOs: 421-423, SEQ ID NOs: 431-433, SEQ ID NOs: 441-443, SEQ ID NOs: 451-453, SEQ ID NOs: 461-463, SEQ ID NOs: 471-473, SEQ ID NOs: 481-483, SEQ ID NOs: 491-493, SEQ ID NOs: 501-503, SEQ ID NOs: 511-513, SEQ ID NOs: 521-523, SEQ ID NOs: 531-533, SEQ ID NOs: 541-543, SEQ ID NOs: 551-553, SEQ ID NOs: 561-563, SEQ ID NOs: 571-573, SEQ ID NOs: 581-583, SEQ ID NOs: 591-593, SEQ ID NOs: 601-603, SEQ ID NOs: 611-613, SEQ ID NOs: 621-623, SEQ ID NOs: 631-633, SEQ ID NOs: 641-643, SEQ ID NOs: 651-653, SEQ ID NOs: 661-663, SEQ ID NOs: 671-673, SEQ ID NOs: 681-683, SEQ ID NOs: 691-693, SEQ ID NOs: 701-703, SEQ ID NOs: 711-713, SEQ ID NOs: 721-723, SEQ ID NOs: 731-733, SEQ ID NOs: 741-743, SEQ ID NOs: 751-753, SEQ ID NOs: 761-763, SEQ ID NOs: 771-773, SEQ ID NOs: 781-783, SEQ ID NOs: 791-793, SEQ ID NOs: 801-803, SEQ ID NOs: 811-813, SEQ ID NOs: 821-823, SEQ ID NOs: 831-833, SEQ ID NOs: 841-843, SEQ ID NOs: 851-853, SEQ ID NOs: 861-863, SEQ ID NOs: 871-873, SEQ ID NOs: 881-883, SEQ ID NOs: 891-896, SEQ ID NOs: 901-903, SEQ ID NOs: 911-913, SEQ ID NOs: 921-923, SEQ ID NOs: 931-933, SEQ ID NOs: 941-943, SEQ ID NOs: 951-953, SEQ ID NOs: 961-963, SEQ ID NOs: 971-973, SEQ ID NOs: 981-983, particularly SEQ ID Nos: 561-563, SEQ ID Nos: 751-753, SEQ ID NOs: 721-723, and preferably SEQ ID NOs: 721-723, and SEQ ID NOs: 344-346, SEQ ID NOs: 354-356, SEQ ID NOs: 364-366, SEQ ID NOs: 374-376, SEQ ID NOs: 384-386, SEQ ID NOs: 394-396, SEQ ID NOs: 404-406, SEQ ID NOs: 414-416, SEQ ID NOs: 424-426, SEQ ID NOs: 434-436, SEQ ID NOs: 444-446, SEQ ID NOs: 454-456, SEQ ID NOs: 464-466, SEQ ID NOs: 474-476, SEQ ID NOs: 484-486, SEQ ID NOs: 494-496, SEQ ID NOs: 504-506, SEQ ID NOs: 514-516, SEQ ID NOs: 524-526, SEQ ID NOs: 534-536, SEQ ID NOs: 544-546, SEQ ID NOs: 554-556, SEQ ID NOs: 564-566, SEQ ID NOs: 574-576, SEQ ID NOs: 584-586, SEQ ID NOs: 594-596, SEQ ID NOs: 604-606, SEQ ID NOs: 614-616, SEQ ID NOs: 624-626, SEQ ID NOs: 634-636, SEQ ID NOs: 644-646, SEQ ID NOs: 654-656, SEQ ID NOs: 664-666, SEQ ID NOs: 674-676, SEQ ID NOs: 684-686, SEQ ID NOs: 694-696, SEQ ID NOs: 704-706, SEQ ID NOs: 714-716, SEQ ID NOs: 724-726, SEQ ID NOs: 734-736, SEQ ID NOs: 744-746, SEQ ID NOs: 754-756, SEQ ID NOs: 764-766, SEQ ID NOs: 774-776, SEQ ID NOs: 784-786, SEQ ID NOs: 794-796, SEQ ID NOs: 804-806, SEQ ID NOs: 814-816, SEQ ID NOs: 824-826, SEQ ID NOs: 834-836, SEQ ID NOs: 844-846, SEQ ID NOs: 854-856, SEQ ID NOs: 864-866, SEQ ID NOs: 874-876, SEQ ID NOs: 884-886, SEQ ID NOs: 894-896, SEQ ID NOs: 904-906, SEQ ID NOs: 914-916, SEQ ID NOs: 924-926, SEQ ID NOs: 934-936, SEQ ID NOs: 944-946, SEQ ID NOs: 954-956, SEQ ID NOs: 964-966, SEQ ID NOs: 974-976, SEQ ID NOs: 984-986, particularly SEQ ID Nos: 564-566, SEQ ID Nos: 754-756, SEQ ID NOs: 724-726, and preferably SEQ ID NOs: 724-726, or wherein the domain which binds to FLT3 binds to an epitope that is selectively bound by any of the above depicted sequences.


(xxxvi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (xxxvi), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein an antibody construct is administered that comprises at least one domain, which binds to FLT3 on the surface of a target cell, and at least one other domain, which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as defined in Sub-Aspect B-3, wherein the first binding domain competes for binding with an antibody selected from the group consisting of FL-1 to FL-65 as disclosed in WO2017021362, i.e., an antibody comprising a VH region comprising CDR-H1, CDR-H2 and CDR-H3 and a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from the group consisting of those described above.


(xxxvii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (xxxvii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein an antibody construct is administered that comprises at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in Sub-Aspect B-3, wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that has the VH chain and/or VL chain respectively, that are disclosed in WO2017021362, particularly in the sequence listing, which is hereby incorporated by reference.


(xxxviii) Further, the present invention relates to the method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (xxxviii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein an antibody construct is administered that comprises at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in Sub-Aspect B-3, wherein the domain which binds to FLT3 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 sequences selected from the group comprising: SEQ ID NOs: 344-346, SEQ ID NOs: 354-356, SEQ ID NOs: 364-366, SEQ ID NOs: 374-376, SEQ ID NOs: 384-386, SEQ ID NOs: 394-396, SEQ ID NOs: 404-406, SEQ ID NOs: 414-416, SEQ ID NOs: 424-426, SEQ ID NOs: 434-436, SEQ ID NOs: 444-446, SEQ ID NOs: 454-456, SEQ ID NOs: 464-466, SEQ ID NOs: 474-476, SEQ ID NOs: 484-486, SEQ ID NOs: 494-496, SEQ ID NOs: 504-506, SEQ ID NOs: 514-516, SEQ ID NOs: 524-526, SEQ ID NOs: 534-536, SEQ ID NOs: 544-546, SEQ ID NOs: 554-556, SEQ ID NOs: 564-566, SEQ ID NOs: 574-576, SEQ ID NOs: 584-586, SEQ ID NOs: 594-596, SEQ ID NOs: 604-606, SEQ ID NOs: 614-616, SEQ ID NOs: 624-626, SEQ ID NOs: 634-636, SEQ ID NOs: 644-646, SEQ ID NOs: 654-656, SEQ ID NOs: 664-666, SEQ ID NOs: 674-676, SEQ ID NOs: 684-686, SEQ ID NOs: 694-696, SEQ ID NOs: 704-706, SEQ ID NOs: 714-716, SEQ ID NOs: 724-726, SEQ ID NOs: 734-736, SEQ ID NOs: 744-746, SEQ ID NOs: 754-756, SEQ ID NOs: 764-766, SEQ ID NOs: 774-776, SEQ ID NOs: 784-786, SEQ ID NOs: 794-796, SEQ ID NOs: 804-806, SEQ ID NOs: 814-816, SEQ ID NOs: 824-826, SEQ ID NOs: 834-836, SEQ ID NOs: 844-846, SEQ ID NOs: 854-856, SEQ ID NOs: 864-866, SEQ ID NOs: 874-876, SEQ ID NOs: 884-886, SEQ ID NOs: 894-896, SEQ ID NOs: 904-906, SEQ ID NOs: 914-916, SEQ ID NOs: 924-926, SEQ ID NOs: 934-936, SEQ ID NOs: 944-946, SEQ ID NOs: 954-956, SEQ ID NOs: 964-966, SEQ ID NOs: 974-976, SEQ ID NOs: 984-986, particularly SEQ ID Nos: 564-566, SEQ ID Nos: 754-756, SEQ ID NOs: 724-726, and preferably SEQ ID NOs: 724-726.


(xxxix) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (xxxix), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein an antibody construct is administered that comprises at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in Sub-Aspect B-3, wherein the domain which binds to FLT3 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: SEQ ID NOs: 341-343; SEQ ID NOs: 351-353, SEQ ID NOs: 361-363, SEQ ID NOs: 371-373, SEQ ID NOs: 381-383, SEQ ID NOs: 391-393, SEQ ID NOs: 401-403, SEQ ID NOs: 411-413, SEQ ID NOs: 421-423, SEQ ID NOs: 431-433, SEQ ID NOs: 441-443, SEQ ID NOs: 451-453, SEQ ID NOs: 461-463, SEQ ID NOs: 471-473, SEQ ID NOs: 481-483, SEQ ID NOs: 491-493, SEQ ID NOs: 501-503, SEQ ID NOs: 511-513, SEQ ID NOs: 521-523, SEQ ID NOs: 531-533, SEQ ID NOs: 541-543, SEQ ID NOs: 551-553, SEQ ID NOs: 561-563, SEQ ID NOs: 571-573, SEQ ID NOs: 581-583, SEQ ID NOs: 591-593, SEQ ID NOs: 601-603, SEQ ID NOs: 611-613, SEQ ID NOs: 621-623, SEQ ID NOs: 631-633, SEQ ID NOs: 641-643, SEQ ID NOs: 651-653, SEQ ID NOs: 661-663, SEQ ID NOs: 671-673, SEQ ID NOs: 681-683, SEQ ID NOs: 691-693, SEQ ID NOs: 701-703, SEQ ID NOs: 711-713, SEQ ID NOs: 721-723, SEQ ID NOs: 731-733, SEQ ID NOs: 741-743, SEQ ID NOs: 751-753, SEQ ID NOs: 761-763, SEQ ID NOs: 771-773, SEQ ID NOs: 781-783, SEQ ID NOs: 791-793, SEQ ID NOs: 801-803, SEQ ID NOs: 811-813, SEQ ID NOs: 821-823, SEQ ID NOs: 831-833, SEQ ID NOs: 841-843, SEQ ID NOs: 851-853, SEQ ID NOs: 861-863, SEQ ID NOs: 871-873, SEQ ID NOs: 881-883, SEQ ID NOs: 891-896, SEQ ID NOs: 901-903, SEQ ID NOs: 911-913, SEQ ID NOs: 921-923, SEQ ID NOs: 931-933, SEQ ID NOs: 941-943, SEQ ID NOs: 951-953, SEQ ID NOs: 961-963, SEQ ID NOs: 971-973, SEQ ID NOs: 981-983, particularly SEQ ID Nos: 561-563, SEQ ID Nos: 751-753, SEQ ID NOs: 721-723, and preferably SEQ ID NOs: 721-723.


(xl) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (xl), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein an antibody construct is administered that comprises at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined Sub-Aspect B-3, wherein the domain which binds to FLT3 comprises pairs of a VH region and a VL region as depicted in SEQ ID NO: 347+348, SEQ ID NO: 357+358, SEQ ID NO: 367+368, SEQ ID NO: 377+378, SEQ ID NO: 387+388, SEQ ID NO: 397+398, SEQ ID NO: 407+408, SEQ ID NO: 417+418, SEQ ID NO: 427+428, SEQ ID NO: 437+438, SEQ ID NO: 447+448, SEQ ID NO: 457+458, SEQ ID NO: 467+468, SEQ ID NO: 477+478, SEQ ID NO: 487+488, SEQ ID NO: 497+498, SEQ ID NO: 507+508, SEQ ID NO: 517+518, SEQ ID NO: 527+528, SEQ ID NO: 537+538, SEQ ID NO: 547+548, SEQ ID NO: 557+558, SEQ ID NO: 567+568, SEQ ID NO: 577+578, SEQ ID NO: 587+588, SEQ ID NO: 597+598, SEQ ID NO: 607+608, SEQ ID NO: 617+618, SEQ ID NO: 627+628, SEQ ID NO: 637+638, SEQ ID NO: 647+648, SEQ ID NO: 657+658, SEQ ID NO: 667+668, SEQ ID NO: 677+678, SEQ ID NO: 687+688, SEQ ID NO: 697+698, SEQ ID NO: 707+708, SEQ ID NO: 717+718, SEQ ID NO: 727+728, SEQ ID NO: 737+738, SEQ ID NO: 747+748, SEQ ID NO: 757+758, SEQ ID NO: 767+768, SEQ ID NO: 777+778, SEQ ID NO: 787+788, SEQ ID NO: 797+798, SEQ ID NO: 807+808, SEQ ID NO: 817+818, SEQ ID NO: 827+828, SEQ ID NO: 837+838, SEQ ID NO: 847+848, SEQ ID NO: 857+858, SEQ ID NO: 867+868, SEQ ID NO: 877+878, SEQ ID NO: 887+888, SEQ ID NO: 897+898, SEQ ID NO: 907+908, SEQ ID NO: 917+918, SEQ ID NO: 927+928, SEQ ID NO: 937+938, SEQ ID NO: 947+948, SEQ ID NO: 957+958, SEQ ID NO: 967+968, SEQ ID NO: 977+978, and SEQ ID NO: 987+988, particularly SEQ ID Nos: 727+728, 767+568, 757+758, preferably SEQ ID NO: 727+728.


(xli) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (xli), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein an antibody construct is administered that comprises at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in Sub-Aspect B-3, wherein the domain binds to FLT3 and comprises a polypeptide selected from the group consisting of those depicted in SEQ ID NO: 349, SEQ ID NO: 359, SEQ ID NO: 369, SEQ ID NO: 379, SEQ ID NO: 389, SEQ ID NO: 399, SEQ ID NO: 409, SEQ ID NO: 419, SEQ ID NO: 429, SEQ ID NO: 439, SEQ ID NO: 449, SEQ ID NO: 459, SEQ ID NO: 469, SEQ ID NO: 479, SEQ ID NO: 489, SEQ ID NO: 499, SEQ ID NO: 509, SEQ ID NO: 519, SEQ ID NO: 529, SEQ ID NO: 539, SEQ ID NO: 549, SEQ ID NO: 559, SEQ ID NO: 569, SEQ ID NO: 579, SEQ ID NO: 589, SEQ ID NO: 599, SEQ ID NO: 609, SEQ ID NO: 619, SEQ ID NO: 629, SEQ ID NO: 639, SEQ ID NO: 649, SEQ ID NO: 659, SEQ ID NO: 669, SEQ ID NO: 679, SEQ ID NO: 689, SEQ ID NO: 699, SEQ ID NO: 709, SEQ ID NO: 719, SEQ ID NO: 729, SEQ ID NO: 739, SEQ ID NO: 749, SEQ ID NO: 759, SEQ ID NO: 769, SEQ ID NO: 779, SEQ ID NO: 789, SEQ ID NO: 799, SEQ ID NO: 809, SEQ ID NO: 819, SEQ ID NO: 829, SEQ ID NO: 839, SEQ ID NO: 849, SEQ ID NO: 859, SEQ ID NO: 869, SEQ ID NO: 879, SEQ ID NO: 889, SEQ ID NO: 899, SEQ ID NO: 909, SEQ ID NO: 919, SEQ ID NO: 929, SEQ ID NO: 939, SEQ ID NO: 949, SEQ ID NO: 959, SEQ ID NO: 969, SEQ ID NO: 979, and SEQ ID NO: 989, particularly SEQ ID NOS: 729, 759, 569, preferably SEQ ID NO: 729.


(xlii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (xlii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein an antibody construct is administered that comprises at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiments of Sub-Aspect B-3, wherein the peptide binding to CD3 and FLT3 as used herein may be selected, for example, from the group comprising SEQ ID Nos: 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850, 860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980, and 990, particularly SEQ ID Nos: 570, 760, and 730, preferably SEQ ID NO: 730.


(xliii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (xliv), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly a blood cell-related cancer, such as leukemia and/or lymphoma, particularly myeloid leukemia, more particularly AML, wherein an antibody construct is administered that comprises at least one domain which binds to FLT3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiments of Sub-Aspect B-3, wherein the first domain which binds to FLT3 competes for binding to FLT3 with an antibody construct in accordance with the present invention that is characterized by a domain which binds to FLT3 comprising a VL region and a VH region consisting a VL region as depicted in SEQ ID NO: 309 and a VH region as depicted in SEQ ID NO: 308, or with an antibody construct having a domain which binds to FLT3 comprises a VL region comprising CDR-LL CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3, wherein the CDR sequences are selected from: SEQ ID NOs: 344-346, SEQ ID NOs: 354-356, SEQ ID NOs: 364-366, SEQ ID NOs: 374-376, SEQ ID NOs: 384-386, SEQ ID NOs: 394-396, SEQ ID NOs: 404-406, SEQ ID NOs: 414-416, SEQ ID NOs: 424-426, SEQ ID NOs: 434-436, SEQ ID NOs: 444-446, SEQ ID NOs: 454-456, SEQ ID NOs: 464-466, SEQ ID NOs: 474-476, SEQ ID NOs: 484-486, SEQ ID NOs: 494-496, SEQ ID NOs: 504-506, SEQ ID NOs: 514-516, SEQ ID NOs: 524-526, SEQ ID NOs: 534-536, SEQ ID NOs: 544-546, SEQ ID NOs: 554-556, SEQ ID NOs: 564-566, SEQ ID NOs: 574-576, SEQ ID NOs: 584-586, SEQ ID NOs: 594-596, SEQ ID NOs: 604-606, SEQ ID NOs: 614-616, SEQ ID NOs: 624-626, SEQ ID NOs: 634-636, SEQ ID NOs: 644-646, SEQ ID NOs: 654-656, SEQ ID NOs: 664-666, SEQ ID NOs: 674-676, SEQ ID NOs: 684-686, SEQ ID NOs: 694-696, SEQ ID NOs: 704-706, SEQ ID NOs: 714-716, SEQ ID NOs: 724-726, SEQ ID NOs: 734-736, SEQ ID NOs: 744-746, SEQ ID NOs: 754-756, SEQ ID NOs: 764-766, SEQ ID NOs: 774-776, SEQ ID NOs: 784-786, SEQ ID NOs: 794-796, SEQ ID NOs: 804-806, SEQ ID NOs: 814-816, SEQ ID NOs: 824-826, SEQ ID NOs: 834-836, SEQ ID NOs: 844-846, SEQ ID NOs: 854-856, SEQ ID NOs: 864-866, SEQ ID NOs: 874-876, SEQ ID NOs: 884-886, SEQ ID NOs: 894-896, SEQ ID NOs: 904-906, SEQ ID NOs: 914-916, SEQ ID NOs: 924-926, SEQ ID NOs: 934-936, SEQ ID NOs: 944-946, SEQ ID NOs: 954-956, SEQ ID NOs: 964-966, SEQ ID NOs: 974-976, SEQ ID NOs: 984-986, particularly SEQ ID Nos: 564-566, SEQ ID Nos: 754-756, SEQ ID NOs: 724-726, and preferably SEQ ID NOs: 724-726, and SEQ ID NOs: 341-343; SEQ ID NOs: 351-353, SEQ ID NOs: 361-363, SEQ ID NOs: 371-373, SEQ ID NOs: 381-383, SEQ ID NOs: 391-393, SEQ ID NOs: 401-403, SEQ ID NOs: 411-413, SEQ ID NOs: 421-423, SEQ ID NOs: 431-433, SEQ ID NOs: 441-443, SEQ ID NOs: 451-453, SEQ ID NOs: 461-463, SEQ ID NOs: 471-473, SEQ ID NOs: 481-483, SEQ ID NOs: 491-493, SEQ ID NOs: 501-503, SEQ ID NOs: 511-513, SEQ ID NOs: 521-523, SEQ ID NOs: 531-533, SEQ ID NOs: 541-543, SEQ ID NOs: 551-553, SEQ ID NOs: 561-563, SEQ ID NOs: 571-573, SEQ ID NOs: 581-583, SEQ ID NOs: 591-593, SEQ ID NOs: 601-603, SEQ ID NOs: 611-613, SEQ ID NOs: 621-623, SEQ ID NOs: 631-633, SEQ ID NOs: 641-643, SEQ ID NOs: 651-653, SEQ ID NOs: 661-663, SEQ ID NOs: 671-673, SEQ ID NOs: 681-683, SEQ ID NOs: 691-693, SEQ ID NOs: 701-703, SEQ ID NOs: 711-713, SEQ ID NOs: 721-723, SEQ ID NOs: 731-733, SEQ ID NOs: 741-743, SEQ ID NOs: 751-753, SEQ ID NOs: 761-763, SEQ ID NOs: 771-773, SEQ ID NOs: 781-783, SEQ ID NOs: 791-793, SEQ ID NOs: 801-803, SEQ ID NOs: 811-813, SEQ ID NOs: 821-823, SEQ ID NOs: 831-833, SEQ ID NOs: 841-843, SEQ ID NOs: 851-853, SEQ ID NOs: 861-863, SEQ ID NOs: 871-873, SEQ ID NOs: 881-883, SEQ ID NOs: 891-896, SEQ ID NOs: 901-903, SEQ ID NOs: 911-913, SEQ ID NOs: 921-923, SEQ ID NOs: 931-933, SEQ ID NOs: 941-943, SEQ ID NOs: 951-953, SEQ ID NOs: 961-963, SEQ ID NOs: 971-973, SEQ ID NOs: 981-983, particularly SEQ ID Nos: 561-563, SEQ ID Nos: 751-753, SEQ ID NOs: 721-723, and preferably SEQ ID NOs: 721-723.


(xliv) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (xlv), wherein the adverse event associated with immunotherapy is increased cytokine release of TNF, IL-1, MCP-1, and/or IL-6, particularly wherein the adverse event is cytokine release syndrome (CRS) or tumor lysis syndrome (TLS), wherein the adverse events may also include a neurological reaction, selected from the group comprising confusion, ataxia, disorientation, dysphasia, aphasia, speech impairment, cerebellar symptoms, tremor, apraxia, seizure, grand mal convulsion, palsy, and balance disorder.


(xlv) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (xlvi), wherein the domain of said antibody construct binds to CD3, preferably human CD3, epsilon and to Callithrix jacchus or Saimiri sciureus CD3 epsilon.


(xlvi) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (xlvii), wherein

    • (a) the antibody construct is a single chain antibody construct,
    • (b) the first domain is in the format of an scFv,
    • (c) the second domain is in the format of an scFv,
    • (d) the first and the second domain are connected via a linker, and/or
    • (e) the antibody construct comprises a domain providing an extended serum half-life.


      (xlvii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (xlviii), wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group comprising small molecules, biological molecules, antibodies and derivatives thereof, aptamers, and the like.


      (xlviii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (xlix), wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group of TNF inhibitors comprising etanercept, infliximab, adalimumab, certolizumab Pergol, and golimumab, particularly etanercept.


      (xlix) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (1), for administration to a patient at risk of developing adverse events or having an intolerance to at least one of a group comprising corticosteroids, IL-6-inhibitors, IL-6R-inhibitors, and/or TNF/TNFR inhibitors different from an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling according to any of the preceding embodiments.


      (l) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (10, for administration to a patient at risk of developing adverse events or having an intolerance to corticosteroids, wherein the corticosteroid is dexamethasone.


      (li) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (lii), for administration to a patient at risk of developing adverse events or having an intolerance to IL-6-antagonists and/or IL-6R-antagonists, wherein the IL-6-antagonists and/or IL-6R-antagonists are selected from the group comprising tocilizumab, siltuximab, olokizumab, elsilimomab, clazakizumab, sirukumab, particularly tocilizumab, and/or wherein said combination product is for administration to a patient at risk of developing adverse events or having an intolerance to TNF/TNFR inhibitors, wherein the TNF/TNFR inhibitor is selected from the group comprising infliximab, adalimumab, certolizumab Pergol, and/or golimumab.


      (lii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (liii), further comprising administering at least one corticosteroid, particularly wherein said corticostoid is dexamethasone.


      (liii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (liii), further comprising administering an IL-6R-antagonist, wherein said IL-6R-antagonist is tocilizumab.


      (liv) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of FLT3+ target cells according to any one of embodiments (i) to (liv), further comprising administering at least one corticosteroid, particularly dexamethasone and/or at least one IL-6 and/or IL-6R-antagonist, particularly tocilizumab, wherein said at least one corticosteroid and/or said IL-6 and/or IL-6R-antagonist is for administration to a patient in need thereof prior to, concomitant with, and/or after administration of said antibody construct.


      Sub-Aspect F-4—Dosing of an TNF/TNFR Inhibitor/Antagonist Together with Antibody Constructs Binding PSMA


The present invention relates also to a method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A for the prevention of adverse events associated with immunotherapy, particularly of cancer immunotherapy, very particularly of CRS due to immunotherapy, very particularly in the treatment of a PSMA+ cancer, such as prostate cancer, in accordance with any of the methods as defined explicitly in Aspect B, particularly in Sub-Aspect B-4, in a patient who is at risk of CRS or TLS as defined in the preceding embodiments, wherein said patient is a person subjected to therapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell as defined in any of the foregoing embodiments, wherein a first dose of said inhibitor is administered before administration of a first dose of said antibody construct, and wherein said antibody construct binds PSMA. Further embodiments are set forth below:


(i) A method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, wherein said method comprises the steps:

    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein a first dose of said inhibitor is administered before administration of a first dose of said antibody construct.


      (ii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to embodiment (i), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS.


      (iii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) and (ii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein at least one further dose, preferably a second dose, of said inhibitor is administered before administration of said antibody construct.


      (iv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (iii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein a further dose of said inhibitor is administered following administration of said antibody construct.


      (v) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (iv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct.


      (vi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (v), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 7 days prior to administration of the antibody construct.


      (vii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (vi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said at least one further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 6 days prior to administration of the antibody construct.


      (viii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (vii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 5 days prior to administration of the antibody construct.


      (ix) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (viii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 4 days prior to administration of the antibody construct.


      (x) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (ix), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 3 days prior to administration of the antibody construct.


      (xi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (x), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 2 days prior to administration of the antibody construct.


      (xii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 1 day prior to administration of the antibody construct.


      (xiii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 60 minutes to 1 day prior to administration of the antibody construct.


      (xiv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xiii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a second period, for example within a second period before administration of the antibody construct, wherein said period is shorter than the first period of administration of the inhibitor.


      (xv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xvi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a second period ranging from 30 minutes to 5 days prior to administration of the antibody construct.


      (xvi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 4 days prior to administration of the antibody construct.


      (xvii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xvi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 3 days prior to administration of the antibody construct.


      (xviii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xvii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 2 days prior to administration of the antibody construct.


      (xix) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xviii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 1 day prior to administration of the antibody construct.


      (xx) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xix), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose and at least one further dose of said inhibitor comprise different quantities of inhibitor and/or different quantities of the antibody construct.


      (xxi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xx), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose and at least one further dose of said inhibitor comprise identical quantities of inhibitor and/or identical quantities of the antibody construct.


      (xxii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 7 days following a first administration of a dose of said antibody construct.


      (xxiii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 6 days following a first administration of a dose of said antibody construct.


      (xxiv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxiii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 5 days following a first administration of a dose of said antibody construct.


      (xxv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxiv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 4 days following a first administration of a dose of said antibody construct.


      (xxvi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 3 days following a first administration of a dose of said antibody construct.


      (xxvii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxvi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds PSMA on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of CRS or TLS in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein at least one further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 2 days following a first administration of a dose of said antibody construct.


      (xxviii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxvii), wherein the domain of the antibody construct used in accordance with the present invention that binds to PSMA comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3, wherein CDR-L1 is as depicted in SEQ ID NO:314, CDR-L2 is as depicted in SEQ ID NO: 315, and CDR-L3 is as depicted in SEQ ID NO: 316.


      (xxix) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxviii), wherein the domain which binds to PSMA comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 as disclosed in any of the embodiments of Sub-Aspect B-4.


      (xxx) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxviii), wherein the domain which binds to PSMA comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 as disclosed in any of the embodiments of Sub-Aspect B-4.


      (xxxi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxx), wherein the domain which binds to PSMA comprises a VL region as disclosed in any of the embodiments of Sub-Aspect B-4.


      (xxxii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxxi), wherein the domain which binds to PSMA comprises a VH region as disclosed in any of the embodiments of Sub-Aspect B-4.


      (xxxiii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxxii), wherein the domain which binds to PSMA comprising a VL region and a VH region consisting as disclosed in any of the embodiments of Sub-Aspect B-4.


      (xxxiv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxxiii), wherein a domain which binds to PSMA comprising a VL region and a VH region as disclosed in any of the embodiments of Sub-Aspect B-4.


      (xxxv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxxiv), wherein a domain which binds to PSMA competes for binding to an epitope of PSMA with an antibody construct that binds to PSMA, wherein said competing antibody construct that binds to PSMA may have VL and/or VH regions that differ in their amino acid sequence(s) from the said antibody constructs as defined in the preceding embodiments, when both, the competing antibody constructs and the antibody constructs as defined in the preceding embodiments are co-incubated in a competition assay with target cells that express PSMA, wherein both, competition antibody construct and antibody constructs as defined in the preceding embodiments are used at equimolar concentrations in such competition assays, wherein the competition antibody construct may be labelled and the antibody constructs as defined in the preceding embodiments may be unlabeled or differently labelled to permit a quantification to be able to distinguish the number of competition antibody construct bound to the target antigen at the end of the competition assay method, and/or wherein the amount/number of competition antibody construct that binds under such circumstances to the target is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, preferably at least 95% of all antibody constructs selectively binding to the target antigen, and/or wherein the competition antibody construct may comprise one or more, e.g. at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or even more amino acid residues that are different from the antibody constructs as defined in the preceding embodiments.


      (xxxvi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells, such as prostate cancer, according to any one of embodiments (i) to (xxxv), wherein the competition antibody constructs have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more amino acid residues that are different from the herein described antibody constructs that are characterized by a domain which binds to PSMA comprising a VL region and a VH region consisting a VL region and a VH region as disclosed in any of the embodiments of Sub-Aspect B-4, or with an antibody construct having a domain which binds to PSMA comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 as disclosed in any of the embodiments of Sub-Aspect B-4.


      (xxxvii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (xxxvi), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly prostate cancer, wherein an antibody construct is administered that comprises at least one domain (also referred to as “first domain”) which binds to PSMA on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as defined in Sub-Aspect B-4.


      (xxxviii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (xxxvii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly prostate cancer, wherein an antibody construct is administered that comprises at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in Sub-Aspect B-4, wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that has the VH chain and/or VL chain respectively, that are disclosed in WO2010052014, particularly in the sequence listing, which is hereby incorporated by reference.


      (xxxix) Further, the present invention relates to the method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (xxxviii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly prostate cancer, wherein an antibody construct is administered that comprises at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in embodiments (i) to (iii) of Sub-Aspect B-4, wherein the domain which binds to PSMA comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3, as disclosed in any of the embodiments of Sub-Aspect B-4.


      (xl) Further, the present invention relates to The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (xxxix), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly more particularly prostate cancer, wherein an antibody construct is administered that comprises at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in embodiments (i) to (iv) of Sub-Aspect B-4, wherein the domain which binds to PSMA comprises a VH region comprising CDR-H1, CDR-1-12 and CDR-H3 as disclosed in any of the embodiments of Sub-Aspect B-4.


      (xli) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (xl), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly more particularly prostate cancer, wherein an antibody construct is administered that comprises at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in embodiments (i) to (iv) of Sub-Aspect B-4, wherein the domain which binds to PSMA comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 as disclosed in any of the embodiments of Sub-Aspect B-4.


      (xlii) Further, the present invention relates to The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (xli), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly prostate cancer, wherein an antibody construct is administered that comprises at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in embodiments (i) to (iv) of Sub-Aspect B-4, wherein the domain which binds to PSMA comprises a VL region as disclosed in any of the embodiments of Sub-Aspect B-4.


      (xliii) Further, the present invention relates to The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (xlii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly prostate cancer, wherein an antibody construct is administered that comprises at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in embodiments (i) to (iv) of Sub-Aspect B-4, wherein the domain which binds to PSMA comprises a VH region as disclosed in any of the embodiments of Sub-Aspect B-4.


      (xliv) Further, the present invention relates to The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (xliii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly prostate cancer, wherein an antibody construct is administered that comprises at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in embodiments (i) to (iv) of Sub-Aspect B-4, wherein the domain which binds to PSMA comprises a VL region and a VH region as disclosed in any of the embodiments of Sub-Aspect B-4.


      (xlv) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (xliv), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, more particularly prostate cancer, wherein an antibody construct is administered that comprises at least one domain which binds to PSMA on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xvi) of general Aspect A) and as further defined in embodiments (i) to (iv) of Sub-Aspect B-4, wherein the first domain which binds to PSMA competes for binding to PSMA with an antibody construct in accordance with the present invention that is characterized by a domain which binds to PSMA comprising a VL region and a VH region as disclosed in any of the embodiments of Sub-Aspect B-4, or with an antibody construct having a domain which binds to PSMA comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 as disclosed in any of the embodiments of Sub-Aspect B-4.


      (xlvi) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (xlv), wherein the adverse event associated with immunotherapy is increased cytokine release of TNF, IL-1, MCP-1, and/or IL-6, particularly wherein the adverse event is CRS or TLS, wherein the adverse events may also include a neurological reaction, selected from the group comprising confusion, ataxia, disorientation, dysphasia, aphasia, speech impairment, cerebellar symptoms, tremor, apraxia, seizure, grand mal convulsion, palsy, and balance disorder.


      (xlvii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (xlvi), wherein the second domain of said antibody construct binds to CD3, preferably human CD3, epsilon and to Callithrix jacchus or Saimiri sciureus CD3 epsilon.


      (xlviii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (xlvii), wherein
    • (a) the antibody construct is a single chain antibody construct,
    • (b) the first domain is in the format of an scFv,
    • (c) the second domain is in the format of an scFv,
    • (d) the first and the second domain are connected via a linker, and/or
    • (e) the antibody construct comprises a domain providing an extended serum half-life.


      (xlix) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (xlviii), wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group comprising small molecules, biological molecules, antibodies and derivatives thereof, aptamers, and the like.


      (l) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (xlix), wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group of TNF inhibitors comprising etanercept, infliximab, adalimumab, certolizumab Pergol, and golimumab, particularly etanercept.


      (li) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (l), for administration to a patient at risk of developing adverse events or having an intolerance to at least one of a group comprising corticosteroids, IL-6-inhibitors, IL-6R-inhibitors, and/or TNF/TNFR inhibitors different from an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling according to any of the preceding embodiments.


      (lii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (li), for administration to a patient at risk of developing adverse events or having an intolerance to corticosteroids, wherein the corticosteroid is dexamethasone.


      (liii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (lii), for administration to a patient at risk of developing adverse events or having an intolerance to IL-6-antagonists and/or IL-6R-antagonists, wherein the IL-6-antagonists and/or IL-6R-antagonists are selected from the group comprising tocilizumab, siltuximab, olokizumab, elsilimomab, clazakizumab, sirukumab, particularly tocilizumab, and/or wherein said combination product is for administration to a patient at risk of developing adverse events or having an intolerance to TNF/TNFR inhibitors, wherein the TNF/TNFR inhibitor is selected from the group comprising infliximab, adalimumab, certolizumab Pergol, and/or golimumab.


      (liv) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (liii), further comprising administering at least one corticosteroid, particularly wherein said corticostoid is dexamethasone.


      (1v) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (liii), further comprising administering an IL-6R-antagonist, wherein said IL-6R-antagonist is tocilizumab.


      (lvi) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of PSMA+ target cells according to any one of embodiments (i) to (liv), further comprising administering at least one corticosteroid, particularly dexamethasone and/or at least one IL-6 and/or IL-6R-antagonist, particularly tocilizumab, wherein said at least one corticosteroid and/or said IL-6 and/or IL-6R-antagonist is for administration to a patient in need thereof prior to, concomitant with, and/or after administration of said antibody construct.


      Sub-Aspect F-5—Dosing of an TNF/TNFR Inhibitor/Antagonist Together with Antibody Constructs Binding DLL3


The present invention relates also to a method/a use of an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling as defined in any of the foregoing embodiments (i) to (xiv) in general Aspect A for the prevention of adverse events associated with immunotherapy, particularly of cancer immunotherapy, very particularly of CRS, in accordance with any of the methods as defined explicitly in Aspect B, particularly in Sub-Aspect B5, in a patient suffering from a neoplastic disease and who is at risk of CRS as defined in the preceding embodiments, wherein said patient is a person subjected to therapy with an antibody construct comprising a first domain which binds to a target antigen on the surface of a target cell, and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell as defined in any of the foregoing embodiments, wherein a first dose of said inhibitor is administered before administration of a first dose of said antibody construct, and wherein said antibody construct binds DLL3.


(i) A method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, wherein said method comprises the steps:

    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell, wherein a first dose of said inhibitor is administered before administration of a first dose of said antibody construct.


      (ii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to embodiment (i), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) in a patient suffering from a neoplastic disease as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS.


      (iii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) and (ii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein at least one further dose, preferably a second dose, of said inhibitor is administered before administration of said antibody construct.


      (iv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (iii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein a further dose of said inhibitor is administered following administration of said antibody construct.


      (v) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (iv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct.


      (vi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (v), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 7 days prior to administration of the antibody construct.


      (vii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (vi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 6 days prior to administration of the antibody construct.


      (viii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (vii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 5 days prior to administration of the antibody construct.


      (ix) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (viii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 4 days prior to administration of the antibody construct.


      (x) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (ix), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 3 days prior to administration of the antibody construct.


      (xi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (x), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 2 days prior to administration of the antibody construct.


      (xii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 1 day prior to administration of the antibody construct.


      (xiii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, said period ranging from 60 minutes to 1 day prior to administration of the antibody construct.


      (xiv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xiii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a second period, for example within a second period before administration of the antibody construct, wherein said period is shorter than the first period of administration of the inhibitor.


      (xv) The method of treating cancer with an antibody construct as defined above, according to any one of embodiments (i) to (xvi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a second period ranging from 30 minutes to 5 days prior to administration of the antibody construct.


      (xvi) The method of treating cancer with an antibody construct as defined above, according to any one of embodiments (i) to (xv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 4 days prior to administration of the antibody construct.


      (xvii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xvi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 3 days prior to administration of the antibody construct.


      (xviii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xvii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 2 days prior to administration of the antibody construct.


      (xix) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xviii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the further dose of said inhibitor is administered within a period ranging from 30 minutes to 1 day prior to administration of the antibody construct.


      (xx) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xix), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose and at least one further dose of said inhibitor comprise different quantities of inhibitor and/or different quantities of the antibody construct.


      (xxi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xx), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein the first dose and at least one further dose of said inhibitor comprise identical quantities of inhibitor and/or identical quantities of the antibody construct.


      (xxii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 7 days following a first administration of a dose of said antibody construct.


      (xxiii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 6 days following a first administration of a dose of said antibody construct.


      (xxiv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxiii), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 5 days following a first administration of a dose of said antibody construct.


      (xxv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxiv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 4 days following a first administration of a dose of said antibody construct.


      (xxvi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxv), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 3 days following a first administration of a dose of said antibody construct.


      (xxvii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxvi), wherein said method comprises the steps:
    • (a) Administering an inhibitor/antagonist of TNF-alpha/TNF-alpha-Receptor reducing TNF-alpha/TNF-alpha-Receptor signaling as defined in any of the foregoing sections,
    • (b) Administering an antibody construct that binds DLL3 on a target cell and CD3 on a T cell,


      wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with immunotherapy, particularly of cancer immunotherapy, more particularly of cytokine release syndrome (CRS) or tumor lysis syndrome (TLS) in a patient as defined in the preceding embodiment, particularly a patient who is at risk of developing CRS or TLS, wherein a first dose, optionally also at least one further dose, of said inhibitor is administered before administration of said antibody construct, and wherein further dose of said inhibitor is administered following administration of said antibody construct, wherein the first dose of said inhibitor is administered within a first period before administration of the antibody construct, wherein optionally also said further dose of said inhibitor is administered within a second period before administration of the antibody construct, wherein another dose of said inhibitor is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor is administered following administration of said antibody construct within a period from 1 day to 2 days following a first administration of a dose of said antibody construct.


      (xxviii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxvii), wherein the domain of the antibody construct used in accordance with the present invention that which binds to DLL3 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3, wherein CDR-L1 as disclosed in Sub-Aspect B5.


      (xxix) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxviii), wherein the domain which binds to DLL3 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 as disclosed in Sub-Aspect B5.


      (xxx) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxviii), wherein the domain which binds to DLL3 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 as disclosed in Sub-Aspect B5.


      (xxxi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxx), wherein the domain which binds to DLL3 comprises a VL region as depicted in Sub-Aspect B5.


      (xxxii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxxi), wherein the domain which binds to DLL3 comprises a VH region as disclosed in Sub-Aspect B5.


      (xxxiii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxxii), wherein the domain which binds to DLL3 comprising a VL region and a VH region consisting a VL region as disclosed in Sub-Aspect B5.


      (xxxiv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxxiii), wherein a domain which binds to DLL3 comprising a VL region and a VH region consisting a VL region as disclosed in Sub-Aspect B5.


      (xxxv) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxxiv), wherein a domain which binds to DLL3 competes for binding to an epitope of DLL3 with an antibody construct that binds to DLL3, wherein said competing antibody construct that binds to DLL3 may have VL and/or VH regions that differ in their amino acid sequence(s) from the said antibody constructs as defined in the preceding embodiments, when both, the competing antibody constructs and the antibody constructs as defined in the preceding embodiments are co-incubated in a competition assay with target cells that express DLL3, wherein both, competition antibody construct and antibody constructs as defined in the preceding embodiments are used at equimolar concentrations in such competition assays, wherein the competition antibody construct may be labelled, and the antibody constructs as defined in the preceding embodiments may be unlabeled or differently labelled to permit a quantification to be able to distinguish the number of competition antibody construct bound to the target antigen at the end of the competition assay method, and/or wherein the amount/number of competition antibody construct that binds under such circumstances to the target is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, preferably at least 95% of all antibody constructs selectively binding to the target antigen, and/or wherein the competition antibody construct may comprise one or more, e.g. at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or even more amino acid residues that are different from the antibody constructs as defined in the preceding embodiments.


      (xxxvi) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells, according to any one of embodiments (i) to (xxxv), wherein the competition antibody constructs have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more amino acid residues that are different from the herein described antibody constructs that are characterized by a domain which binds to DLL3 comprising a VL region and a VH region consisting a VL region as depicted in Sub-Aspect B5.


      (xxxvii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (xxxvi), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein an antibody construct is administered that comprises at least one domain (also referred to as “first domain”) which binds to DLL3 on the surface of a target cell, and at least one other domain (also referred to as “second domain”) which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as depicted in Sub-Aspect B5.


      (xxxviii) The method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (xxxvii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein an antibody construct is administered that comprises at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) as depicted in Sub-Aspect B5, wherein said antibody construct binds to an epitope that is selectively bound by an antibody/antibody construct that has the VH chain and/or VL chain respectively, that are disclosed in WO2010052014, particularly in the sequence listing, which is hereby incorporated by reference.


      (xxxix) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (xxxviii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein an antibody construct is administered that comprises at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiments (i) to (iii) of Sub-Aspect B-5, wherein the domain which binds to DLL3 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 as disclosed in Sub-Aspect B5.


      (xl) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (xxxix), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein an antibody construct is administered that comprises at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiments (i) to (iv) of Sub-Aspect B-5, wherein the domain which binds to DLL3 comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from those disclosed in Sub-Aspect B5.


      (xli) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (xl), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein an antibody construct is administered that comprises at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiments (i) to (iv) of Sub-Aspect B-5, wherein the domain which binds to DLL3 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 as disclosed in Sub-Aspect B5.


      (xlii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (xli), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein an antibody construct is administered that comprises at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiments (i) to (iv) of Sub-Aspect B-5, wherein the domain which binds to DLL3 comprises comprises a VL region as disclosed in Sub-Aspect B5.


      (xliii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (xlii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein an antibody construct is administered that comprises at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiments (i) to (iv) of Sub-Aspect B-5, wherein the domain which binds to DLL3 comprises a VH region as disclosed in Sub-Aspect B5.


      (xliv) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (xliii), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein an antibody construct is administered that comprises at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiments (i) to (iv) of Sub-Aspect B-5, wherein the domain which binds to DLL3 comprises a VL region and a VH region consisting a VL region as disclosed in Sub-Aspect B5 and a VH region as disclosed in Sub-Aspect B5.


      (xlv) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (xliv), further comprising the prevention, prophylaxis, or reduction of adverse events associated with immunotherapy, particularly cancer immunotherapy, wherein an antibody construct is administered that comprises at least one domain which binds to DLL3 on the surface of a target cell, and at least one other domain which binds to CD3, preferably human CD3, on the surface of a T cell, according to any one of embodiments (i) to (xiv) of general Aspect A) and as further defined in embodiments (i) to (iv) of Sub-Aspect B-5, wherein the first domain which binds to DLL3 competes for binding to DLL3 with an antibody construct in accordance with the present invention that is characterized by a domain which binds to DLL3 comprising a VL region and a VH region consisting a VL region as disclosed in Sub-Aspect B5 and a VH region as disclosed in Sub-Aspect B5, or with an antibody construct having a domain which binds to DLL3 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 sequences and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 sequences as disclosed in Sub-Aspect B5.


      (xlvi) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (xlv), wherein the adverse event associated with immunotherapy is increased cytokine release of TNF, IL-1, MCP-1, and/or IL-6, particularly wherein the adverse event is cytokine release syndrome (CRS) or tumor lysis syndrome (TLS), wherein the adverse events may also include a neurological reaction, selected from the group comprising confusion, ataxia, disorientation, dysphasia, aphasia, speech impairment, cerebellar symptoms, tremor, apraxia, seizure, grand mal convulsion, palsy, and balance disorder.


      (xlvii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (xlvi), wherein the second domain of said antibody construct binds to CD3, preferably human CD3, epsilon and to Callithrix jacchus or Saimiri sciureus CD3 epsilon.


      (xlviii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (xlvii), wherein
    • (a) the antibody construct is a single chain antibody construct,
    • (b) the first domain is in the format of an scFv,
    • (c) the second domain is in the format of an scFv,
    • (d) the first and the second domain are connected via a linker, and/or
    • (e) the antibody construct comprises a domain providing an extended serum half-life.


      (xlix) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (xlviii), wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group comprising small molecules, biological molecules, antibodies and derivatives thereof, aptamers, and the like.


      (l) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (xlix), wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group of TNF inhibitors comprising etanercept, infliximab, adalimumab, certolizumab Pergol, and golimumab, particularly etanercept.


      (li) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (l), for administration to a patient at risk of developing adverse events or having an intolerance to at least one of a group comprising corticosteroids, IL-6-inhibitors, IL-6R-inhibitors, and/or TNF/TNFR inhibitors different from an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling according to any of the preceding embodiments.


      (lii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (10, for administration to a patient at risk of developing adverse events or having an intolerance to corticosteroids, wherein the corticosteroid is dexamethasone.


      (liii) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (lii), for administration to a patient at risk of developing adverse events or having an intolerance to IL-6-antagonists and/or IL-6R-antagonists, wherein the IL-6-antagonists and/or IL-6R-antagonists are selected from the group comprising tocilizumab, siltuximab, olokizumab, elsilimomab, clazakizumab, sirukumab, particularly tocilizumab, and/or wherein said combination product is for administration to a patient at risk of developing adverse events or having an intolerance to TNF/TNFR inhibitors, wherein the TNF/TNFR inhibitor is selected from the group comprising infliximab, adalimumab, certolizumab Pergol, and/or golimumab.


      (liv) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (liii), further comprising administering at least one corticosteroid, particularly wherein said corticostoid is dexamethasone.


      (lv) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (liii), further comprising administering an IL-6R-antagonist, wherein said IL-6R-antagonist is tocilizumab.


      (lvi) Further, the present invention relates to a method of treating cancer with an antibody construct as defined above, particularly with a cancer immunotherapy, more particularly of DLL3+ target cells according to any one of embodiments (i) to (liv), further comprising administering at least one corticosteroid, particularly dexamethasone and/or at least one IL-6 and/or IL-6R-antagonist, particularly tocilizumab, wherein said at least one corticosteroid and/or said IL-6 and/or IL-6R-antagonist is for administration to a patient in need thereof prior to, concomitant with, and/or after administration of said antibody construct.


Further Items of the Invention are

Item 1: A method for the treatment of cancer and/or for the prophylaxis, prevention, reduction, amelioration, and/or alleviation of adverse events associated with cancer immunotherapy, particularly with cancer immunotherapy engaging T cells via CD3 binding antibody constructs in a human patient, said method comprising

    • (a) Administering an antibody construct that binds selectively to a target antigen on a cancer cell and to human CD3 on the surface of a T cell,
    • (b) Administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling, and/or administering an inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling,


      wherein a first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or a first dose of said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R according to (b) signaling is administered before administration of a first dose of said antibody construct (a) within a first period, said period ranging from 5 minutes to 7 days prior to administration of the antibody construct, particularly wherein said period is ranging from 15 minutes to 7 days prior to administration of the antibody construct.


Item 2: The method of Item 1, wherein the antibody construct binds selectively to a target antigen on a target cell selected from the group comprising CD19, CD33, FLT3, PSMA, and DLL3.


Item 3: The method of any one of Items 1 and 2, wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with cancer immunotherapy, particularly wherein these adverse events are selected from cytokine release syndrome (CRS) and tumor lysis syndrome (TLS), particularly in a patient at risk of developing CRS and/or TLS.


Item 4: The method of any one of Items 1 to 3, wherein at least one further dose, particularly a second dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered before administration of said antibody construct.


Item 5: The method of any one of Items 1 to 4, wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling (c) is administered following administration of said antibody construct.


Item 6: The method of any one of Items 1 to 5, wherein a first dose, and optionally also at least one further dose, of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered within a first period before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of said antibody construct, and optionally wherein at least one dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.


Item 7: The method of any one of Items 1 to 6, wherein said first dose, and optionally also at least one further dose of said inhibitor of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 7 days prior to administration of the antibody construct, wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionally wherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.


Item 8: The method of any one of Items 1 to 7, wherein said first dose, and optionally also at least one further dose of said inhibitor of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 6 days prior to administration of the antibody construct, wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionally wherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.


Item 9: The method of any one of Items 1 to 8, wherein said first dose, and optionally also at least one further dose of said inhibitor of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 5 days prior to administration of the antibody construct, wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionally wherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.


Item 10: The method of any one of Items 1 to 9, wherein said first dose, and optionally also at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 4 days prior to administration of the antibody construct, wherein also said at least one optional further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionally wherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.


Item 11: The method of any one of Items 1 to 10, wherein said first dose, and optionally also at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 3 days prior to administration of the antibody construct, wherein also said at least one optional further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionally wherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.


Item 12: The method of any one of Items 1 to 11, wherein said first dose, and optionally also at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is selected from etanercept and/or tocilicumab, said period ranging from 30 minutes to 2 days prior to administration of the antibody construct, particularly wherein the target antigen is Flt3 or CD33, wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionally wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.


Item 13: The method of any one of Items 1 to 12, wherein said first dose, and optionally also at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab, said period ranging from 30 minutes to 1 day prior to administration of the antibody construct, particularly wherein the target antigen is Flt3 or CD33, more particularly wherein the target antigen is CD33, wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionally wherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.


Item 14: The method of any one of Items 1 to 13, wherein said first dose, and optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab, wherein also said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, wherein said period is shorter than the first period of administration of the inhibitor, and optionally wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.


Item 15: The method of any one of Items 1 to 14, wherein said first dose, optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein optionally the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab, wherein also the further said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, wherein said second period is shorter than the first period of administration of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b), wherein the further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a period ranging from 30 minutes to 5 days, 30 minutes to 4 days, 30 minutes to 3 days, 30 minutest to 2 days, particularly 30 minutes to 1 day prior to administration of the antibody construct, and optionally wherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.


Item 16: The method of any one of Items 1 to 15, wherein said first dose, optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is selected from etanercept and/or tocilicumab, wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, wherein said second period is shorter than the first period of administration of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b), wherein the further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a period ranging from 30 minutes to 5 days, 30 minutes to 4 days, 30 minutes to 3 days, 30 minutest to 2 days, particularly 30 minutes to 1 day prior to administration of the antibody construct, and optionally wherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct, wherein the first dose and at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) comprise different quantities of inhibitor and/or different quantities of the antibody construct.


Item 17: The method of any one of Items 1 to 16, wherein said first dose, optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab, wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionally wherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct, wherein the first dose and at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) comprise identical quantities of inhibitor and/or identical quantities of the antibody construct.


Item 18: The method of any one of Items 1 to 17, wherein said first dose, optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab, wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionally wherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct within a period from 1 day to 7 days following a first administration of a dose of said antibody construct.


Item 19: The method of any one of Items 1 to 18, wherein said first dose, optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab, wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionally wherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct within a period from 1 day to 6 days following a first administration of a dose of said antibody construct.


Item 20: The method of any one of Items 1 to 19, wherein said first dose, and optionally said also at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab, wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionally wherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct within a period from 1 hour to 5 days following a first administration of a dose of said antibody construct.


Item 21: The method of any one of Items 1 to 20, wherein said first dose, and optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab, wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionally wherein said at least one other dose said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct within a period from 1 hour to 4 days following a first administration of a dose of said antibody construct.


Item 22: The method of any one of Items 1 to 21, wherein said first dose, and optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab, wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionally wherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct within a period from 1 hour to 3 days following a first administration of a dose of said antibody construct.


Item 23: The method of any one of Items 1 to 22, wherein said first dose, and optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab, wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionally wherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct, wherein another dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct within a period from 1 hour to 2 days following a first administration of a dose of said antibody construct.


Item 24: The method of any one of Items 1 to 21, wherein said target antigen is CD33, particularly wherein the antibody construct comprises a first domain that comprises the CDR sequences as depicted in SEQ ID NOs: 317-319 and 323-325, and wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered about 1 day before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab, wherein said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered about 4 days following administration of said antibody construct.


Item 25: The method of any one of Items 1 to 21, wherein said target antigen is CD33 particularly wherein the antibody construct comprises a first domain that comprises the CDR sequences as depicted in SEQ ID NOs: 317-319 and 323-325, and wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is administered about 1 day before administration of the antibody construct, particularly wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) is etanercept, wherein said at least one dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b), particularly etanercept, is administered about 4 days following administration of said antibody construct.


Item 26: The method of any one of Items 1 to 23, wherein said target antigen is CD33, particularly wherein the antibody construct comprises a first domain that comprises the CDR sequences as depicted in SEQ ID NOs: 317-319 and 323-325, and wherein a first dose of said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is administered before administration of the antibody construct, particularly wherein inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling (c) is tocilicumab, wherein said dose is administered about 1 hour before administration of the antibody construct, optionally before administration of every dose of antibody construct.


Item 27: The method of any one of Items 1 to 23, wherein said target antigen is Flt3, particularly wherein the antibody construct comprises a first domain wherein the CDR sequences are as depicted in SEQ ID NOs: 721 to 726, and wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) is administered about 2 days before administration of the antibody construct, wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) is etanercept.


Item 28: The method of any one of Items 1 to 23, wherein said target antigen is Flt3, wherein the antibody construct comprises a first domain wherein the CDR sequences are as depicted in SEQ ID NOs: 721 to 726, and wherein a first dose of said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is administered before administration of the antibody construct, particularly wherein inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling (c) is tocilicumab, wherein said dose is administered about 1 hour before administration of the antibody construct, optionally before administration of every dose of antibody construct.


Item 29: The method of any one of the preceding Items, further comprising administering at least one corticosteroid and/or a non-glucocorticoidal compound.


Item 30: The method of any one of the preceding Items, wherein said corticostoid is dexamethasone, and/or said non-glucocorticoidal compound is selected from the group comprising natalizumab, PPS, and minocylin.


Item 31: The method of any one of Items 1 to 30, further comprising the administration of a corticoid compound, particularly dexamethasone, before administration of more that one dose of said antibody construct.


Item 32: The method of any one of Items 1 to 23 and 29 to 31, wherein the target antigen is CD19 and the cancer is a leukemia, particularly ALL.


Item 33: The method of any one of Items 1 to 26 and 29 to 32, wherein the target antigen is CD33 and the cancer is a leukemia, particularly AML.


Item 34: The method of any one of Items 1 to 23 and 27 to 32, wherein the target antigen is Flt3 and the cancer is a leukemia, particularly AML.


Item 35: The method of any one of Items 1 to 23 and 29 to 31, wherein the target antigen is PSMA and the cancer is a solid tumor, particularly prostate cancer or a cancer originating from a prostate cancer.


Item 36: The method of any one of Items 1 to 23 and 29 to 31, wherein the target antigen is DLL3 and the cancer is a solid tumor selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, or a lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing.


Item 37: The method of any one of Items 1 to 25, 27, and 29 to 36, wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is etanercept, particularly wherein the dosage is administered subcutaneously.


Item 38: The method of any one of Items 1 to 25, 27, and 29 to 37, wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is etanercept and the dosage is administered subcutaneously at a dose of between 10 mg to 100 mg.


Item 39: The method of any one of Items 1 to 24, 26, and 29 to 36, wherein the inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is tocilizumab, particularly wherein the dosage is administered intravenously.


Item 40: The method of any one of Items 1 to 24, 26, 29 to 36, and 39, wherein the inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is tocilizumab and the dosage is administered intravenously or at 1 mg/kg to 20 mg/kg.


Item 41: The method of any one of the preceding Items 1 to 40, wherein the adverse event associated with immunotherapy is associated with increased cytokine release of TNF, IL-1, MCP-1, and/or IL-6, and wherein the group of adverse events optionally further comprises a neurological reaction, particularly one or more selected from the group consisting of: confusion, ataxia, disorientation, dysphasia, aphasia, speech impairment, cerebellar symptoms, tremor, apraxia, seizure, grand mal convulsion, palsy, and balance disorder.


Item 42: The method of any one of the preceding Items 1-41, wherein the domain of said antibody construct that binds to CD3, binds to human CD3 epsilon and to Callithrix jacchus or Saimiri sciureus CD3 epsilon.


Item 43: The method of any one of the preceding Items 1 to 42, wherein

    • a) the antibody construct is a single chain antibody construct,
    • b) the first domain is in the format of an scFv,
    • c) the second domain is in the format of an scFv,
    • d) the first and the second domain are connected via a linker, and/or
    • e) the antibody construct comprises a domain providing an extended serum half-life.


Item 44: The method of any one of the preceding Items 1 to 43, wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b), is selected from the group comprising small molecules, biological molecules, antibodies and derivatives thereof, and aptamers.


Item 45: The method of any one of the preceding Items 1 to 25, 27, 29 to 38, 41 to 44, wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group of TNF inhibitors/antagonists comprising etanercept, infliximab, adalimumab, certolizumab Pergol, and golimumab, particularly etanercept.


Item 46: The method of any one of the preceding Items, wherein said patient is selected from the group of patients at risk of developing adverse events or having an intolerance to at least one of a group comprising corticosteroids, non-glucocorticoidal compounds, IL-6-inhibitors, IL-6R-inhibitors, and/or TNF/TNFR inhibitors different from an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling according to Item 45.


Item 47: The method of any one of the preceding Items, wherein said patient is selected from the group of patients at risk of developing adverse events or having an intolerance to corticosteroids, optionally also wherein the corticosteroid is dexamethasone.


Item 48: The method of any one of the preceding Items, wherein the step of administering an antibody construct that binds selectively to a target antigen on a cancer cell and to human CD3 on the surface of a T cell is the first exposure of said antibody construct.


Item 49: The method of any one of the preceding Items 1 to 47, wherein the step of administering an antibody construct that binds selectively to a target antigen on a cancer cell and to human CD3 on the surface of a T cell is a re-exposure of the patient to said antibody construct.


Definitions

The term “antibody construct” refers to a molecule in which the structure and/or function is/are based on the structure and/or function of an antibody, e.g., of a full-length immunoglobulin molecule. Hence, an antibody construct immunospecifically binds to its target or antigen, and/or it comprises the heavy chain variable region (VH) and/or the light chain variable region (VL) of an antibody, or comprises domains derived therefrom. An antibody construct used according to the invention comprises the minimum structural requirements of an antibody which allow for immunospecific target binding. This minimum requirement may e.g. be defined by the presence of at least three light chain CDRs (i.e. CDR1, CDR2 and CDR3 of the VL region) and/or three heavy chain CDRs (i.e. CDR1, CDR2 and CDR3 of the VH region), preferably of all six CDRs. An antibody construct may hence be characterized by the presence of three or six CDRs in either one or both binding domains, and the skilled person knows where (in which order) those CDRs are located within the binding domain.


The definition of “antibody” according to the invention comprises full-length antibodies, also including camelid antibodies and other immunoglobulins generated by biotechnological or protein engineering methods or processes. These full-length antibodies may be for example monoclonal, recombinant, chimeric, deimmunized, humanized and human antibodies, as well as antibodies from other species such as mouse, hamster, rabbit, rat, goat, or non-human primates.


“Antibody constructs” used in accordance with the present invention may have the structure of a full-length immunoglobulin as it occurs naturally. For example, they may comprise (at least) two full-length antibody heavy chains and two full-length antibody light chains. However, given that the antibody constructs according used in accordance with the invention comprise one domain binding to a target antigen and another domain binding to CD3, they do not occur naturally, and they are markedly different in their function from naturally occurring products. An antibody construct used in accordance with the invention is hence an artificial “hybrid” molecule comprising at least two distinct binding domains with different specificities. It is emphasized that the antibody constructs disclosed herein may comprise more than two domains, e.g., they may comprise two identical or different target antigen binding domains and another domain binding to CD3. The target antigen binding domains may be identical, i.e. bind the same epitope, or they may bind different epitopes of the same of different target antigens.


“Antibody constructs” used in accordance with the present invention may also comprise fragments of full-length antibodies, such as VH, VHH, VL, (s)dAb, Fv, light chain (VL-CL), Fd (VH-CH1), heavy chain, Fab, Fab′, F(ab′)2 or “r IgG” (“half antibody” consisting of a heavy chain and a light chain). Antibody constructs used in accordance with the invention may also comprise modified fragments of antibodies, also called antibody variants or antibody derivatives. Examples include, but are not limited to, scFv, di-scFv or bi(s)-scFv, scFv-Fc, scFv-zipper, scFab, Fab2, Fab3, diabodies, single chain diabodies, tandem diabodies (Tandab's), tandem di-scFv, tandem tri-scFv, “minibodies” exemplified by a structure which is as follows: (VH-VL-CH3)2, (scFv-CH3)2, ((scFv)2-CH3+CH3), ((scFv)2-CH3) or (scFv-CH3-scFv)2, multibodies such as triabodies or tetrabodies, and single domain antibodies such as nanobodies or single variable domain antibodies comprising merely one variable region, which might be VHH, VH or VL, that specifically binds to an antigen or target independently of other variable regions or domains. Further possible formats of the antibody constructs used in accordance with the invention are cross bodies, maxi bodies, hetero Fc constructs, mono Fc constructs and scFc constructs. Examples for those formats will be described herein below.


Furthermore, the definition of the term “antibody construct” includes bivalent and polyvalent/multivalent constructs as well as bispecific and polyspecific/multispecific constructs, which specifically bind to two, three or more antigenic structures, through distinct binding domains. An antibody construct can have more binding valences than specificities, e.g. in a case where it has two binding domains for the first target and one binding domain for the second target (CD3), or vice versa, in which case the construct is trivalent and bispecific. In general, the term “bispecific” includes the meaning that an antibody construct binds to (at least) two different antigens, a target antigen and CD3.


Moreover, the definition of the term “antibody construct” includes molecules consisting of only one polypeptide chain as well as molecules consisting of two, three, four or more polypeptide chains, which chains can be either identical (homodimers, homotrimers or homo oligomers) or different (heterodimer, heterotrimer or heterooligomer) Examples for the above identified antibodies and their fragments, variants, derivatives and antibody constructs derived therefrom are described inter alia in Harlow and Lane, Antibodies: A laboratory manual, CSHL Press (1988); Kontermann and Dübel, Antibody Engineering, Springer, 2nd ed. 2010; and Little, Recombinant Antibodies for Immunotherapy, Cambridge University Press 2009.


The terms “binding domain” or “domain which binds to . . . ” or “domain” as far as it relates to the herein described “constructs” characterizes in connection with the present invention a domain of the antibody construct which immunospecifically binds to/interacts with/recognizes an epitope on the target or antigen. The structure and function of the first domain (binding to a target antigen), and preferably also the structure and/or function of the second domain (binding to CD3), is/are based on the structure and/or function of an antibody, e.g. of a full-length immunoglobulin molecule. The “binding domain” or “domain which binds to . . . ” may hence comprise the minimum structural requirements of an antibody which allow for immunospecific target binding. This minimum structural requirement of the first domain may e.g. be defined by the presence of at least three light chain CDRs (i.e. CDR1, CDR2 and CDR3 of the VL region) and/or of three heavy chain CDRs (i.e. CDR1, CDR2 and CDR3 of the VH region), preferably of all six CDRs. It is envisaged that the second domain also comprises this minimum structural requirement of an antibody which allow for the immunospecific target binding. More preferably, the second domain also comprises at least three light chain CDRs (i.e. CDR1, CDR2 and CDR3 of the VL region) and/or three heavy chain CDRs (i.e. CDR1, CDR2 and CDR3 of the VH region), preferably all six CDRs. A “domain which binds to” (or a “binding domain”) may typically comprise an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH); however, it does not have to comprise both, but may comprise only one of VH or VL. Fd fragments, for example, often retain some antigen-binding function of the intact antigen-binding domain.


Examples for the format of a “domain which binds to” (or a “binding domain”) include, but are not limited to, full-length antibodies, fragments of full-length antibodies (such as VH, VHH, VL), (s)dAb, Fv, light chain (VL-CL), Fd (VH-CH1), heavy chain, Fab, Fab′, F(ab′)2 or “r IgG” (“half antibody”)), antibody variants or derivatives such as scFv, di-scFv or bi(s)-scFv, scFv-Fc, scFv-zipper, scFab, Fab2, Fab3, diabodies, single chain diabodies, tandem diabodies (Tandab's), tandem di-scFv, tandem tri-scFv, “minibodies” (selected from formats such as (VH-VL-CH3)2, (scFv-CH3)2, ((scFv)2-CH3+CH3)), ((scFv)2-CH3) or (scFv-CH3-scFv)2, multibodies such as triabodies or tetrabodies, and single domain antibodies such as nanobodies or single variable domain antibodies comprising merely one variable region, which might be VHH, VH or VL. Further examples for the format of a “domain which binds to” (or a “binding domain”) include (1) an antibody fragment or variant comprising VL, VH, CL and CH1 (such as Fab); (2) an antibody fragment or variant comprising two linked Fab fragments (such as a F(ab′)2); (3) an antibody fragment or variant comprising VH and CH1 (such as Fd); (4) an antibody fragment or variant comprising VL and CL (such as the light chain); (5) an antibody fragment or variant comprising VL and VH (such as Fv); (5) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which has a VH domain; (6) an antibody variant comprising at least three isolated CDRs of the heavy and/or the light chain; and (7) a single chain Fv (scFv). Examples for embodiments of antibody constructs or binding domains used in accordance with the invention are e.g. described in WO 00/006605, WO 2005/040220, WO 2008/119567, WO 2010/037838, WO 2013/026837, WO 2013/026833, US 2014/0308285, US 2014/0302037, W 02014/144722, WO 2014/151910, and WO 2015/048272.


It is envisaged for the antibody construct used in accordance with the present invention that

    • the antibody construct is a single chain polypeptide or a single chain antibody construct,
    • the first domain is in the format of an scFv,
    • the second domain is in the format of an scFv,
    • the first and the second domain are connected via a linker, preferably a peptide linker, more preferably a glycine/serine linker, and/or
    • the antibody construct comprises at least one domain providing an extended serum half-life, such as an Fc-based domain, which may be located either at the C-terminal or N-terminal end of either the first or the second domain.


The antibody constructs used in accordance with the present invention are preferably “in vitro generated antibody constructs” and/or “recombinant antibody constructs”. In the context of the present invention, the term “in vitro generated” refers to an antibody construct according to the above definition where all or part of the binding domain or of a variable region (e.g., at least one CDR) is generated in a non-immune cell selection, e.g., in an in vitro phage display, on a protein chip or in any other method in which candidate amino acid sequences can be tested for their ability to bind to an antigen. This term thus preferably excludes sequences generated solely by genomic rearrangement in an immune cell in an animal. It is envisaged that the first and/or second domain of the antibody construct is produced by or obtainable by phage display or library screening methods rather than by grafting CDR sequences from a pre-existing (monoclonal) antibody into a scaffold. A “recombinant antibody construct” is an antibody construct generated or produced using (inter alia) recombinant DNA technology or genetic engineering.


The antibody constructs used in accordance with the present invention are envisaged to be monoclonal. As used herein, antibodies or antibody constructs that are denominated “monoclonal” (mAb) are obtained from a population of substantially homogeneous antibodies/antibody constructs, i.e., the individual antibodies/antibody constructs comprised in the population are identical (in particular with respect to their amino acid sequence) except for possible naturally occurring mutations and/or post-translational modifications (e.g., isomerizations, amidations) that may be present in minor amounts. Monoclonal antibodies/antibody constructs are highly specific, being directed against a single epitope within the antigen, in contrast to polyclonal antibody preparations which typically include different antibodies directed against different determinants (or epitopes). In addition to their specificity, monoclonal antibodies are advantageous in that they are synthesized by the hybridoma culture, hence uncontaminated by other immunoglobulins. The modifier “monoclonal” indicates the character of the antibody/antibody construct as being obtained from a substantially homogeneous population of antibodies and is not to be construed as requiring production of the antibody by any specific method.


For the preparation of monoclonal antibodies, any technique providing antibodies produced by continuous cell line cultures can be used. For example, monoclonal antibodies to be used may be made by the hybridoma method first described by Koehler et al., Nature, 256: 495 (1975), or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567). Examples for further techniques to produce human monoclonal antibodies include the trioma technique, the human B-cell hybridoma technique (Kozbor, Immunology Today 4 (1983), 72) and the EBV-hybridoma technique (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc. (1985), 77-96).


Hybridomas can then be screened using standard methods, such as enzyme-linked immunosorbent assay (ELISA) and surface plasmon resonance (BIACORE™) analysis, to identify one or more hybridomas that produce an antibody that immunospecifically binds to a specified antigen. Any form of the relevant antigen may be used as the immunogen, e.g., recombinant antigen, naturally occurring forms, any variants or fragments thereof, as well as an antigenic peptide thereof. Surface plasmon resonance as employed in the BIAcore™ system can be used to increase the efficiency of phage antibodies/antibody constructs which bind to an epitope of a target antigen (Schier, Human Antibodies Hybridomas 7 (1996), 97-105; Malmborg, J. Immunol. Methods 183 (1995), 7-13).


Another exemplary method of making antibody constructs or binding domains includes screening protein expression libraries, e.g., phage display or ribosome display libraries. Phage display is described, for example, in Ladner et al., U.S. Pat. No. 5,223,409; Smith (1985) Science 228:1315-1317, Clackson et al., Nature, 352: 624-628 (1991) and Marks et al., J. Mol. Biol., 222: 581-597 (1991).


In addition to the use of display libraries, the relevant antigen can be used to immunize a non-human animal, e.g., a rodent (such as a mouse, hamster, rabbit or rat). In one embodiment, the non-human animal includes at least a part of a human immunoglobulin gene. For example, it is possible to engineer mouse strains deficient in mouse antibody production with large fragments of the human Ig (immunoglobulin) loci. Using the hybridoma technology, antigen-specific monoclonal antibodies derived from the genes with the desired specificity may be produced and selected. See, e.g., Xenomouse™, Green et al. (1994) Nature Genetics 7:13-21, US 2003-0070185, WO 96/34096, and WO 96/33735.


A monoclonal antibody can also be obtained from a non-human animal, and then modified, e.g., humanized, deimmunized, rendered chimeric etc., using recombinant DNA techniques known in the art. Examples of modified antibody constructs or binding domains include humanized variants of non-human antibodies/antibody constructs, “affinity matured” antibody constructs or binding domains (see, e.g. Hawkins et al. J. Mol. Biol. 254, 889-896 (1992) and Lowman et al., Biochemistry 30, 10832-10837 (1991)) and antibody variants or mutants with altered effector function(s) (see, e.g., U.S. Pat. No. 5,648,260, Kontermann and Dübel (2010), loc. cit. and Little (2009), loc. cit.).


In immunology, affinity maturation is the process by which B cells produce antibodies with increased affinity for antigen during the course of an immune response. With repeated exposures to the same antigen, a host will produce antibodies of successively greater affinities. Like the natural prototype, the in vitro affinity maturation is based on the principles of mutation and selection. The in vitro affinity maturation has successfully been used to optimize antibodies, antibody fragments, antibody variants, antibody constructs or binding domains. Random mutations inside the CDRs are introduced using radiation, chemical mutagens or error-prone PCR. In addition, the genetic diversity can be increased by chain shuffling. Two or three rounds of mutation and selection using display methods like phage display usually results in antibodies, antibody fragments, antibody variants, antibody constructs or binding domains with affinities in the low nanomolar range.


A preferred type of an amino acid substitutional variation of the antibody constructs or binding domains used in accordance with the invention involves substituting one or more residues within the hypervariable region of a parent antibody structure (e.g. a humanized or human antibody structure). Generally, the resulting variant(s) selected for further development will have improved biological properties relative to the parent antibody structure from which they are generated. A convenient way for generating such substitutional variants involves affinity maturation using phage display. Briefly, several sites of the hypervariable region (e. g. 6-7 sites) are mutated to generate all possible amino acid substitutions at each site. The variants thus generated are displayed in a monovalent fashion from filamentous phage particles as fusions to the gene III product of M13 packaged within each particle. The phage-displayed variants are then screened for their biological activity (e.g. binding affinity) as disclosed herein. To identify candidate hypervariable region sites contributing significantly to antigen binding (candidates for modification), alanine scanning mutagenesis can also be performed. Alternatively, or additionally, it may be beneficial to analyze a crystal structure of the complex between the antigen and the antibody construct or the binding domain to identify contact points between the binding domain and its specific antigen. Such contact residues and neighbouring residues are candidates for substitution according to the techniques elaborated herein. Once such variants are generated, the panel of variants is subjected to screening as described herein and antibodies, their antigen-binding fragments, antibody constructs or binding domains with superior properties in one or more relevant assays may be selected for further development.


The antibody constructs and binding domains used in accordance with the present invention specifically include “chimeric” versions in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is/are identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments or variants of such antibodies, so long as they exhibit the desired biological activity (U.S. Pat. No. 4,816,567; Morrison et al., Proc. Natl. Acad. Sci. USA, 81: 6851-6855 (1984)). Chimeric antibody constructs or binding domains of interest herein include “primitized” antibody constructs comprising variable domain antigen-binding sequences derived from a non-human primate (e.g., Old World Monkey, Ape etc.) and human constant region sequences. A variety of approaches for making chimeric antibodies or antibody constructs have been described. See e.g., Morrison et al., Proc. Natl. Acad. ScL U.S.A. 81:6851, 1985; Takeda et al., Nature 314:452, 1985, Cabilly et al., U.S. Pat. No. 4,816,567; Boss et al., U.S. Pat. No. 4,816,397; Tanaguchi et al., EP 0171496; EP 0173494; and GB 2177096.


An antibody, antibody construct, antibody fragment, antibody variant or binding domain may also be modified by specific deletion of human T cell epitopes (a method called “deimmunization”) using methods disclosed for example in WO 98/52976 or WO 00/34317. Briefly, the heavy and light chain variable regions of an antibody, antibody construct or binding domain can be analyzed for peptides that bind to MHC class II; these peptides represent potential T cell epitopes (as defined e.g. in WO 98/52976 and WO 00/34317). For detection of potential T cell epitopes, a computer modeling approach termed “peptide threading” can be applied, and in addition a database of human MHC class II binding peptides can be searched for motifs present in the VH and VL sequences, as described in WO 98/52976 and WO 00/34317. These motifs bind to any of the 18 major MHC class II DR allotypes, and thus constitute potential T cell epitopes. Potential T cell epitopes detected can be eliminated by substituting small numbers of amino acid residues in the variable domains or variable regions, or preferably, by single amino acid substitutions. Typically, conservative substitutions are made. Often, but not exclusively, an amino acid common to a position in human germline antibody sequences may be used. Human germline sequences are disclosed e.g. in Tomlinson, et al. (1992) J. MoI. Biol. 227:776-798; Cook, G. P. et al. (1995) Immunol. Today Vol. 16 (5): 237-242; and Tomlinson et al. (1995) EMBO J. 14: 14:4628-4638. The V BASE directory (www2.mrc-lmb.cam.ac.uk/vbase/list2.php) provides a comprehensive directory of human immunoglobulin variable region sequences (compiled by Tomlinson, L A. et al. MRC Centre for Protein Engineering, Cambridge, UK). These sequences can be used as a source of human sequence, e.g., for framework regions and CDRs. Consensus human framework regions can also be used, for example as described in U.S. Pat. No. 6,300,064.


“Humanized” antibodies, variants or fragments thereof, antibody constructs and binding domains are based on immunoglobulins of mostly human sequences, which contain (a) minimal sequence(s) derived from non-human immunoglobulin. For the most part, humanized antibodies, variants or fragments thereof, antibody constructs and binding domains are based on human immunoglobulins (recipient antibodies) in which residues from a hypervariable region or CDR are replaced by residues from a hypervariable region or CDR of a non-human species (donor antibody) such as a rodent (e.g. mouse, hamster, rat or rabbit) having the desired specificity, affinity, capacity and/or biological activity. In some instances, Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, “humanized” antibodies, variants or fragments thereof, antibody constructs and binding domains as used herein may also comprise residues which are found neither in the recipient antibody nor the donor antibody. These modifications are made to further refine and optimize antibody performance. The humanized antibodies, variants or fragments thereof, antibody constructs and binding domains may also comprise at least a portion of an immunoglobulin constant region (such as Fc), typically that of a human immunoglobulin. For further details, see Jones et al., Nature, 321: 522-525 (1986); Reichmann et al., Nature, 332: 323-329 (1988); and Presta, Curr. Op. Struct. Biol., 2: 593-596 (1992).


Humanized antibodies, variants or fragments thereof, antibody constructs and binding domains can be generated by replacing sequences of the (Fv) variable region that are not directly involved in antigen binding with equivalent sequences from human (Fv) variable regions. Exemplary methods for generating such molecules are provided by Morrison (1985) Science 229:1202-1207; by Oi et al. (1986) BioTechniques 4:214; and by U.S. Pat. Nos. 5,585,089; 5,693,761; 5,693,762; 5,859,205; and 6,407,213. These methods include isolating, manipulating, and expressing the nucleic acid sequences that encode all or part of immunoglobulin (Fv) variable regions from at least one of a heavy or light chain. Such nucleic acids may be obtained from a hybridoma producing an antibody against a predetermined target, as described above, as well as from other sources. The recombinant DNA encoding the humanized antibody, variant or fragment thereof, antibody construct or binding domain can then be cloned into an appropriate expression vector.


Humanized antibodies, variants or fragments thereof, antibody constructs and binding domains may also be produced using transgenic animals such as mice that express human heavy and light chain genes but are incapable of expressing the endogenous mouse immunoglobulin heavy and light chain genes. Winter describes an exemplary CDR grafting method that may be used to prepare the humanized molecules described herein (U.S. Pat. No. 5,225,539). All the CDRs of a given human sequence may be replaced with at least a portion of a non-human CDR, or only some of the CDRs may be replaced with non-human CDRs. It is only necessary to replace the number of CDRs required for binding of the humanized molecule to a predetermined antigen.


A humanized antibody, variant or fragment thereof, antibody construct or binding domain can be optimized by the introduction of conservative substitutions, consensus sequence substitutions, germline substitutions and/or back mutations. Such altered immunoglobulin molecules can be made by any of several techniques known in the art, (e.g., Teng et al., Proc. Natl. Acad. Sci. U.S.A., 80: 7308-7312, 1983; Kozbor et al., Immunology Today, 4: 7279, 1983; Olsson et al., Meth. Enzymol., 92: 3-16, 1982, and EP 239 400).


Human anti-mouse antibody (HAMA) responses have led the industry to prepare chimeric or otherwise humanized antibodies/antibody constructs. It is however expected that certain human anti-chimeric antibody (HACA) responses will be observed, particularly in chronic or multi-dose utilizations of an antibody or antibody construct. Thus, it would be desirable to provide antibody constructs comprising a human binding domain against a target antigen and/or a human binding domain against CD3, in order to vitiate concerns and/or effects of HAMA or HACA response.


Therefore, according to one embodiment, the antibody construct, the first binding domain and/or the second binding domain are “human”. The term “human antibody”, “human antibody construct” and “human binding domain” includes antibodies, antibody constructs and binding domains, respectively, having antibody-derived regions such as variable and constant regions or domains which correspond substantially to human germline immunoglobulin sequences known in the art, including, for example, those described by Kabat et al. (1991) (loc. cit.). The human antibody constructs or binding domains used in accordance with the invention may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs, and particularly in CDR3. The human antibody constructs or binding domains can have at least one, two, three, four, five, or more positions replaced with an amino acid residue that is not encoded by the human germline immunoglobulin sequence. The definition of human antibodies, antibody constructs and binding domains as used herein also contemplates fully human antibodies, antibody constructs and binding domains which include only non-artificially and/or genetically altered human sequences of antibodies as those can be derived by using technologies or systems such as the Xenomouse.


Antibody constructs comprising at least one human binding domain avoid some of the problems associated with antibodies or antibody constructs that possess non-human such as rodent (e.g. murine, rat, hamster or rabbit) variable and/or constant regions. The presence of such rodent derived proteins can lead to the rapid clearance of the antibodies or antibody constructs or can lead to the generation of an immune response against the antibody or antibody construct by a patient. To avoid the use of rodent-derived antibody constructs, humanized or fully human antibody constructs can be generated through the introduction of human antibody functions into a rodent so that the rodent produces fully human antibodies.


The ability to clone and reconstruct megabase-sized human loci in YACs and to introduce them into the mouse germline provides a powerful approach to elucidating the functional components of very large or crudely mapped loci as well as generating useful models of human disease. Furthermore, the use of such technology for substitution of mouse loci with their human equivalents could provide unique insights into the expression and regulation of human gene products during development, their communication with other systems, and their involvement in disease induction and progression.


An important practical application of such a strategy is the “humanization” of the mouse humoral immune system. Introduction of human immunoglobulin (Ig) loci into mice in which the endogenous Ig genes have been inactivated offers the opportunity to study the mechanisms underlying programmed expression and assembly of antibodies as well as their role in B-cell development. Furthermore, such a strategy could provide an ideal source for production of fully human monoclonal antibodies (mAbs)—an important milestone towards fulfilling the promise of antibody therapy in human disease. Fully human antibodies or antibody constructs derived therefrom are expected to minimize the immunogenic and allergic responses intrinsic to mouse or mouse-derivatized mAbs and thus to increase the efficacy and safety of the administered antibodies/antibody constructs. The use of fully human antibodies or antibody constructs can be expected to provide a substantial advantage in the treatment of chronic and recurring human diseases, such as inflammation, autoimmunity, and cancer, which require repeated compound administrations.


One approach towards this goal was to engineer mouse strains deficient in mouse antibody production with large fragments of the human Ig loci in anticipation that such mice would produce a large repertoire of human antibodies in the absence of mouse antibodies. Large human Ig fragments would preserve the large variable gene diversity as well as the proper regulation of antibody production and expression. By exploiting the mouse machinery for antibody diversification and selection and the lack of immunological tolerance to human proteins, the reproduced human antibody repertoire in these mouse strains should yield high affinity antibodies against any antigen of interest, including human antigens. Using the hybridoma technology, antigen-specific human mAbs with the desired specificity could be readily produced and selected. This general strategy was demonstrated in connection with the generation of the first XenoMouse mouse strains (see Green et al. Nature Genetics 7:13-21 (1994)). The XenoMouse strains were engineered with yeast artificial chromosomes (YACs) containing 245 kb and 190 kb-sized germline configuration fragments of the human heavy chain locus and kappa light chain locus, respectively, which contained core variable and constant region sequences. The human Ig containing YACs proved to be compatible with the mouse system for both rearrangement and expression of antibodies and were capable of substituting for the inactivated mouse Ig genes. This was demonstrated by their ability to induce B cell development, to produce an adult-like human repertoire of fully human antibodies, and to generate antigen-specific human mAbs. These results also suggested that introduction of larger portions of the human Ig loci containing greater numbers of V genes, additional regulatory elements, and human Ig constant regions might recapitulate substantially the full repertoire that is characteristic of the human humoral response to infection and immunization. The work of Green et al. was extended to the introduction of greater than approximately 80% of the human antibody repertoire through introduction of megabase sized, germline configuration YAC fragments of the human heavy chain loci and kappa light chain loci, respectively. See Mendez et al. Nature Genetics 15:146-156 (1997) and U.S. patent application Ser. No. 08/759,620.


The production of the XenoMouse model is further discussed and delineated in U.S. patent application Ser. No. 07/466,008, Ser. No. 07/610,515, Ser. No. 07/919,297, Ser. No. 07/922,649, Ser. No. 08/031,801, Ser. No. 08/112,848, Ser. No. 08/234,145, Ser. No. 08/376,279, Ser. No. 08/430,938, Ser. No. 08/464,584, Ser. No. 08/464,582, Ser. No. 08/463,191, Ser. No. 08/462,837, Ser. No. 08/486,853, Ser. No. 08/486,857, Ser. No. 08/486,859, Ser. No. 08/462,513, Ser. No. 08/724,752, and Ser. No. 08/759,620; and U.S. Pat. Nos. 6,162,963; 6,150,584; 6,114,598; 6,075,181, and 5,939,598 and Japanese Patent Nos. 3 068 180 B2, 3 068 506 B2, and 3 068 507 B2. See also Mendez et al. Nature Genetics 15:146-156 (1997) and Green and Jakobovits J. Exp. Med. 188:483-495 (1998), EP 0 463 151 B1, WO 94/02602, WO 96/34096, WO 98/24893, WO 00/76310, and WO 03/47336.


In an alternative approach, others, including GenPharm International, Inc., have utilized a “minilocus” approach. In the minilocus approach, an exogenous Ig locus is mimicked through the inclusion of pieces (individual genes) from the Ig locus. Thus, one or more VH genes, one or more DH genes, one or more JH genes, a mu constant region, and a second constant region (preferably a gamma constant region) are formed into a construct for insertion into an animal. This approach is described in U.S. Pat. No. 5,545,807 to Surani et al. and U.S. Pat. Nos. 5,545,806; 5,625,825; 5,625,126; 5,633,425; 5,661,016; 5,770,429; 5,789,650; 5,814,318; 5,877,397; 5,874,299; and 6,255,458 each to Lonberg and Kay, U.S. Pat. Nos. 5,591,669 and 6,023,010 to Krimpenfort and Berns, U.S. Pat. Nos. 5,612,205; 5,721,367; and U.S. Pat. No. 5,789,215 to Berns et al., and U.S. Pat. No. 5,643,763 to Choi and Dunn, and GenPharm International U.S. patent application Ser. No. 07/574,748, Ser. No. 07/575,962, Ser. No. 07/810,279, Ser. No. 07/853,408, Ser. No. 07/904,068, Ser. No. 07/990,860, Ser. No. 08/053,131, Ser. No. 08/096,762, Ser. No. 08/155,301, Ser. No. 08/161,739, Ser. No. 08/165,699, Ser. No. 08/209,741. See also EP 0 546 073 B1, WO 92/03918, WO 92/22645, WO 92/22647, WO 92/22670, WO 93/12227, WO 94/00569, WO 94/25585, WO 96/14436, WO 97/13852, and WO 98/24884 and U.S. Pat. No. 5,981,175. See further Taylor et al. (1992), Chen et al. (1993), Tuaillon et al. (1993), Choi et al. (1993), Lonberg et al. (1994), Taylor et al. (1994), and Tuaillon et al. (1995), Fishwild et al. (1996).


Kirin has also demonstrated the generation of human antibodies from mice in which, through microcell fusion, large pieces of chromosomes, or entire chromosomes, have been introduced. See European Patent Application Nos. 773 288 and 843 961. Xenerex Biosciences is developing a technology for the potential generation of human antibodies. In this technology, SCID mice are reconstituted with human lymphatic cells, e.g., B and/or T cells. Mice are then immunized with an antigen and can generate an immune response against the antigen. See U.S. Pat. Nos. 5,476,996; 5,698,767; and 5,958,765.


In some embodiments, the antibody constructs used in accordance with the invention are “isolated” or “substantially pure” antibody constructs. “Isolated” or “substantially pure”, when used to describe the antibody constructs disclosed herein, means an antibody construct that has been identified, separated and/or recovered from a component of its production environment. Preferably, the antibody construct is free or substantially free of association with all other components from its production environment. Contaminant components of its production environment, such as that resulting from recombinant transfected cells, are materials that could interfere with diagnostic or therapeutic uses for the antibody construct, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous compounds. It is understood that the isolated or substantially pure antibody construct may constitute from 5% to 99.9% by weight of the total protein/polypeptide content in a given sample, depending on the circumstances. The desired antibody construct may be produced at a significantly higher concentration using an inducible promoter or high expression promoter. The definition includes the production of an antibody construct in a wide variety of organisms and/or host cells that are known in the art. In certain embodiments, the antibody construct will be purified (1) to a degree enough to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (2) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie Blue or, preferably, silver staining. Usually, however, an isolated antibody construct will be prepared by at least one purification step.


According to one embodiment, the entire antibody construct and/or the binding domains are in the form of one or more polypeptides or in the form of proteins. In addition to proteinaceous parts, such polypeptides or proteins may include non-proteinaceous parts (e.g. chemical linkers or chemical crosslinking agents such as glutaraldehyde).


Peptides are short chains of amino acid monomers linked by covalent peptide (amide) bonds. Hence, peptides fall under the broad chemical classes of biological oligomers and polymers. Amino acids that are part of a peptide or polypeptide chain are termed “residues” and can be consecutively numbered. All peptides except cyclic peptides have an N-terminal residue at one end and a C-terminal residue at the other end of the peptide. An oligopeptide consists of only a few amino acids (usually between two and twenty). A polypeptide is a longer, continuous, and unbranched peptide chain. Peptides are distinguished from proteins on the basis of size, and as an arbitrary benchmark can be understood to contain approximately 50 or fewer amino acids. Proteins consist of one or more polypeptides, usually arranged in a biologically functional way. While aspects of the lab techniques applied to peptides versus polypeptides and proteins differ (e.g., the specifics of electrophoresis, chromatography, etc.), the size boundaries that distinguish peptides from polypeptides and proteins are not absolute. Therefore, in the context of the present invention, the terms “peptide”, “polypeptide” and “protein” may be used interchangeably, and the term “polypeptide” is often preferred.


Polypeptides may further form multimers such as dimers, trimers and higher oligomers, which consist of more than one polypeptide molecule. Polypeptide molecules forming such dimers, trimers etc. may be identical or non-identical. The corresponding structures of higher order of such multimers are, consequently, termed homo- or heterodimers, homo- or heterotrimers etc. An example for a hereteromultimer is an antibody or immunoglobulin molecule, which, in its naturally occurring form, consists of two identical light polypeptide chains and two identical heavy polypeptide chains. The terms “peptide”, “polypeptide” and “protein” also refer to naturally modified peptides/polypeptides/proteins wherein the modification is accomplished e.g. by post-translational modifications like glycosylation, acetylation, phosphorylation and the like. A “peptide”, “polypeptide” or “protein” when referred to herein may also be chemically modified such as pegylated. Such modifications are well known in the art and described herein below.


The terms “selectively binds to”, “(specifically or immunospecifically) binds to”, “(specifically or immunospecifically) recognizes”, or “(specifically or immunospecifically) reacts with” mean in accordance with this invention that an antibody construct or a binding domain interacts or (immuno-)specifically interacts with a given epitope on the target molecule (antigen) and CD3, respectively. This interaction or association occurs more frequently, more rapidly, with greater duration, with greater affinity, or with some combination of these parameters, to an epitope on the specific target than to alternative substances (non-target molecules). Because of the sequence similarity between homologous proteins in different species, an antibody construct or a binding domain that immunspecifically binds to its target (such as a human target) may, however, cross-react with homologous target molecules from different species (such as, from non-human primates). The term “specific/immunospecific binding” can hence include the binding of an antibody construct or binding domain to epitopes or structurally related epitopes in more than one species.


In the context of the present invention, the term “epitope” refers to the part or region of the antigen that is recognized/immunospecifically recognized by the binding domain. An “epitope” is antigenic, and thus the term epitope is sometimes also referred to as “antigenic structure” or “antigenic determinant”. The part of the binding domain that binds to the epitope is called a paratope. Specific binding is believed to be accomplished by specific motifs in the amino acid sequence of the binding domain and the antigen. Thus, binding is achieved because of their primary, secondary and/or tertiary structure as well as the result of potential secondary modifications of said structures. The specific interaction of the paratope with its antigenic determinant may result in a simple binding of said site to the antigen. In some cases, the specific interaction may alternatively or additionally result in the initiation of a signal, e.g. due to the induction of a change of the conformation of the antigen, an oligomerization of the antigen, etc.


The epitopes of protein antigens are divided into two categories, conformational epitopes and linear epitopes, based on their structure and interaction with the paratope. A conformational epitope is composed of discontinuous sections of the antigen's amino acid sequence. These epitopes interact with the paratope based on the three-dimensional surface features and shape or tertiary structure (folding) of the antigen. Methods of determining the conformation of epitopes include, but are not limited to, x-ray crystallography, two-dimensional nuclear magnetic resonance (2D-NMR) spectroscopy and site-directed spin labelling and electron paramagnetic resonance (EPR) spectroscopy. By contrast, linear epitopes interact with the paratope based on their primary structure. A linear epitope is formed by a continuous sequence of amino acids from the antigen and typically includes at least 3 or at least 4, and more usually, at least 5 or at least 6 or at least 7, for example, about 8 to about 10 amino acids in a unique sequence.


A method for epitope mapping is described in the following: A pre-defined region (a contiguous amino acid stretch) within the target protein is exchanged/replaced, preferably with a corresponding region, of a different or even a similar (e.g., a homologous) non-target antigen peptide fragment provided that the binding domain is not cross-reactive with the non-target antigen peptide fragment. These chimeras are expressed on the surface of host cells (such as CHO cells). Binding of the antibody or antibody construct can be tested via FACS analysis. When the binding of the antibody or antibody construct to the chimeric molecule is entirely abolished, or when a significant binding decrease is observed, it can be concluded that the region of the target antigen which was removed from this chimeric molecule is relevant for the immunospecific epitope-paratope recognition. Said decrease in binding is preferably at least 10%, 20%, 30%, 40%, or 50%; more preferably at least 60%, 70%, or 80%, and most preferably 90%, 95% or even 100% in comparison to the binding to the non-modified (wild-type) target antigen, which is set to be 100%. Alternatively, the above described epitope mapping analysis can be modified by introducing one or multiple point mutations into the sequence of the target antigen. These point mutations can e.g. reflect the differences between the target antigen and a similar (e.g., a homologous) polypeptide.


A further method to determine the contribution of a specific residue of a target antigen to the recognition by an antibody construct or binding domain is alanine scanning (see e.g. Morrison K L & Weiss G A. Curr Opin Chem Biol. 2001 June; 5(3):302-7), where each residue to be analyzed is replaced by alanine, e.g. via site-directed mutagenesis. Alanine is used because of its non-bulky, chemically inert, methyl functional group that nevertheless mimics the secondary structure references that many of the other amino acids possess. Sometimes bulky amino acids such as valine or leucine can be used in cases where conservation of the size of mutated residues is desired.


The interaction between the binding domain and the epitope of the target antigen implies that a binding domain exhibits appreciable or significant affinity for the epitope/the target antigen and, generally, does not exhibit significant affinity for proteins or antigens other than the target antigen— notwithstanding the above discussed cross-reactivity with homologous targets e.g. from other species. “Significant affinity” includes binding with an affinity (dissociation constant, KD) of ≤10-6 M. Preferably, binding is considered specific when the binding affinity is ≤10-7 M, ≤10-8 M, ≤10-9 M, ≤10-10 M, or even ≤10-11 M, or ≤10-12 M. Whether a binding domain (immuno-)specifically reacts with or binds to a target can be tested readily e.g. by comparing the affinity of said binding domain to its desired target protein or antigen with the affinity of said binding domain to non-target proteins or antigens. Preferably, an antibody construct used in accordance with the invention does not significantly bind to proteins or antigens other than target antigen(s) or CD3, respectively—unless any further binding domain(s) directed against a further target is/are deliberately introduced into the antibody construct used in accordance with the invention, in which case the binding of that binding domain to its specific target is also provided by the present invention.


It is envisaged that the affinity of the first domain for the target antigen(s) is ≤100 nM, ≤90 nM, ≤80 nM, ≤70 nM, ≤60 nM, ≤50 nM, ≤40 nM, ≤30 nM, or ≤20 nM. These values are preferably measured in a cell-based assay, such as a Scatchard assay. See Example 4. Other methods of determining the affinity are also well-known. It is furthermore envisaged that the affinity of the second domain for CD3 (e.g. CD3, preferably human CD3) is ≤100 nM, ≤90 nM, ≤80 nM, ≤70 nM, ≤60 nM, ≤50 nM, ≤40 nM, ≤30 nM, ≤20 nM, or ≤10 nM. These values are preferably measured in a surface plasmon resonance assay, such as a Biacore assay.


The term “does not significantly bind” means that an antibody construct or binding domain used in accordance with the present invention does not bind to a protein or antigen other than the target antigen(s) or CD3, when said protein or antigen is expressed on the surface of a cell. The antibody construct hence shows reactivity of ≤30%, preferably ≤20%, more preferably ≤10%, particularly preferably ≤9%, ≤8%, ≤7%, ≤6%, ≤5%, ≤4%, ≤3%, ≤2%, or ≤1% with proteins or antigens other than the target antigen(s) or CD3 (when said proteins or antigens are expressed on the surface of a cell), whereby binding to the target antigen(s) or CD3, respectively, is set to be 100%. The “reactivity” can e.g. be expressed in an affinity value (see above).


It is envisaged that the antibody construct used in accordance with the invention (and more specifically its first domain) does not bind or does not significantly bind to the target antigen(s) homologues, more specifically to human the target antigen(s) homologues and/or to macaque/cyno the target antigen(s) homologues. It is also envisaged that the antibody construct does not bind or does not significantly bind to (human or macaque/cyno) the target antigen(s) homologues on the surface of a target cell. It is hence envisaged that the first domain of the antibody construct used in accordance with the invention does not bind or does not significantly bind to similar, but different (e.g., homologous) antigen(s), preferably on the surface of a target cell.


The first domain of the antibody construct used in accordance with the invention binds to the target antigen(s) on the surface of a target cell. The “target cell” can be any prokaryotic or eukaryotic cell expressing the target antigen(s) on its surface; preferably the target cell is a cell that is part of the human or animal body, such as a specific the target antigen(s)-expressing cancer or tumor cell or a cell of target antigen-positive neoplasm. The first domain may hence bind to the target antigen(s) expressed by naturally expressing cells or cell lines (such as human cancer lines), and/or by cells or cell lines transformed or (stably/transiently) transfected with nucleic acids encoding the target antigen(s). In one embodiment, the first domain binds to the target antigen(s) is used as a target molecule in a cell-based binding assay such as Scatchard. It is furthermore envisaged that the antibody construct/its first domain binds to human the target antigen(s) on the surface of a target cell. In this connection, the term “target antigen” relates to a molecular structure, e.g. a protein or a part thereof that is specifically recognized on a target cell. The target may be a tumor antigen, a neo antigen, an antigen that is usually not found on a differentiated cell, e.g. a protein that is a characteristic marker for a cancer cell, a neoplastic cell, or a cell that expresses an antigen that is foreign to the host body, e.g. a viral or bacterial antigen, for example an oncoviral antigen that is associated with an infection of a cell by an oncovirus, which is the causative agent for the proliferation of an infected cell by cell division, wherein the cell would normally, under non-infected conditions, no longer or not at all, proliferate, e.g., cells infected by oncogenic viruses, such as human papillomaviruses, hepatitis viruses, etc., that proliferate and give rise to neoplastic tissues.


Whether or not an antibody, antibody construct or binding domain binds to the same epitope of the target antigen(s) on the surface of a target cell as another given antibody, antibody construct or binding domain can be measured by different analyses as described herein, e.g. by epitope mapping with chimeric or mutated target antigen molecules, as described herein above. Other methods of determining epitopes are described herein, such as alanine scanning.


Whether or not an antibody or antibody construct competes for binding to an antigen on the surface of a target cell with another given antibody or antibody construct can be measured in a competition assay such as a competitive ELISA. Avidin-coupled microparticles (beads) can also be used. Similarly, to an avidin-coated ELISA plate, when reacted with a biotinylated protein, each of these beads can be used as a substrate on which an assay can be performed. Antigen is coated onto a bead and then precoated with the first antibody. The second antibody is added, and any additional binding is determined. Read-out occurs via flow cytometry. Preferably a cell-based competition assay is used, using either cells that naturally express the target antigen(s) or cells that were stably or transiently transformed with nucleic acids encoding the target antigen(s). The term “competes for binding”, in the present context, means that competition occurs between the two tested antibodies of at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90%, as determined by any one of the assays disclosed above, preferably the cell-based assay. The same analysis can of course be applied for other targets such as CD3.


Competitive antibody binding assays include assays determining the competitive binding of two antibodies/antibody constructs to a cell surface bound antigen. Common methods aim to detect binding of two antibodies/antibody constructs, A and B, to the same antigen on the surface of a cell may include steps of: blocking of the cell surface antigen by pre-incubation of cells with antibody/antibody construct A followed by a sub-maximal addition of labeled antibody/antibody construct B and detecting the binding of B compared with binding in the absence of A; titration (i.e. adding different amounts) of antibody/antibody construct A in the presence of sub-maximal amounts of labeled antibody/antibody construct B and detecting the effect on binding of B; or co-titration of A and B, wherein both antibodies/antibody constructs are incubated together at maximal concentration and detecting whether the total binding equals or exceeds that of either A or B alone, i.e. a method which cannot be affected by the order of addition or relative amounts of the antibodies/antibody constructs.


When two antibodies/antibody constructs A and B compete for a cell surface bound antigen, the antibodies will very often compete in blocking assays independently from the order of the addition of the antibodies. In other words, competition is detected if the assay is carried out in either direction. However, this is not always the case, and under certain circumstances the order of the addition of the antibodies or the direction of the assay may influence the signal generated. This may be due to differences in affinities or avidities of the potentially competing antibodies/antibody constructs. If the order of the addition has a significant effect on the signal generated, it is concluded that the two antibodies/antibody constructs do compete if competition is detected in at least one order.


In the context of the present invention, the term “variable” refers to those portions of antibody or immunoglobulin domains that exhibit variability in their sequence and that are involved in determining the specificity and binding affinity of a particular antibody (i.e., the “variable region(s)”). Usually, the pairing of a heavy chain variable region (VH) and a light chain variable region (VL) together forms a single antigen-binding site.


Variability is not evenly distributed throughout the variable regions of antibodies; it is concentrated in sub-domains of each of the heavy and light chain variable regions. These sub-domains are called “hypervariable regions” or “complementarity determining regions” (CDRs). The more conserved (i.e., non-hypervariable) portions of the variable regions are called the “framework” (FR) regions and provide a scaffold for the six CDRs in three-dimensional space to form an antigen-binding surface. The variable regions of naturally occurring antibody heavy and light chains each comprise four FR regions (FR1, FR2, FR3, and FR4), largely adopting a β-sheet configuration. Together with the CDRs, they form the following sequence within a variable heavy or light chain: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4. The hypervariable regions in each chain are held together in proximity by the framework regions and, usually together with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site (see Kabat et al., loc. cit.).


The terms “CDR”, and its plural “CDRs”, refer to the complementarity determining region of which three make up the binding character of a light chain variable region (CDR-L1, CDR-L2 and CDR-L3) and three make up the binding character of a heavy chain variable region (CDR-H1, CDR-H2 and CDR-H3). CDRs contain most of the residues responsible for specific interactions of the antibody (or antibody construct or binding domain) with the antigen and hence contribute to the functional activity of an antibody molecule: they are the main determinants of antigen specificity.


The exact definition of CDR boundaries and lengths is subject to different classification and numbering systems. CDRs may therefore be referred to by Kabat, Chothia, contact or any other boundary definitions, including the numbering system described herein. Despite differing boundaries, each of these systems has some degree of overlap in what constitutes the so called “hypervariable regions” within the variable sequences. CDR definitions according to these systems may therefore differ in length and boundary areas with respect to the adjacent framework region. See for example Kabat (an approach based on cross-species sequence variability), Chothia (an approach based on crystallographic studies of antigen-antibody complexes), and/or MacCallum (Kabat et al., loc. cit.; Chothia et al., J. MoI. Biol, 1987, 196: 901-917; and MacCallum et al., J. Mol. Biol, 1996, 262: 732). Still another standard for characterizing the antigen binding site is the AbM definition used by Oxford Molecular's AbM antibody modeling software. See, e.g., Protein Sequence and Structure Analysis of Antibody Variable Domains. In: Antibody Engineering Lab Manual (Ed.: Duebel, S. and Kontermann, R., Springer-Verlag, Heidelberg). To the extent that two residue identification techniques define regions of overlapping, but not identical regions, they can be combined to define a hybrid CDR. However, the numbering in accordance with the so-called Kabat system is preferred.


Typically, CDRs form a loop structure that can be classified as a canonical structure. The term “canonical structure” refers to the main chain conformation that is adopted by the antigen binding (CDR) loops. From comparative structural studies, it has been found that five of the six antigen binding loops have only a limited repertoire of available conformations. Each canonical structure can be characterized by the torsion angles of the polypeptide backbone. Corresponding loops between antibodies may, therefore, have very similar three-dimensional structures, despite high amino acid sequence variability in most parts of the loops (Chothia and Lesk, J. Mol. Biol., 1987, 196: 901; Chothia et al., Nature, 1989, 342: 877; Martin and Thornton, J. Mol. Biol, 1996, 263: 800). Furthermore, there is a relationship between the adopted loop structure and the amino acid sequences surrounding it. The conformation of a particular canonical class is determined by the length of the loop and the amino acid residues residing at key positions within the loop, as well as within the conserved framework (i.e., outside of the loop). Assignment to a particular canonical class can therefore be made based on the presence of these key amino acid residues.


The term “canonical structure” may also include considerations as to the linear sequence of the antibody, for example, as catalogued by Kabat (Kabat et al., loc. cit.). The Kabat numbering scheme (system) is a widely adopted standard for numbering the amino acid residues of an antibody variable region in a consistent manner and is the preferred scheme applied in the present invention as also mentioned elsewhere herein. Additional structural considerations can also be used to determine the canonical structure of an antibody. For example, those differences not fully reflected by Kabat numbering can be described by the numbering system of Chothia et al. and/or revealed by other techniques, for example, crystallography and two- or three-dimensional computational modeling. Accordingly, a given antibody sequence may be placed into a canonical class which allows for, among other things, identifying appropriate class sequences (e.g., based on a desire to include a variety of canonical structures in a library). Kabat numbering of antibody amino acid sequences and structural considerations as described by Chothia et al., loc. cit. and their implications for construing canonical aspects of antibody structure, are described in the literature. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known in the art. For a review of the antibody structure, see Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, eds. Harlow et al., 1988.


The CDR3 of the light chain and, particularly, the CDR3 of the heavy chain may constitute the most important determinants in antigen binding within the light and heavy chain variable regions. In some antibodies or antibody constructs/binding domains, the heavy chain CDR3 appears to constitute the major area of contact between the antigen and the antibody. In vitro selection schemes in which CDR3 alone is varied can be used to vary the binding properties of an antibody or antibody construct/binding domain or determine which residues contribute to the binding of an antigen. Hence, CDR3 is typically the greatest source of molecular diversity within the antibody binding site. CDR-H3, for example, can be as short as two amino acid residues or greater than 26 amino acids.


In a classical full-length antibody or immunoglobulin, each light (L) chain is linked to a heavy (H) chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype. The heavy chain constant (CH) domain most proximal to VH is usually designated as CH1. The constant (“C”) domains are not directly involved in antigen binding, but exhibit various effector functions, such as antibody-dependent cell-mediated cytotoxicity (ADCC) and complement activation (complement dependent cytotoxicity, CDC). The Fc region of an antibody is the “tail” region of a classical antibody that interacts with cell surface receptors called Fc receptors and some proteins of the complement system. In IgG, IgA and IgD antibody isotypes, the Fc region is composed of two identical protein fragments, derived from the second and third constant domains (CH2 and CH3) of the antibody's two heavy chains. IgM and IgE Fc regions contain three heavy chain constant domains (CH2, CH3 and CH4) in each polypeptide chain. The Fc regions also contains part of the so-called “hinge” region held together by one or more disulfides and noncovalent interactions. The Fc region of a naturally occurring IgG bears a highly conserved N-glycosylation site. Glycosylation of the Fc fragment is essential for Fc receptor-mediated activity.


ADCC is a mechanism of cell-mediated immune defense whereby an effector cell of the immune system actively lyses a target cell, whose membrane-surface antigens have been bound by specific antibodies. ADCC requires an immune effector cell which classically is known to be a natural killer (NK) cell that typically interacts with IgG antibodies. However, ADCC can also be mediated by macrophages, neutrophils and eosinophils. ADCC involves activation of effector cells expressing Fc receptors by antibodies expressing an Fc portion. For example, the most common Fc receptor on the surface of an NK cell is calles CD16 or FcγRIII. Once the Fc receptor binds to the Fc region of IgG, the NK cell releases cytotoxic factors that cause the death of the target cell. Likewise, the Fc receptor (FceRI) of an eosinophil will recognize IgE. In CDC, in contrast, the molecule “C1q” of the complement system binds to the antibody Fc region, and this binding triggers the complement cascade which leads to the formation of the membrane attack complex (MAC) at the surface of the target cell, because of the classical pathway complement activation. In therapeutic antibodies or antibody constructs, both ADCC and CDC can be modulated by Fc isotype engineering, Fc genetic mutations, or Fc glycosylation profile modifications.


The sequence of antibody genes after assembly and somatic mutation is highly varied, and these varied genes are estimated to encode 1010 different antibody molecules (Immunoglobulin Genes, 2nd ed., eds. Jonio et al., Academic Press, San Diego, Calif., 1995). Accordingly, the immune system provides a repertoire of immunoglobulins. The term “repertoire” refers to at least one nucleotide sequence derived wholly or partially from at least one sequence encoding at least one immunoglobulin. The sequence(s) may be generated by rearrangement in vivo of the V, D, and J segments of heavy chains, and the V and J segments of light chains. Alternatively, the sequence(s) can be generated from a cell in response to which rearrangement occurs, e.g., in vitro stimulation. Alternatively, part or all the sequence(s) may be obtained by DNA splicing, nucleotide synthesis, mutagenesis, and other methods, see, e.g., U.S. Pat. No. 5,565,332. A repertoire may include only one sequence or may include a plurality of sequences, including ones in a genetically diverse collection.


It is envisaged that the antibody construct has a cysteine clamp within the first domain. This cysteine clamp may be introduced to improve stability of the construct. See e.g. US 2016/0193295.


As described herein above, the invention provides an embodiment wherein the antibody construct is in a format selected from the group consisting of (scFv)2, scFv-single domain mAb, diabodies and oligomers of any of the aforementioned formats. The term “is in a format” does not exclude that the construct can be further modified, e.g. by attachment or fusion to other moieties, as described herein. According to one embodiment of the antibody construct used in accordance with the present invention, the first and/or the second domain are in the format of an scFv. In an scFv, the VH region and the and VL region are arranged in the order VH-VL or VL-VH (from N- to C-terminus). It is envisaged that the VH and the VL regions of the first and/or the second binding domain are connected via a linker, preferably a peptide linker. According to one embodiment of the first and/or the second domain, the VH-region is positioned N-terminally of the linker, and the VL-region is positioned C-terminally of the linker. In other words, in one embodiment of the first and/or the second domain, the scFv comprises from the N-terminus to the C-terminus: VH-linker-VL. It is furthermore envisaged that the first domain and the second domain of the antibody construct are connected via a linker, preferably a peptide linker. The antibody construct may e.g. comprise the domains in the order (from N-terminus to C-terminus) first domain—linker—second domain. The inverse order (second domain—linker—first domain) is also possible.


The linkers are preferably peptide linkers, more preferably short peptide linkers. In accordance with the present invention, a “peptide linker” comprises an amino acid sequence which connects the amino acid sequences of one domain with another (variable and/or binding) domain (e.g. a variable domain or a binding domain) of the antibody construct. An essential technical feature of such peptide linker is that it does not comprise any polymerization activity. Among the suitable peptide linkers are those described in U.S. Pat. Nos. 4,751,180 and 4,935,233 or WO 88/09344. The peptide linkers can also be used to attach other domains or modules or regions (such as half-life extending domains) to the antibody construct used in accordance with the invention. Examples of useful peptide linkers are shown in SEQ ID NOs: 202-215. In the present context, a “short” linker has between 2 and 50 amino acids, preferably between 3 and 35, between 4 and 30, between 5 and 25, between 6 and 20 or between 6 and 17 amino acids. The linker between two variable regions of one binding domain may have a different length (e.g. may be longer) than the linker between the two binding domains. For example, the linker between two variable regions of one binding domain may have a length between 7 and 15 amino acids, preferably between 9 and 13, and the linker between the two binding domains may have a length between 3 and 10 amino acids, preferably between 4 and 8. It is further envisaged that the peptide linkers are glycine/serine linkers, such as those depicted in SEQ ID NOs: 203 and 205-215. Most of the amino acids in glycine/serine linkers are selected from glycine and serine.


If a linker is used, this linker is preferably of a length and sequence that are enough to ensure that each of the first and second domains can, independently from one another, retain their differential binding specificities. For peptide linkers which connect the at least two binding domains (or the two variable regions forming one binding domain) in the antibody construct, those peptide linkers are envisaged which comprise only a few amino acid residues, e.g. 12 amino acid residues or less. Thus, peptide linkers of 12, 11, 10, 9, 8, 7, 6 or 5 amino acid residues are preferred. An envisaged peptide linker with less than 5 amino acids comprises 4, 3, 2 or one amino acid(s), wherein Gly-rich linkers are preferred. A “single amino acid” linker in the context of said “peptide linker” is Gly. Another embodiment of a peptide linker is characterized by the amino acid sequence Gly-Gly-Gly-Gly-Ser, i.e. Gly4Ser (SEQ ID NO: 203), or polymers thereof, i.e. (Gly4Ser)x, where x is an integer of 1 or greater (e.g. 2 or 3). Usable linkers are depicted in SEQ ID NOs: 202-211. The characteristics of said peptide linkers are known in the art and are described e.g. in Dall'Acqua et al. (Biochem. (1998) 37, 9266-9273), Cheadle et al. (Mol Immunol (1992) 29, 21-30) and Raag and Whitlow (FASEB (1995) 9(1), 73-80). Peptide linkers which do not promote any secondary structures are preferred. The linkage of said domains to each other can be provided, e.g., by genetic engineering. Methods for preparing fused and operatively linked bispecific single chain constructs and expressing them in mammalian cells or bacteria are well-known in the art (e.g. WO 99/54440 or Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 2001).


According to one embodiment of the invention, the antibody construct in combination products, or that is used in combination in accordance with the invention is a “single chain antibody construct”. It is also envisaged that either the first or the second or both binding domains may be in the format of a “single chain Fv” (scFv). Although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by an artificial linker—as described hereinbefore—that enables them to be made as a single protein chain in which the VL and VH regions pair to form a monovalent molecule; see e.g., Huston et al. (1988) Proc. Natl. Acad. Sci USA 85:5879-5883). These antibody fragments are obtained using conventional techniques known to those with skill in the art, and the fragments are evaluated for function in the same manner as are full-length antibodies or IgGs. A single-chain variable fragment (scFv) is hence a fusion protein of the variable region of the heavy chain (VH) and of the light chain (VL) of immunoglobulins, usually connected with a short linker peptide. The linker is usually rich in glycine for flexibility, as well as serine or also threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa. This protein retains the specificity of the original immunoglobulin, despite removal of the constant regions and introduction of the linker.


Bispecific single chain molecules are known in the art and are described in WO 99/54440, Mack, J. Immunol. (1997), 158, 3965-3970, Mack, PNAS, (1995), 92, 7021-7025, Kufer, Cancer Immunol. Immunother., (1997), 45, 193-197, Löffler, Blood, (2000), 95, 6, 2098-2103, Brühl, Immunol., (2001), 166, 2420-2426, Kipriyanov, J. Mol. Biol., (1999), 293, 41-56. Techniques described for producing single chain antibody constructs (see, inter alia, U.S. Pat. No. 4,946,778, Kontermann and Dübel (2010), loc. cit. and Little (2009), loc. cit.) can be adapted to produce single chain antibody constructs specifically recognizing (an) elected target(s).


Bivalent (also called divalent) or bispecific single-chain variable fragments (bi-scFvs or di-scFvs) having the format (scFv)2 can be engineered by linking two scFv molecules (e.g. with linkers as described hereinbefore). The linking can be done by producing a single polypeptide chain with two VH regions and two VL regions, yielding tandem scFvs (see e.g. Kufer P. et al., (2004) Trends in Biotechnology 22(5):238-244). Another possibility is the creation of scFv molecules with linker peptides that are too short for the two variable regions to fold together (e.g. about five amino acids), forcing the scFvs to dimerize. In this case, the VH and th VL of a binding domain (binding either to the target antigen or to CD3) are not directly connected via a peptide linker. Thus, the VH of the CD3 binding domain may e.g. be fused to the VL of the target antigen(s) binding domain via a peptide linker, and the VH of the target antigen(s) binding domain is fused to the VL of the CD3 binding domain via such peptide linker. This type is known as diabodies (see e.g. Hollinger, Philipp et al., (July 1993) Proceedings of the National Academy of Sciences of the United States of America 90 (14): 6444-8).


Antibody constructs denominated “single domain antibodies” comprise one (monomeric) antibody variable region which can bind selectively to a specific antigen, independently of other variable regions. The first single domain antibodies were engineered from heavy chain antibodies found in camelids, and these are called VHH fragments. Cartilaginous fishes also have heavy chain antibodies (IgNAR) from which single domain antibodies called VNAR fragments can be obtained. An alternative approach is to split the dimeric variable regions from common immunoglobulins into monomers, hence obtaining VH or VL as a single domain Ab. Although most research into single domain antibodies is currently based on heavy chain variable regions, nanobodies derived from light chains were also shown to bind specifically to target epitopes. Examples of single domain antibodies are called sdAb, nanobodies or single variable domain antibodies. A (single domain mAb)2 is hence a monoclonal antibody construct composed of (at least) two single domain monoclonal antibody constructs, which are individually selected from the group comprising VH, VL, VHH and VNAR. The linker is preferably in the form of a peptide linker. Similarly, an “scFv-single domain mAb” is a monoclonal antibody construct composed of at least one single domain antibody as described above and one scFv molecule as described above. Again, the linker is preferably in the form of a peptide linker.


It is also envisaged that the antibody construct has, in addition to its function to bind to the target molecules and CD3, a further function. In this format, the antibody construct may be a trifunctional or multifunctional antibody construct by targeting target cells through target antigen binding, mediating cytotoxic T cell activity through CD3 binding and providing a further function such as means or domains to enhance or extend serum half-life, a fully functional or modified Fc constant domain mediating ADCC through recruitment of effector cells, a label (fluorescent etc.), a therapeutic agent such as a toxin or radionuclide, etc.


Examples for means or domains to extend serum half-life of the antibody constructs include peptides, proteins or domains of proteins, which are fused or otherwise attached to the antibody constructs. The group of peptides, proteins or protein domains includes peptides binding to other proteins with preferred pharmacokinetic profile in the human body such as serum albumin (see WO 2009/127691). An alternative concept of such half-life extending peptides includes peptides binding to the neonatal Fc receptor (FcRn, see WO 2007/098420), which can also be used in the antibody constructs used in accordance with the present invention. The concept of attaching larger domains of proteins or complete proteins includes the fusion of human serum albumin, variants or mutants of human serum albumin (see WO 2011/051489, WO 2012/059486, WO 2012/150319, WO 2013/135896, WO 2014/072481, WO 2013/075066) or domains thereof, as well as the fusion of an immunoglobulin constant region (Fc domain) and variants thereof. Such variants of Fc domains are called Fc-based domains and may e.g. be optimized/modified to allow the desired pairing of dimers or multimers, to abolish Fc receptor binding (e.g. to avoid ADCC or CDC) or for other reasons. A further concept known in the art to extend the half-life of substances or molecules in the human body is the pegylation of those molecules (such as the antibody constructs used in accordance with the present invention).


In one embodiment, the antibody constructs used in accordance with the invention are linked (e.g. via peptide bond) with a fusion partner (such as a protein, polypeptide or peptide), e.g. for extending the construct's serum half-life. These fusion partners can be selected from human serum albumin (“HSA” or “HALB”) as wells as sequence variants thereof, peptides binding to HSA, peptides binding to FcRn (“FcRn BP”), or constructs comprising an (antibody derived) Fc region. Exemplary sequences of these fusion partners are depicted in SEQ ID NOs: 216-278. In general, the fusion partners may be linked to the N-terminus or to the C-terminus of the antibody constructs used in accordance with the invention, either directly (e.g. via peptide bond) or through a peptide linker such as (GGGGS)n (wherein “n” is an integer of 2 or greater, e.g. 2 or 3 or 4). Suitable peptide linkers are depicted in SEQ ID NOs: 202-211.


According to another embodiment, the antibody construct used in accordance with the invention comprises (in addition to the first and second domain) a third domain which comprises two polypeptide monomers, each comprising a hinge, a CH2 and a CH3 domain, wherein said two polypeptide monomers are fused to each other via a peptide linker. It is envisaged that said third domain comprises in N-terminal to C-terminal order: hinge-CH2-CH3-linker-hinge-CH2-CH3.


In line with the present invention, a “hinge” is an IgG hinge region. This region can be identified by analogy using the Kabat numbering, see e.g. Kabat positions 223-243. In line with the above, the minimal requirement for a “hinge” are the amino acid residues corresponding to the IgG1 sequence stretch of D231 to P243 according to the Kabat numbering. The terms “CH2” and “CH3” refer to the immunoglobulin heavy chain constant regions 2 and 3. These regions can as well be identified by analogy using the Kabat numbering, see e.g. Kabat positions 244-360 for CH2 and Kabat positions 361-478 for CH3. Is understood that there is some variation between the immunoglobulins in terms of their IgG1 Fc region, IgG2 Fc region, IgG3 Fc region, IgG4 Fc region, IgM Fc region, IgA Fc region, IgD Fc region and IgE Fc region (see, e.g., Padlan, Molecular Immunology, 31(3), 169-217 (1993)). The term Fc region refers to the last two heavy chain constant regions of IgA, IgD, and IgG, and the last three heavy chain constant regions of IgE and IgM. The Fc region can also include the flexible hinge N-terminal to these domains. For IgA and IgM, the Fc region may include the J chain. For IgG, the Fc region comprises immunoglobulin domains CH2 and CH3 and the hinge between the first two domains and CH2. Although the boundaries of the Fc region of an immunoglobulin may vary, an example for a human IgG heavy chain Fc portion comprising a functional hinge, CH2 and CH3 domain can be defined e.g. to comprise residues D231 (of the hinge domain) to P476 (of the C-terminus of the CH3 domain), or D231 to L476, respectively, for IgG4, wherein the numbering is according to Kabat.


Covalent modifications of the antibody constructs are also included within the scope of this invention, and are generally, but not always, done post-translationally. For example, several types of covalent modifications of the antibody construct are introduced into the molecule by reacting specific amino acid residues of the antibody construct with an organic derivatizing agent that can react with selected side chains or with the N- or C-terminal residues. Derivatization with bifunctional agents is useful for crosslinking the antibody constructs used in accordance with the present invention to a water-insoluble support matrix or surface used in a variety of methods. Glutaminyl and asparaginyl residues are frequently deamidated to the corresponding glutamyl and aspartyl residues, respectively. Alternatively, these residues are deamidated under mildly acidic conditions. Either form of these residues falls within the scope of this invention. Other modifications include hydroxylation of proline and lysine, phosphorylation of hydroxyl groups of seryl or threonyl residues, methylation of the α-amino groups of lysine, arginine, and histidine side chains (T. E. Creighton, Proteins: Structure and Molecular Properties, W. H. Freeman & Co., San Francisco, 1983, pp. 79-86), acetylation of the N-terminal amine, and amidation of any C-terminal carboxyl group.


Another type of covalent modification of the antibody constructs included within the scope of this invention comprises altering the glycosylation pattern of the protein. As is known in the art, glycosylation patterns can depend on both the sequence of the protein (e.g., the presence or absence of specific glycosylation amino acid residues, discussed below), or the host cell or organism in which the protein is produced. Specific expression systems are discussed below. Glycosylation of polypeptides is typically either N-linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue. The tri-peptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain Thus, the presence of either of these tri-peptide sequences in a polypeptide creates a potential glycosylation site. O-linked glycosylation refers to the attachment of one of the sugars N-acetylgalactosamine, galactose, or xylose, to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.


Addition of glycosylation sites to the antibody construct is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tri-peptide sequences (for N-linked glycosylation sites). The alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the starting sequence (for O-linked glycosylation sites). For ease, the amino acid sequence of an antibody construct may be altered through changes at the DNA level, particularly by mutating the DNA encoding the polypeptide at preselected bases such that codons are generated that will translate into the desired amino acids.


Another means of increasing the number of carbohydrate moieties on the antibody construct is by chemical or enzymatic coupling of glycosides to the protein. These procedures are advantageous in that they do not require production of the protein in a host cell that has glycosylation capabilities for N- and O-linked glycosylation. Depending on the coupling mode used, the sugar(s) may be attached to (a) arginine and histidine, (b) free carboxyl groups, (c) free sulfhydryl groups such as those of cysteine, (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline, (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan, or (f) the amide group of glutamine. These methods are described in WO 87/05330, and in Aplin and Wriston, 1981, CRC Crit. Rev. Biochem., pp. 259-306.


Removal of carbohydrate moieties present on the starting antibody construct may be accomplished chemically or enzymatically. Chemical deglycosylation requires exposure of the protein to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N-acetylgalactosamine), while leaving the polypeptide intact. Chemical deglycosylation is described by Hakimuddin et al., 1987, Arch. Biochem. Biophys. 259:52 and by Edge et al., 1981, Anal. Biochem. 118:131. Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved using a variety of endo- and exo-glycosidases as described by Thotakura et al., 1987, Meth. Enzymol. 138:350. Glycosylation at potential glycosylation sites may be prevented using the compound tunicamycin as described by Duskin et al., 1982, J. Biol. Chem. 257:3105. Tunicamycin blocks the formation of protein-N-glycoside linkages.


Other modifications of the antibody construct are also contemplated herein. For example, another type of covalent modification of the antibody construct comprises linking the antibody construct to various non-proteinaceous polymers, including polyols, in the manner set forth in U.S. Pat. Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192 or 4,179,337. In addition, as is known in the art, amino acid substitutions may be made in various positions within the antibody construct, e.g. to facilitate the addition of polymers such as polyethylene glycol (PEG).


In some embodiments, the covalent modification of the antibody constructs used in accordance with the invention comprises the addition of one or more labels. The labelling group may be coupled to the antibody construct via spacer arms of various lengths to reduce potential steric hindrance. Various methods for labelling proteins are known in the art and can be used in performing the present invention. The term “label” or “labelling group” refers to any detectable label. In general, labels fall into a variety of classes, depending on the assay in which they are to be detected—the following examples include, but are not limited to:

  • (a) isotopic labels, which may be radioactive or heavy isotopes, such as radioisotopes or radionuclides (e.g., 3H, 14C, 15N, 35S, 89Zr, 90Y, 99Tc, 111In, 125I, 131I)
  • (b) magnetic labels (e.g., magnetic particles)
  • (c) redox active moieties
  • (d) optical dyes (including, but not limited to, chromophores, phosphors and fluorophores) such as fluorescent groups (e.g., FITC, rhodamine, lanthanide phosphors), chemiluminescent groups, and fluorophores which can be either “small molecule” fluores or proteinaceous fluores
  • (e) enzymatic groups (e.g. horseradish peroxidase, β-galactosidase, luciferase, alkaline phosphatase)
  • (f) biotinylated groups
  • (g) predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags, etc.).


By “fluorescent label” is meant any molecule that may be detected via its inherent fluorescent properties. Suitable fluorescent labels include, but are not limited to, fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methyl-coumarins, pyrene, Malacite green, stilbene, Lucifer Yellow, Cascade BlueJ, Texas Red, IAEDANS, EDANS, BODIPY FL, LC Red 640, Cy 5, Cy 5.5, LC Red 705, Oregon green, the Alexa-Fluor dyes (Alexa Fluor 350, Alexa Fluor 430, Alexa Fluor 488, Alexa Fluor 546, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 633, Alexa Fluor 660, Alexa Fluor 680), Cascade Blue, Cascade Yellow and R-phycoerythrin (PE) (Molecular Probes, Eugene, Oreg.), FITC, Rhodamine, and Texas Red (Pierce, Rockford, Ill.), Cy5, Cy5.5, Cy7 (Amersham Life Science, Pittsburgh, Pa.). Suitable optical dyes, including fluorophores, are described in Molecular Probes Handbook by Richard P. Haugland.


Suitable proteinaceous fluorescent labels also include, but are not limited to, green fluorescent protein, including a Renilla, Ptilosarcus, or Aequorea species of GFP (Chalfie et al., 1994, Science 263:802-805), EGFP (Clontech Laboratories, Inc., Genbank® Accession Number U55762), blue fluorescent protein (BFP, Quantum Biotechnologies, Inc. 1801 de Maisonneuve Blvd. West, 8th Floor, Montreal, Quebec, Canada H3H 1J9; Stauber, 1998, Biotechniques 24:462-471; Heim et al., 1996, Curr. Biol. 6:178-182), enhanced yellow fluorescent protein (EYFP, Clontech Laboratories, Inc.), luciferase (Ichiki et al., 1993, J. Immunol. 150:5408-5417), β galactosidase (Nolan et al., 1988, Proc. Natl. Acad. Sci. U.S.A. 85:2603-2607) and Renilla (WO92/15673, WO95/07463, WO98/14605, WO98/26277, WO99/49019, U.S. Pat. Nos. 5,292,658; 5,418,155; 5,683,888; 5,741,668; 5,777,079; 5,804,387; 5,874,304; 5,876,995; 5,925,558).


Leucine zipper domains are peptides that promote oligomerization of the proteins in which they are found. Leucine zippers were originally identified in several DNA-binding proteins (Landschulz et al., 1988, Science 240:1759), and have since been found in a variety of different proteins. Among the known leucine zippers are naturally occurring peptides and derivatives thereof that dimerize or trimerize. Examples of leucine zipper domains suitable for producing soluble oligomeric proteins are described in PCT application WO94/10308, and the leucine zipper derived from lung surfactant protein D (SPD) described in Hoppe et al., 1994, FEBS Letters 344:191. The use of a modified leucine zipper that allows for stable trimerization of a heterologous protein fused thereto is described in Fanslow et al., 1994, Semin. Immunol. 6:267-78.


The antibody construct used in accordance with the invention may also comprise additional domains, which are e.g. helpful in the isolation of the molecule or relate to an adapted pharmacokinetic profile of the molecule. Domains helpful for the isolation of an antibody construct may be selected from peptide motives or secondarily introduced moieties, which can be captured in an isolation method, e.g. an isolation column. Non-limiting embodiments of such additional domains comprise peptide motives known as Myc-tag, HAT-tag, HA-tag, TAP-tag, GST-tag, chitin binding domain (CBD-tag), maltose binding protein (MBP-tag), Flag-tag, Strep-tag and variants thereof (e.g. StrepII-tag) and His-tag. All herein disclosed antibody constructs characterized by the identified CDRs may comprise a His-tag domain, which is generally known as a repeat of consecutive His residues in the amino acid sequence of a molecule, e.g. of five His residues (SEQ ID NO: 279), or of six His residues (hexa-histidine, SEQ ID NO: 280). The His-tag may be located e.g. at the N- or C-terminus of the antibody construct. In one embodiment, a hexa-histidine tag (HHHHHH) is linked via peptide bond to the C-terminus of the antibody construct used in accordance with the invention.


It is also envisaged that the antibody construct used in accordance with the present invention comprises or consists of a polypeptide which has an amino acid sequence selected from the group consisting of those depicted in SEQ ID NOs: 281 and 282, and which is linked at its N-terminus or at its C-terminus with a protein purification tag, preferably via a peptide bond (amide bond). The linking of the protein purification tag at the C-terminus of the polypeptide is preferred. It is envisaged that the protein purification tag is a short peptide. For example, the length of the short peptide may be 2-30 amino acids, 4-25 amino acids, 5-20 amino acids or 6-19 amino acids. Examples of protein purification tags include, but are not limited to, AU1 epitope (e.g. as depicted in SEQ ID NO: 285), AU5 epitope (e.g. as depicted in SEQ ID NO: 286), T7-tag (e.g. as depicted in SEQ ID NO: 287), V5-tag (e.g. as depicted in SEQ ID NO: 288), B-tag (e.g. as depicted in SEQ ID NO: 289), E2 epitope (e.g. as depicted in SEQ ID NO: 290), FLAG epitope/FLAG tag (e.g. as depicted in SEQ ID NO: 291), Glu-Glu tag (e.g. as depicted in SEQ ID NOs: 292 or 293), HA tag, Histidine affinity tag (e.g. as depicted in SEQ ID NO: 294), HSV epitope (e.g. as depicted in SEQ ID NO: 295), KT3 epitope (e.g. as depicted in SEQ ID NO: 296), Myc epitope (e.g. as depicted in SEQ ID NO: 297), polyarginine tag (5-6 Arg residues), polyaspartate tag (5-16 Asp residues), polyhistidine tag (2-10 His residues, usually 6 His residues, see e.g. SEQ ID NOs: 280, and (279, 298, 299-), polyphenylalanine tag (usually 11 Phe residues), S1 tag (e.g. as depicted in SEQ ID NO: 300), S-tag (e.g. as depicted in SEQ ID NO: 301), Strep tag (e.g. as depicted in SEQ ID NOs: 302 or 303), universal tag (e.g. as depicted in SEQ ID NO: 304), VSV-G (e.g. as depicted in SEQ ID NO: 305), Protein C (e.g. as depicted in SEQ ID NO: 306), and Protein A. A histidine tag is preferred, especially a 6×His tag (SEQ ID NO: 280). Is it hence further envisaged that the antibody construct used in accordance with the present invention consists of a polypeptide which has an amino acid sequence selected from the group consisting of those depicted in SEQ ID NOs: 281 and 282, and which is linked at its C-terminus with a 6×His tag via a peptide bond. An embodiment of the antibody construct used in accordance with the present invention has an amino acid sequence as depicted in SEQ ID NO: 283 or SEQ ID NO: 284.


T cells or T lymphocytes are a type of lymphocyte (itself a type of white blood cell) that play a central role in cell-mediated immunity. There are several subsets of T cells, each with a distinct function. T cells can be distinguished from other lymphocytes, such as B cells and NK cells, by the presence of a T cell receptor (TCR) on the cell surface. The TCR is responsible for recognizing antigens bound to major histocompatibility complex (MHC) molecules and is composed of two different protein chains. In 95% of the T cells, the TCR consists of an alpha (α) and beta (β) chain. When the TCR engages with antigenic peptide and MHC (peptide/MHC complex), the T lymphocyte is activated through a series of biochemical events mediated by associated enzymes, co-receptors, specialized adaptor molecules, and activated or released transcription factors.


The antibody construct used in accordance with the invention comprises a domain which binds to CD3 on the surface of a T cell. “CD3” (cluster of differentiation 3) is a T cell co-receptor composed of four chains. In mammals, the CD3 protein complex contains a CD3γ (gamma) chain, a CD3δ (delta) chain, and two CD3ε (epsilon) chains. These four chains associate with the T cell receptor (TCR) and the so-called (zeta) chain to for the “T cell receptor complex” and to generate an activation signal in T lymphocytes. The CD3γ (gamma), CD3δ (delta), and CD3ε (epsilon) chains are highly related cell-surface proteins of the immunoglobulin superfamily and each contain a single extracellular immunoglobulin domain. The intracellular tails of the CD3 molecules contain a single conserved motif known as an immunoreceptor tyrosine-based activation motif (ITAM), which is essential for the signaling capacity of the TCR. The CD3 epsilon molecule is a polypeptide which in humans is encoded by the CD3E gene which resides on chromosome 11.


The redirected lysis of target cells via the recruitment of T cells by an antibody construct which binds to CD3 on the T cell and to a target protein on the target cell generally involves cytolytic synapse formation and delivery of perforin and granzymes. The engaged T cells are capable of serial target cell lysis and are not affected by immune escape mechanisms interfering with peptide antigen processing and presentation, or clonal T cell differentiation; see e.g. WO2007/042261.


Cytotoxicity mediated by the herein described antibody constructs can be measured in various ways. The “half maximal effective concentration” (EC50) is commonly used as a measure of potency of a biologically active molecule such as an antibody construct used in accordance with the present invention. It may be expressed in molar units. In the present case of measuring cytotoxicity, the EC50 value refers to the concentration of an antibody construct inducing a cytotoxic response (lysis of target cells) halfway between the baseline and the maximum. Effector cells in a cytotoxicity assay can e.g. be stimulated enriched (human) CD8 positive T cells or unstimulated (human) peripheral blood mononuclear cells (PBMC). An EC50 value may typically be expected to be lower when stimulated/enriched CD8+ T cells are used as effector cells, compared with unstimulated PBMC. If the target cells are of macaque origin or express or are transfected with macaque target antigen, the effector cells should also be of macaque origin, such as a macaque T cell line, e.g. 4119LnPx. The target cells should express the target antigen(s), such as human or macaque the target antigen(s), on the cell surface. Target cells can be a cell line (such as CHO) which is stably or transiently transfected with nucleic acids encoding the target antigen(s). Alternatively, the target cells can be a target antigen(s)-positive natural expresser cell line, such as the human cancer lines. Usually EC50 values are expected to be lower when using target cells that express higher levels of the target antigen(s) on the cell surface compared with target cells having a lower target expression rate.


The effector to target cell (E:T) ratio in a cytotoxicity assay is usually about 10:1, but can also vary. Cytotoxic activity of the target antigen(s)×CD3 antibody constructs can be measured in a 51-chromium release assay (e.g. with an incubation time of about 18 hours) or in a in a FACS-based cytotoxicity assay (e.g. with an incubation time of about 48 hours). Modifications of the incubation time (cytotoxic reaction) are also envisaged. Other methods of measuring cytotoxicity are well-known and comprise MTT or MTS assays, ATP-based assays including bioluminescent assays, the sulforhodamine B (SRB) assay, WST assay, clonogenic assay and the ECIS technology.


According to one embodiment, the cytotoxic activity mediated by the target antigen(s)×CD3 antibody constructs used in accordance with the present invention is measured in a cell-based cytotoxicity assay. It may also be measured in a 51-chromium release assay. It is envisaged that the EC50 value of the antibody constructs used in accordance with the invention is ≤300 μM, ≤280 μM, ≤260 μM, ≤250 μM, ≤240 μM, ≤220 μM, ≤200 μM, ≤180 μM, ≤160 μM, ≤150 μM, ≤140 μM, ≤120 μM, ≤100 μM, ≤90 μM, ≤80 μM, ≤70 μM, ≤60 μM, ≤50 μM, ≤40 μM, ≤30 μM, ≤20 μM, ≤15 μM, ≤10 μM, or ≤5 μM.


The above given EC50 values can be measured in different assays and under different conditions. For example, when human PBMCs are used as effector cells and the target antigen(s)-transfected cells such as CHO cells are used as target cells, it is envisaged that the EC50 value of the antibody construct is ≤500 μM, ≤400 μM, ≤300 μM, ≤280 μM, ≤260 μM, ≤250 μM, ≤240 μM, ≤220 μM, ≤200 μM, ≤180 μM, ≤160 μM, ≤150 μM, 2140 μM, ≤120 μM, 2100 μM, ≤90 μM, ≤80 μM, ≤70 μM, ≤60 μM, ≤50 μM, ≤40 μM, ≤30 μM, ≤20 μM, ≤15 μM, ≤10 μM, or ≤5 μM. When human PBMCs are used as effector cells and when the target cells are a the target antigen(s) positive cell line such as, it is envisaged that the EC50 value of the target antigen(s)×CD3 antibody construct is ≤300 μM, ≤280 μM, ≤260 μM, ≤250 μM, ≤240 μM, ≤220 μM, ≤200 μM, ≤180 μM, ≤160 μM, ≤150 μM, ≤140 μM, ≤120 μM, ≤100 μM, ≤90 μM, ≤80 μM, ≤70 μM, ≤60 μM, ≤50 μM, ≤40 μM, ≤30 μM, ≤20 μM, ≤15 μM, ≤10 μM, or ≤5 μM.


According to one embodiment, the target antigen(s)×CD3 antibody constructs used in accordance with the present invention do not induce/mediate lysis or do not essentially induce/mediate lysis of cells that do not express the target antigen(s) on their surface (the target antigen(s)-negative cells), such as CHO cells. The term “do not induce lysis”, “do not essentially induce lysis”, “do not mediate lysis” or “do not essentially mediate lysis” means that an antibody construct used in accordance with the present invention does not induce or mediate lysis of more than 30%, preferably not more than 20%, more preferably not more than 10%, particularly preferably not more than 9%, 8%, 7%, 6% or 5% of the target antigen(s)-negative cells, whereby lysis of the target antigen(s) expressing target cells (such as cells transformed or transfected with the target antigen(s) or a natural expresser cell line such as human cancer lines) is set to be 100%. This usually applies for concentrations of the antibody construct of up to 500 nM. Cell lysis measurement is a routine technique. Moreover, the present specification teaches specific instructions how to measure cell lysis.


The difference in cytotoxic activity between the monomeric and the dimeric isoform of individual the target antigen(s)×CD3 antibody constructs is referred to as “potency gap”. This potency gap can e.g. be calculated as ratio between EC50 values of the molecule's monomeric and dimeric form. In one method to determine this gap, an 18 hour 51-chromium release assay or a 48 h FACS-based cytotoxicity assay is carried out as described known in the art with purified antibody construct monomer and dimer. Effector cells are stimulated enriched human CD8+ T cells or unstimulated human PBMC. Target cells are target antigen(s)-transfected CHO cells. Effector to target cell (E:T) ratio is 10:1. Potency gaps of the target antigen(s)×CD3 antibody constructs used in accordance with the present invention are preferably ≤5, more preferably ≤4, even more preferably ≤3, even more preferably ≤2 and most preferably ≤1.


The first and/or the second domain of the antibody construct used in accordance with the invention is/are preferably cross-species specific for members of the mammalian order of primates, such as macaques. Cross-species specific CD3 binding domains are, for example, described in WO 2008/119567. According to one embodiment, the second domain, in addition to binding to CD3, preferably human CD3, will also bind to CD3 of primates including (but not limited to) new world primates (such as Callithrix jacchus, Saguinus Oedipus or Saimiri sciureus), old world primates (such as baboons and macaques), gibbons, orangutans and non-human homininae. It is envisaged that the second domain which binds to CD3, preferably human CD3, on the surface of a T cell also binds at least to macaque CD3. A preferred macaque is Macaca fascicularis. Macaca mulatta (Rhesus) is also envisaged. One antibody construct used in accordance with the invention comprises a first domain which binds to human the target antigen(s) on the surface of a target cell and a second domain which binds to CD3, preferably human CD3, on the surface of a T cell and at least macaque CD3.


In one embodiment, the affinity gap of the antibody constructs used in accordance with the invention for binding macaque CD3 versus CD3, preferably human CD3, [KD ma CD3: KD hu CD3] (as determined e.g. by BiaCore or by Scatchard analysis) is between 0.01 and 100, preferably between 0.1 and 10, more preferably between 0.2 and 5, more preferably between 0.3 and 4, even more preferably between 0.5 and 3 or between 0.5 and 2.5, and most preferably between 0.5 and 1.


The second domain of the antibody construct used in accordance with the invention binds to CD3. More preferably, it binds to CD3 on the surface of a T cell. It is furthermore envisaged that the second domain binds to CD3, preferably human CD3, preferably to CD3, preferably human CD3, on the surface of a T cell. It is also envisaged that the second domain binds to CD3 epsilon. More preferably, it binds to CD3, preferably human CD3, epsilon, e.g. to CD3, preferably human CD3, epsilon on the surface of a T cell. A preferred amino acid sequence for the extracellular domain of CD3, preferably human CD3, epsilon is depicted in SEQ ID NO: 1.


In one embodiment used in accordance with the present invention, the second domain of the antibody construct binds to CD3, preferably human CD3, epsilon (or CD3, preferably human CD3, epsilon on the surface of a T cell) and to Callithrix jacchus or Saimiri sciureus CD3 epsilon. It is also envisaged that the second domain binds to an extracellular epitope of CD3 epsilon, preferably to an extracellular epitope of CD3, preferably human CD3, epsilon. It is also envisaged that the second domain binds to an extracellular epitope of the human and the Macaca CD3 epsilon chain. One preferred epitope of CD3 epsilon is comprised within amino acid residues 1-27 of the CD3, preferably human CD3, epsilon extracellular domain (see SEQ ID NO: 2). Even more specifically, the epitope comprises at least the amino acid sequence Gln-Asp-Gly-Asn-Glu. Callithrix jacchus is a new world primate belonging to the family of Callitrichidae, while Saimiri sciureus is a new world primate belonging to the family of Cebidae. Binders having such characteristics are described in detail in WO 2008/119567.


Antibodies or bispecific antibody constructs directed against (human) CD3 or specifically against CD3 epsilon are known in the art, and their CDRs, VH and VL sequences can serve as a basis for the second binding domain of the antibody construct used in accordance with the invention. For example, Kung et al. reported in 1979 the development of OKT3 (Ortho Kung T3), the first mAb recognizing CD3 (specifically, the epsilon chain of CD3) on human T cells. OKT3 (muromonab) was the first monoclonal antibody of murine origin to become available for therapy in humans. Newer anti-CD3 monoclonal antibodies include otelixizumab (TRX4), teplizumab (MGA031), foralumab and visilizumab, all targeting the epsilon chain of CD3. Bispecific antibody constructs directed against a (cancer) target and CD3 are also being developed and (pre-)clinically tested, and their CD3 binding domain (CDRs, VH, VL) may serve as a basis for the second binding domain of the antibody construct used in accordance with the invention. Examples include, but are not limited to, Blinatumomab, Solitomab (MT110, AMG 110), Catumaxomab, Duvortuxizumab, Ertumaxomab, Mosunetuzumab, FBTA05 (Bi20, TPBs05), CEA-TCB (RG7802, R06958688), AFM11, and MGD006 (S80880). Other examples of CD3 binding domains are disclosed e.g. in U.S. Pat. No. 7,994,289 B2, U.S. Pat. No. 7,728,114 B2, U.S. Pat. No. 7,381,803 B1, U.S. Pat. No. 6,706,265 B1.


It is envisaged for the antibody construct used in accordance with the present invention that the second domain which binds to CD3 on the surface of a T cell comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 selected from: CDR-L1 as depicted in SEQ ID NO: 3, CDR-L2 as depicted in SEQ ID NO: 4, and CDR-L3 as depicted in SEQ ID NO: 5; CDR-L1 as depicted in SEQ ID NO: 6, CDR-L2 as depicted in SEQ ID NO: 7, and CDR-L3 as depicted in SEQ ID NO: 8; and CDR-L1 as depicted in SEQ ID NO: 9, CDR-L2 as depicted in SEQ ID NO: 10, and CDR-L3 as depicted in SEQ ID NO: 11.


It is also envisaged for the antibody construct used in accordance with the present invention that the second domain which binds to CD3 on the surface of a T cell comprises a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-H1 as depicted in SEQ ID NO: 12, CDR-H2 as depicted in SEQ ID NO: 13, and CDR-H3 as depicted in SEQ ID NO: 14; CDR-H1 as depicted in SEQ ID NO: 15, CDR-H2 as depicted in SEQ ID NO: 16, and CDR-H3 as depicted in SEQ ID NO: 17; CDR-H1 as depicted in SEQ ID NO: 18, CDR-H2 as depicted in SEQ ID NO: 19, and CDR-H3 as depicted in SEQ ID NO: 20; CDR-H1 as depicted in SEQ ID NO: 21, CDR-H2 as depicted in SEQ ID NO: 22, and CDR-H3 as depicted in SEQ ID NO: 23; CDR-H1 as depicted in SEQ ID NO: 24, CDR-H2 as depicted in SEQ ID NO: 25, and CDR-H3 as depicted in SEQ ID NO: 26; CDR-H1 as depicted in SEQ ID NO: 27, CDR-H2 as depicted in SEQ ID NO: 28, and CDR-H3 as depicted in SEQ ID NO: 29; CDR-H1 as depicted in SEQ ID NO: 30, CDR-H2 as depicted in SEQ ID NO: 31, and CDR-H3 as depicted in SEQ ID NO: 32; CDR-H1 as depicted in SEQ ID NO: 33, CDR-H2 as depicted in SEQ ID NO: 34, and CDR-H3 as depicted in SEQ ID NO: 35; CDR-H1 as depicted in SEQ ID NO: 36, CDR-H2 as depicted in SEQ ID NO: 37, and CDR-H3 as depicted in SEQ ID NO: 38; and CDR-H1 as depicted in SEQ ID NO: 39, CDR-H2 as depicted in SEQ ID NO: 40, and CDR-H3 as depicted in SEQ ID NO: 41.


It is furthermore envisaged for the antibody construct used in accordance with the present invention that the second domain which binds to CD3 comprises a VL region comprising CDR-L1, CDR-L2 and CDR-L3 and a VH region comprising CDR-H1, CDR-H2 and CDR-H3 selected from: CDR-L1 as depicted in SEQ ID NO: 42, CDR-L2 as depicted in SEQ ID NO: 43, CDR-L3 as depicted in SEQ ID NO: 44, CDR-H1 as depicted in SEQ ID NO: 12, CDR-H2 as depicted in SEQ ID NO: 13, and CDR-H3 as depicted in SEQ ID NO: 14; CDR-L1 as depicted in SEQ ID NO: 3, CDR-L2 as depicted in SEQ ID NO: 4, CDR-L3 as depicted in SEQ ID NO: 5, CDR-H1 as depicted in SEQ ID NO: 15, CDR-H2 as depicted in SEQ ID NO: 16, and CDR-H3 as depicted in SEQ ID NO: 17; CDR-L1 as depicted in SEQ ID NO: 45, CDR-L2 as depicted in SEQ ID NO: 46, CDR-L3 as depicted in SEQ ID NO: 47, CDR-H1 as depicted in SEQ ID NO: 48, CDR-H2 as depicted in SEQ ID NO: 49, and CDR-H3 as depicted in SEQ ID NO: 50; CDR-L1 as depicted in SEQ ID NO: 51, CDR-L2 as depicted in SEQ ID NO: 52, CDR-L3 as depicted in SEQ ID NO: 53, CDR-H1 as depicted in SEQ ID NO: 21, CDR-H2 as depicted in SEQ ID NO: 22, and CDR-H3 as depicted in SEQ ID NO: 23; CDR-L1 as depicted in SEQ ID NO: 54, CDR-L2 as depicted in SEQ ID NO: 55, CDR-L3 as depicted in SEQ ID NO: 56, CDR-H1 as depicted in SEQ ID NO: 24, CDR-H2 as depicted in SEQ ID NO: 25, and CDR-H3 as depicted in SEQ ID NO: 26; CDR-L1 as depicted in SEQ ID NO: 57, CDR-L2 as depicted in SEQ ID NO: 58, CDR-L3 as depicted in SEQ ID NO: 59, CDR-H1 as depicted in SEQ ID NO: 27, CDR-H2 as depicted in SEQ ID NO: 28, and CDR-H3 as depicted in SEQ ID NO: 29; CDR-L1 as depicted in SEQ ID NO: 6, CDR-L2 as depicted in SEQ ID NO: 7, CDR-L3 as depicted in SEQ ID NO: 8, CDR-H1 as depicted in SEQ ID NO: 30, CDR-H2 as depicted in SEQ ID NO: 31, and CDR-H3 as depicted in SEQ ID NO: 32; CDR-L1 as depicted in SEQ ID NO: 60, CDR-L2 as depicted in SEQ ID NO: 61, CDR-L3 as depicted in SEQ ID NO: 62, CDR-H1 as depicted in SEQ ID NO: 33, CDR-H2 as depicted in SEQ ID NO: 34, and CDR-H3 as depicted in SEQ ID NO: 35; CDR-L1 as depicted in SEQ ID NO: 9, CDR-L2 as depicted in SEQ ID NO: 10, CDR-L3 as depicted in SEQ ID NO: 11, CDR-H1 as depicted in SEQ ID NO: 36, CDR-H2 as depicted in SEQ ID NO: 37, and CDR-H3 as depicted in SEQ ID NO: 38; and CDR-L1 as depicted in SEQ ID NO: 63, CDR-L2 as depicted in SEQ ID NO: 64, CDR-L3 as depicted in SEQ ID NO: 65, CDR-H1 as depicted in SEQ ID NO: 39, CDR-H2 as depicted in SEQ ID NO: 40, and CDR-H3 as depicted in SEQ ID NO: 41.


It is envisaged for the antibody construct used in accordance with the present invention that the second domain which binds to CD3 on the surface of a T cell comprises a VL region selected from the group consisting of a VL region as depicted in any one of SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, SEQ ID NO: 70 and SEQ ID NO: 71.


It is also envisaged that the second domain which binds to CD3 on the surface of a T cell comprises a VH region selected from the group consisting of a VH region as depicted in any one of SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, SEQ ID NO: 86, SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90,


SEQ ID NO: 91, and SEQ ID NO: 92.


More preferably, the antibody construct used in accordance with the present invention is characterized by the second domain which binds to CD3 on the surface of a T cell comprising a VL region and a VH region selected from the group consisting of:

  • (a) a VL region as depicted in SEQ ID NO: 93 or 69 and a VH region as depicted in SEQ ID NO: 72 or 83;
  • (b) a VL region as depicted in SEQ ID NO: 66 or 69 and a VH region as depicted in SEQ ID NO: 73 or 84;
  • (c) a VL region as depicted in SEQ ID NO: 94 or 69 and a VH region as depicted in SEQ ID NO: 74 or 85;
  • (d) a VL region as depicted in SEQ ID NO: 95 or 69 and a VH region as depicted in SEQ ID NO: 75 or 86;
  • (e) a VL region as depicted in SEQ ID NO: 96 or 70 and a VH region as depicted in SEQ ID NO: 76 or 87;
  • (f) a VL region as depicted in SEQ ID NO: 97 or 69 and a VH region as depicted in SEQ ID NO: 77 or 88;
  • (g) a VL region as depicted in SEQ ID NO: 67 or 70 and a VH region as depicted in SEQ ID NO: 78 or 89;
  • (h) a VL region as depicted in SEQ ID NO: 98 or 69 and a VH region as depicted in SEQ ID NO: 79 or 90;
  • (i) a VL region as depicted in SEQ ID NO: 68 or 71 and a VH region as depicted in SEQ ID NO: 80 or 91;
  • (j) a VL region as depicted in SEQ ID NO: 99 or 71 and a VH region as depicted in SEQ ID NO: 81 or 92; and
  • (k) a VL region as depicted in SEQ ID NO: 100 and a VH region as depicted in SEQ ID NO: 82.


A preferred embodiment of the above described antibody construct used in accordance with the present invention is characterized by the second domain which binds to CD3 on the surface of a T cell comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120 and 121.


Amino acid sequence modifications of the antibody constructs described herein are also contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody construct. Amino acid sequence variants of the antibody constructs are prepared by peptide synthesis or by introducing appropriate nucleotide changes into the nucleic acid molecule encoding the antibody constructs. All below described amino acid sequence modifications should result in an antibody construct which retains the desired biological activity of the unmodified parental molecule (such as binding to the target antigen(s) and to CD3, inducing cytotoxicity against the target antigen(s)-positive target cells).


The term “amino acid” or “amino acid residue” typically refers to an amino acid having its art recognized definition such as an amino acid selected from the group consisting of: alanine (Ala or A); arginine (Arg or R); asparagine (Asn or N); aspartic acid (Asp or D); cysteine (Cys or C); glutamine (GIn or Q); glutamic acid (GIu or E); glycine (GIy or G); histidine (His or H); isoleucine (Ile or I): leucine (Leu or L); lysine (Lys or K); methionine (Met or M); phenylalanine (Phe or F); proline (Pro or P); serine (Ser or S); threonine (Thr or T); tryptophan (Trp or W); tyrosine (Tyr or Y); and valine (VaI or V), although modified, synthetic, or rare amino acids may be used as desired. There are basically four different classes of amino acids determined by different side chains:

  • (i) non-polar and neutral (uncharged): Ala, Gly, Ile, Leu, Met, Phe, Pro, Val,
  • (ii) polar and neutral (uncharged): Asn, Cys (being only slightly polar), Gln, Ser, Thr, Trp (being only slightly polar), Tyr,
  • (iii) acidic and polar (negatively charged): Asp and Glu,
  • (iv) basic and polar (positively charged): Arg, His, Lys.


Hydrophobic amino acids can be divided according to whether they have aliphatic or aromatic side chains. Phe and Trp (being very hydrophobic), Tyr and His (being less hydrophobic) are classified as aromatic amino acids. Strictly speaking, aliphatic means that the side chain contains only hydrogen and carbon atoms. By this strict definition, the amino acids with aliphatic side chains are alanine, isoleucine, leucine (also norleucine), proline and valine. Alanine's side chain, being very short, means that it is not particularly hydrophobic, and proline has an unusual geometry that gives it special roles in proteins. It is often convenient to consider methionine in the same category as isoleucine, leucine and valine, although it also contains a sulphur atom. The unifying theme is that these amino acids contain largely non-reactive and flexible side chains. The amino acids alanine, cysteine, glycine, proline, serine and threonine are often grouped together because they are all small. Gly and Pro may influence chain orientation.


Amino acid modifications include, for example, deletions of residues from, insertions of residues into, and/or substitutions of residues within the amino acid sequences of the antibody constructs. Any combination of deletion, insertion, and/or substitution is made to arrive at a final antibody construct, provided that the final construct possesses the desired characteristics, e.g. the biological activity of the unmodified parental molecule (such as binding to the target antigen(s) and to CD3, inducing cytotoxicity against the target antigen(s) positive target cells). The amino acid changes may also alter post-translational processes of the antibody constructs, such as changing the number or position of glycosylation sites.


For example, 1, 2, 3, 4, 5, or 6 amino acids may be inserted, deleted and/or substituted in each of the CDRs (of course, dependent on their respective length), while 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 25 amino acids may be inserted, deleted and/or substituted in each of the FRs. Amino acid sequence insertions also include N-terminal and/or C-terminal additions of amino acids ranging in length from e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 residues to polypeptides containing more than 10, e.g. one hundred or more residues, as well as intra-sequence insertions of single or multiple amino acid residues. An insertional variant of the antibody construct used in accordance with the invention includes the fusion of a polypeptide which increases or extends the serum half-life of the antibody construct to the N-terminus or to the C-terminus of the antibody construct. It is also conceivable that such insertion occurs within the antibody construct, e.g. between the first and the second domain.


The sites of greatest interest for amino acid modifications, particularly for amino acid substitutions, include the hypervariable regions, particularly the individual CDRs of the heavy and/or light chain, but FR alterations in the heavy and/or light chain are also contemplated. The substitutions can be conservative substitutions as described herein. Preferably, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids may be substituted in a CDR, while 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 25 amino acids may be substituted in the framework regions (FRs), depending on the length of the CDR or FR, respectively. For example, if a CDR sequence encompasses 6 amino acids, it is envisaged that one, two or three of these amino acids are substituted. Similarly, if a CDR sequence encompasses 15 amino acids it is envisaged that one, two, three, four, five or six of these amino acids are substituted.


A useful method for the identification of certain residues or regions within the antibody constructs that are preferred locations for mutagenesis is called “alanine scanning mutagenesis” and is described e.g. in Cunningham B C and Wells J. A. (Science. 1989 Jun. 2; 244(4908):1081-5). Here, a residue or group of residues within the antibody construct is/are identified (e.g. charged residues such as Arg, His, Lys, Asp, and Glu) and replaced by a neutral or non-polar amino acid (most preferably alanine or polyalanine) to affect the interaction of the respective amino acid(s) with the epitope of the target protein Alanine scanning is a technique used to determine the contribution of a specific residue to the stability or function of given protein. Alanine is used because of its non-bulky, chemically inert, methyl functional group that nevertheless mimics the secondary structure preferences that many of the other amino acids possess. Sometimes bulky amino acids such as valine or leucine can be used in cases where conservation of the size of mutated residues is needed. This technique can also be useful to determine whether the side chain of a specific residue plays a significant role in bioactivity. Alanine scanning is usually accomplished by site-directed mutagenesis or randomly by creating a PCR library. Furthermore, computational methods to estimate thermodynamic parameters based on theoretical alanine substitutions have been developed. The data can be tested by IR, NMR Spectroscopy, mathematical methods, bioassays, etc.


Those amino acid locations demonstrating functional sensitivity to the substitutions (as determined e.g. by alanine scanning) can then be refined by introducing further or other variants at, or for, the sites of substitution. Thus, while the site or region for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se needs not to be predetermined. For example, to analyze or optimize the performance of a mutation at a given site, alanine scanning, or random mutagenesis may be conducted at a target codon or region, and the expressed antibody construct variants are screened for the optimal combination of desired activity. Techniques for making substitution mutations at predetermined sites in the DNA having a known sequence are well known, for example, M13 primer mutagenesis and PCR mutagenesis. Screening of the mutants is done e.g. using assays of antigen-binding activity and/or of cytotoxic activity.


Generally, if amino acids are substituted in one or more or all the CDRs of the heavy and/or light chain, it is envisaged that the then-obtained “substituted” sequence is at least 60% or 65%, more preferably 70% or 75%, even more preferably 80% or 85%, and particularly preferably 90% or 95% identical/homologous to the “original” or “parental” CDR sequence. This means that the degree of identity/homology between the original and the substituted sequence depends on the length of the CDR. For example, a CDR having 5 amino acids in total and comprising one amino acid substitution is 80% identical to the “original” or “parental” CDR sequence, while a CDR having 10 amino acids in total and comprising one amino acid substitution is 90% identical to the “original” or “parental” CDR sequence. Accordingly, the substituted CDRs of the antibody construct used in accordance with the invention may have different degrees of identity to their original sequences, e.g., CDRL1 may have 80%, while CDRL3 may have 90% of homology. The same considerations apply to the framework regions and to the entire VH and VL regions.


A “variant CDR” is a CDR with a specific sequence homology, similarity, or identity to the parent CDR used in accordance with the invention, and shares biological function with the parent CDR, including, but not limited to, at least 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% of the specificity and/or activity of the parent CDR. Generally, the amino acid homology, similarity, or identity between individual variant CDRs is at least 60% to the parent sequences depicted herein, and more typically with increasing homologies, similarities or identities of at least 65% or 70%, preferably at least 75% or 80%, more preferably at least 85%, 90%, 91%, 92%, 93%, 94%, and most preferably 95%, 96%, 97%, 98%, 99%, and almost 100%. The same applies to “variant VH” and “variant VL”. According to one embodiment, the sequence variations within a “variant VH” and/or a “variant VL” do not extend to the CDRs. The present invention is hence directed to an antibody construct used in accordance with the disclosure herein, comprising VH and VL sequences having a certain sequence homology (see above) to the specific sequences as defined herein (the “parental” VH and VL), wherein the CDR sequences are 100% identical to the specific CDR sequences as defined herein (the “parental” CDRs).


Preferred substitutions (or replacements) are conservative substitutions. However, any substitution (including non-conservative substitutions or one or more from the “exemplary substitutions” listed in Table 1, below) is envisaged, as long as the antibody construct retains its capacity to bind to the target antigen(s) via the first domain and to CD3 or CD3 epsilon via the second domain, and/or provided its CDRs, FRs, VH and/or VL sequences have a degree of identity to the original or parental sequence of at least 60% or 65%, more preferably at least 70% or 75%, even more preferably at least 80% or 85%, and particularly preferably at least 90% or 95%.


A conservative replacement (also called a conservative mutation or a conservative substitution) is an amino acid replacement that changes a given amino acid to a different amino acid with similar biochemical properties (e.g. charge, hydrophobicity, size). Conservative replacements in proteins often have a smaller effect on protein function than non-conservative replacements. Conservative substitutions are shown in Table 1. Exemplary conservative substitutions are shown as “exemplary substitutions”. If such substitutions result in a change in biological activity, then more substantial changes, as further described herein with reference to amino acid classes, may be introduced and the products screened for a desired characteristic.









TABLE 1







Amino acid substitutions (aa = amino acid)









Original




aa
Conservative substitutions
Exemplary Substitutions





Ala (A)
Small aa
Gly, Ser, Thr


Arg (R)
Polar aa, particularly Lys
Lys, Gln, Asn


Asn (N)
Polar aa, particularly Asp
Asp, Gln, His, Lys, Arg


Asp (D)
Glu or other polar aa,
Glu, Asn



particularly Asn


Cys (C)
Small aa
Ser, Ala


Gln (Q)
Polar aa, particularly Glu
Glu, Asn


Glu (E)
Asp or other polar aa,
Asp, Gln



particularly Gln


Gly (G)
Small aa, such as Ala
Ala


His (H)

Asn, Gln, Arg, Lys, Tyr


Ile (I)
Hydrophobic, particularly
Ala, Val, Met, Leu, Phe



aliphatic aa


Leu (L)
Hydrophobic, particularly
Norleucine, Ile, Ala, Val, Met



aliphatic aa


Lys (K)
Polar aa, particularly Arg
Arg, Gln, Asn


Met (M)
Hydrophobic, particularly
Leu, Ala, Ile, Val, Phe



aliphatic aa


Phe (F)
Aromatic or hydrophobic aa,
Tyr, Trp, Leu, Val, Ile, Ala



particularly Tyr


Pro (P)
Small aa
Ala


Ser (S)
Polar or small aa,
Thr



particularly Thr


Thr (T)
Polar aa, particularly Ser
Ser


Trp (W)
Aromatic aa
Tyr, Phe


Tyr (Y)
Aromatic aa, particularly
Phe, Trp, Thr, Ser



Phe


Val (V)
Hydrophobic, particularly
Leu, Ile, Ala, Met, Phe



aliphatic aa









Substantial modifications in the biological properties of the antibody construct used in accordance with the present invention are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the region of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Non-conservative substitutions will usually entail exchanging a member of one of the above defined amino acid classes (such as polar, neutral, acidic, basic, aliphatic, aromatic, small . . . ) for another class. Any cysteine residue not involved in maintaining the proper conformation of the antibody construct may be substituted, generally with senile, to improve the oxidative stability of the antibody construct.


Sequence identity, homology and/or similarity of amino acid sequences is determined by using standard techniques known in the art, including, but not limited to, the local sequence identity algorithm of Smith and Waterman, 1981, Adv. Appl. Math. 2:482, the sequence identity alignment algorithm of Needleman and Wunsch (J Mol Biol. 1970 March; 48(3):443-53), the search for similarity method of Pearson and Lipman (Proc Natl Acad Sci USA. 1988 April; 85(8):2444-8), computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Drive, Madison, Wis.), the Best Fit sequence program described by Devereux et al. (Nucleic Acids Res. 1984 Jan. 11; 12(1 Pt 1):387-95), preferably using the default settings, or by inspection. It is envisaged that percent identity is calculated by FastDB based upon the following parameters: mismatch penalty of 1; gap penalty of 1; gap size penalty of 0.33; and joining penalty of 30. See also “Current Methods in Sequence Comparison and Analysis,” Macromolecule Sequencing and Synthesis, Selected Methods and Applications, pp 127-149 (1988), Alan R. Liss, Inc.


An example of a useful algorithm is PILEUP. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle (J Mol Evol. 1987; 25(4):351-60); the method is similar to that described by Higgins and Sharp (Comput Appl Biosci. 1989 April; 5(2):151-3). Useful PILEUP parameters include a default gap weight of 3.00, a default gap length weight of 0.10, and weighted end gaps.


Another example of a useful algorithm is the BLAST algorithm, described in: Altschul et al. (J Mol Biol. 1990 Oct. 5; 215(3):403-10); Altschul et al., (Nucleic Acids Res. 1997 Sep. 1; 25(17):3389-402); and Karlin and Altschul (Proc Natl Acad Sci USA. 1993 Jun. 15; 90(12):5873-7). A particularly useful BLAST program is the WU-Blast-2 program which was obtained from Altschul et al., (Methods Enzymol. 1996; 266:460-80). WU-Blast-2 uses several search parameters, most of which are set to the default values. The adjustable parameters are set with the following values: overlap span=1, overlap fraction=0.125, word threshold (T)=II. The HSP S and HSP S2 parameters are dynamic values and are established by the program itself depending upon the composition of the specific sequence and composition of the respective database against which the sequence of interest is being searched; however, the values may be adjusted to increase sensitivity.


An additional useful algorithm is gapped BLAST as reported by Altschul et al. (Nucleic Acids Res. 1997 Sep. 1; 25(17):3389-402). Gapped BLAST uses BLOSUM-62 substitution scores; threshold T parameter set to 9; the two-hit method to trigger ungapped extensions, charges gap lengths of k a cost of 10+k; Xu set to 16, and Xg set to 40 for database search stage and to 67 for the output stage of the algorithms. Gapped alignments are triggered by a score corresponding to about 22 bits.


In line herewith, the term “percent (%) nucleic acid sequence identity/homology/similarity” with respect to the nucleic acid sequence encoding the antibody constructs identified herein is defined as the percentage of nucleotide residues in a candidate sequence that are identical with the nucleotide residues in the coding sequence of the antibody construct. One method to align two sequences and thereby determine their homology uses the BLASTN module of WU-Blast2 set to the default parameters, with overlap span and overlap fraction set to 1 and 0.125, respectively. Generally, the nucleic acid sequence homology, similarity, or identity between the nucleotide sequences encoding individual variant CDRs and the nucleotide sequences depicted herein are at least 60%, and more typically with increasing homologies, similarities or identities of at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, and almost 100%. Again, the same applies to nucleic acid sequence encoding the “variant VH” and/or “variant VL”.


In one embodiment, the percentage of identity to human germline of the antibody constructs used in accordance with the invention, or of the first and second domain (binding domains) of these antibody constructs, is ≥70% or ≥75%, more preferably ≥80% or ≥85%, even more preferably ≥90%, and most preferably ≥91%, ≥92%, ≥93%, ≥94%, ≥95% or even ≥96%. Identity to human antibody germline gene products is thought to be an important feature to reduce the risk of therapeutic proteins to elicit an immune response against the drug in the patient during treatment. Hwang W. Y. and Foote J. (Methods. 2005 May; 36(1):3-10) demonstrate that the reduction of non-human portions of drug antibody constructs leads to a decrease of risk of inducing anti-drug antibodies in the patients during treatment. By comparing an exhaustive number of clinically evaluated antibody drugs and the respective immunogenicity data, the trend is shown that humanization of the variable regions of antibodies/antibody constructs makes the protein less immunogenic (average 5.1% of patients) than antibodies/antibody constructs carrying unaltered non-human variable regions (average 23.59% of patients). Higher degrees of identity to human sequences are hence desirable for protein therapeutics based on variable regions and in the form of antibody constructs. To determine the germline identity, the V-regions of VL can be aligned with the amino acid sequences of human germline V segments and J segments (http://www2.mrc-lmb.cam.ac.uk/vbase/) using Vector NTI software and the amino acid sequence calculated by dividing the identical amino acid residues by the total number of amino acid residues of the VL in percent. The same can be done for the VH segments (http://www2.mrc-lmb.cam.ac.uk/vbase/) with the exception that the VH CDR3 may be excluded due to its high diversity and a lack of existing human germline VH CDR3 alignment partners. Recombinant techniques can then be used to increase sequence identity to human antibody germline genes.


In a further embodiment, the antibody constructs used in accordance with the present invention exhibit high monomer yields under standard research scale conditions, e.g., in a standard two-step purification process. It is envisaged that the monomer yield of the antibody constructs used in accordance with the invention is ≥0.25 mg/L supernatant (SN), preferably ≥0.5 mg/L SN, more preferably ≥1 mg/L SN, even more preferably ≥2 mg/L SN and most preferably ≥3 mg/L SN. The yield of the antibody construct denominated “CL-1×I2C-6His” was shown to be 4.1 mg/L supernatant, and the yield of the antibody construct denominated “CL-1×I2C-scFc” was shown to be 36.5 mg/L supernatant.


Likewise, the yield of the dimeric antibody construct isoforms and hence the monomer percentage (i.e., monomer: (monomer+dimer)) of the antibody constructs can be determined. The productivity of monomeric and dimeric antibody constructs and the calculated monomer percentage can e.g. be obtained in the SEC purification step of culture supernatant from standardized research-scale production in roller bottles. According to one embodiment, the monomer percentage of the antibody constructs used in accordance with the invention is ≥80%, more preferably ≥85%, even more preferably ≥90%, and most preferably ≥95%.


According to one embodiment, the antibody constructs used in accordance with the invention have a plasma stability (ratio of EC50 with plasma to EC50 w/o plasma) of ≤5 or ≤4, more preferably ≤3.5 or ≤3, even more preferably ≤2.5 or ≤2, and most preferably ≤1.5 or ≤1. The plasma stability of an antibody construct can be tested by incubation of the purified construct in human plasma at 37° C. for 24 to 96 hours, e.g. at a concentration of 2-20 μg/ml, followed by EC50 determination in an 18 h 51-chromium release or in a 48 h FACS cytotoxicity assay. The effector cells in the cytotoxicity assay can be stimulated enriched human CD8 positive T cells (preferred) or unstimulated human PBMC. Target cells can e.g. be CHO cells transfected with human the target antigen(s). The effector to target cell (E:T) ratio can be 10:1. The starting concentration of the antibody constructs in the cytotoxicity assay can be 0.01-0.1 μg/ml. The human plasma pool used for this purpose is derived from the blood of healthy donors collected by EDTA coated syringes. Cellular components are removed by centrifugation and the upper plasma phase is collected and subsequently pooled. As control, non-incubated antibody constructs are diluted immediately prior to the cytotoxicity assay in appropriate medium such as RPMI-1640. The plasma stability is calculated as ratio of EC50 (after plasma incubation) to EC50 (control/no incubation).


It is furthermore envisaged that the monomer to dimer conversion of the antibody constructs used in accordance with the invention is low. The conversion can be measured under different conditions and analyzed by high performance size exclusion chromatography. For example, incubation of the monomeric isoforms of the antibody constructs can be carried out for 7 days at 37° C. in generic formulation buffer and at concentrations of e.g. 100 μg/ml or 250 μg/ml in an incubator, followed by high performance SEC to determine the percentage of initially monomeric antibody construct which had been converted into dimeric antibody construct. Under these conditions, it is envisaged that the antibody constructs used in accordance with the invention show a dimer percentage that is ≤8%, preferably ≤6%, more preferably ≤5%, more preferably ≤4%, even more preferably ≤3%, even more preferably ≤2.5%, even more preferably ≤2%, even more preferably ≤1.5%, and most preferably ≤1% or ≤0.5% or even 0%.


It is likewise envisaged that the antibody constructs used in accordance with the present invention present with very low dimer conversion after several freeze/thaw cycles. For example, the antibody construct monomer is adjusted to a concentration of 250 μg/ml e.g. in generic formulation buffer and subjected to three freeze/thaw cycles (freezing at −80° C. for 30 min followed by thawing for 30 min at room temperature), followed by high performance SEC to determine the percentage of initially monomeric antibody construct which had been converted into dimeric antibody construct. It is envisaged that the dimer percentages of the antibody constructs are ≤8%, preferably ≤6%, more preferably ≤5%, more preferably ≤4%, even more preferably ≤3%, even more preferably ≤2.5%, even more preferably ≤2%, even more preferably ≤1.5%, and most preferably ≤1% or ≤0.5% or even 0%, for example after three freeze/thaw cycles.


According to one embodiment, the antibody constructs used in accordance with the present invention show a favorable thermostability with aggregation temperatures ≥45° C. or ≥46° C., more preferably ≥47° C. or ≥48° C., even more preferably ≥49° C. or ≥50° C., and most preferably ≥51° C. The thermostability parameter can be determined in terms of antibody aggregation temperature as follows: Antibody solution at a concentration 250 μg/ml is transferred into a single use cuvette and placed in a dynamic light scattering (DLS) device. The sample is heated from 40° C. to 70° C. at a heating rate of 0.5° C./min with constant acquisition of the measured radius. Increase of radius indicating melting of the protein and aggregation is used to calculate the aggregation temperature of the antibody.


Alternatively, temperature melting curves can be determined by differential scanning calorimetry (DSC) to determine intrinsic biophysical protein stabilities of the antibody constructs. These experiments can be performed using a MicroCal LLC VP-DSC device. The energy uptake of a sample containing an antibody construct is recorded from 20° C. to 90° C. compared to a sample containing only the formulation buffer. The antibody constructs are adjusted to a final concentration of 250 μg/ml e.g. in SEC running buffer. For recording of the respective melting curve, the overall sample temperature is increased stepwise. Energy uptake of the sample and the formulation buffer reference is recorded at each temperature. The difference in energy uptake Cp (kcal/mole/° C.) of the sample minus the reference is plotted against the respective temperature. The melting temperature is defined as the temperature at the first maximum of energy uptake.


The antibody constructs used in accordance with the invention are also envisaged to have a turbidity of ≤0.2 or ≤0.15, preferably of ≤0.10 or ≤0.08, more preferably of ≤0.06 or ≤0.05, and most preferably of ≤0.04 or ≤0.03. The turbidity can be measured by OD340 at a concentration of the antibody construct of 2.5 mg/ml and 16 h incubation at 5° C.


Changes in the potency of a target×CD3 antibody construct as a function of preincubation of the construct on the target cells in the absence of T cells can be measured. If an antibody construct is internalized, it is expected to undergo lysosomal degradation. The effective concentration is hence expected to decrease over time, and thus the apparent potency should decrease as well. The effect has been observed with some targets, for which this is a known phenomenon. Antibody constructs used in accordance with the invention are envisaged to not be internalized or to not undergo significant internalization by the target cell. The rate of internalization can be assayed e.g. as described in the following: T cells are counted and diluted to a concentration of 1×105/ml in assay media. Target positive target cells are counted and plated e.g. at 2500 cells per well (cpw). The antibody construct is diluted serially 1:2, e.g. at a starting concentration of 100 nM. The antibody construct is added to the culture assay plates to allow for 0 hours, 1 hour or 2 hours of incubation prior to addition of the T cells. Then the T cells are plated at 25000 cpw (E:T=10:1), and the assay is incubated for 48 hours at 37° C. Target cell survival is analyzed e.g. with the Steady-Glo® system (25 μl/well). Preferably, the internalization rate (e.g. measured as a decrease in cytotoxicity) is ≤20% after a 2-hour (pre-)incubation of the antibody construct with the target cell, more preferably ≤15%, even more preferably ≤10%, and most preferably ≤5%.


It is furthermore envisaged for an antibody construct used in accordance with the invention that shed or soluble target does not significantly impair its efficacy or biologic activity. This can be measured e.g. in a cytotoxicity assay where soluble target is added at increasing concentrations to the assay, e.g. at 0 nM-0.3 nM-0.7 nM-1 nM-3 nM-7 nM-12 nM. An exemplary E:T value is 10:1. The EC50 value of the tested antibody construct should not be significantly increased in the presence of soluble target.


In a further embodiment, the antibody construct used in accordance with the invention is stable at acidic pH. The more tolerant the antibody construct behaves at unphysiologic pH such as pH 5.5 (a pH which is required to run e.g. a cation exchange chromatography), the higher is the recovery of the antibody construct eluted from an ion exchange column relative to the total amount of loaded protein. Recovery of the antibody construct from an ion (e.g., cation) exchange column at pH 5.5 is preferably ≥30%, more preferably ≥40%, more preferably ≥50%, even more preferably ≥60%, even more preferably ≥70%, even more preferably ≥80%, and most preferably ≥95%. The percentage represents the area under the curve (=AUC) of the main peak.


It is furthermore envisaged that the antibody constructs used in accordance with the present invention exhibit therapeutic efficacy, which manifests as anti-tumor activity or tumor growth inhibition. In one embodiment, the tumor growth inhibition of the antibody construct used in accordance with the invention T/C [%] is ≤70, ≤60, ≤50, ≤40, ≤30, ≤20, ≤10, ≤5, ≤4, ≤3, or ≤2. Modification or adjustment of certain parameters of these studies (such as the number of injected tumor cells, the site of injection, the number of transplanted human T cells, the amount of antibody constructs to be administered, and the timelines) is also envisaged, while still arriving at a meaningful and reproducible result.


The invention further provides a polynucleotide/nucleic acid molecule encoding an antibody construct used in accordance with the invention. Nucleic acid molecules are biopolymers composed of nucleotides. A polynucleotide is a biopolymer composed of 13 or more nucleotide monomers covalently bonded in a chain. DNA (such as cDNA) and RNA (such as mRNA) are examples of polynucleotides/nucleic acid molecules with distinct biological function. Nucleotides are organic molecules that serve as the monomers or subunits of nucleic acid molecules like DNA or RNA. The nucleic acid molecule or polynucleotide can be double stranded or single stranded, linear or circular. It is envisaged that the nucleic acid molecule or polynucleotide is comprised in a vector. It is furthermore envisaged that such vector is comprised in a host cell. Said host cell is, e.g. after transformation or transfection with the vector or the polynucleotide/nucleic acid molecule, capable of expressing the antibody construct. For this purpose, the polynucleotide or nucleic acid molecule is operatively linked with control sequences.


The genetic code is the set of rules by which information encoded within genetic material (nucleic acids) is translated into proteins. Biological decoding in living cells is accomplished by the ribosome which links amino acids in an order specified by mRNA, using tRNA molecules to carry amino acids and to read the mRNA three nucleotides at a time. The code defines how sequences of these nucleotide triplets, called codons, specify which amino acid will be added next during protein synthesis. With some exceptions, a three-nucleotide codon in a nucleic acid sequence specifies a single amino acid. Because most genes are encoded with the same code, this code is often referred to as the canonical or standard genetic code.


Degeneracy of codons is the redundancy of the genetic code, exhibited as the multiplicity of three-base pair codon combinations that specify an amino acid. Degeneracy results because there are more codons than encodable amino acids. The codons encoding one amino acid may differ in any of their three positions; however, often this difference is in the second or third position. For instance, codons GAA and GAG both specify glutamic acid and exhibit redundancy; but, neither specifies any other amino acid and thus demonstrate no ambiguity. The genetic codes of different organisms can be biased towards using one of the several codons that encode the same amino acid over the others—that is, a greater frequency of one will be found than expected by chance. For example, leucine is specified by six distinct codons, some of which are rarely used. Codon usage tables detailing genomic codon usage frequencies for most organisms are available. Recombinant gene technologies commonly take advantage of this effect by implementing a technique termed codon optimization, in which those codons are used to design a polynucleotide which are preferred by the respective host cell (such as a cell of human hamster origin, an Escherichia coli cell, or a Saccharomyces cerevisiae cell), e.g. to increase protein expression. It is hence envisaged that the polynucleotides/nucleic acid molecules of the present disclosure are codon optimized. Nevertheless, the polynucleotide/nucleic acid molecule encoding an antibody construct used in accordance with the invention may be designed using any codon that encodes the desired amino acid.


According to one embodiment, the polynucleotide/nucleic acid molecule encoding the antibody construct used in accordance with the invention is in the form of one single molecule or in the form of two or more separate molecules. If the antibody construct used in accordance with the present invention is a single chain antibody construct, the polynucleotide/nucleic acid molecule encoding such construct will most likely also be in the form of one single molecule. However, it is also envisaged that different components of the antibody construct (such as the different domains, e.g. the domain which binds to the target antigen(s), the domain which binds to CD3, and/or further domains such as antibody constant domains) are located on separate polypeptide chains, in which case the polynucleotide/nucleic acid molecule is most likely in the form of two or more separate molecules.


The same applies for the vector comprising a polynucleotide/nucleic acid molecule. If the antibody construct used in accordance with the present invention is a single chain antibody construct, one vector may comprise the polynucleotide which encodes the antibody construct in one single location (as one single open reading frame, ORF). One vector may also comprise two or more polynucleotides/nucleic acid molecules at separate locations (with individual ORFs), each one of them encoding a different component of the antibody construct used in accordance with the invention. It is envisaged that the vector comprising the polynucleotide/nucleic acid molecule of the present invention is in the form of one single vector or two or more separate vectors. In one embodiment, and for the purpose of expressing the antibody construct in a host cell, the host cell should comprise the polynucleotide/nucleic acid molecule encoding the antibody construct or the vector comprising such polynucleotide/nucleic acid molecule in their entirety, meaning that all components of the antibody construct—whether encoded as one single molecule or in separate molecules/locations—will assemble after translation and form together the biologically active antibody construct used in accordance with the invention.


Also disclosed herein is a vector comprising a polynucleotide/nucleic acid molecule used in accordance with the invention. A vector is a nucleic acid molecule used as a vehicle to transfer (foreign) genetic material into a cell, usually to ensure the replication and/or expression of the genetic material. The term “vector” encompasses—but is not restricted to—plasmids, viruses, cosmids, and artificial chromosomes. Some vectors are designed specifically for cloning (cloning vectors), others for protein expression (expression vectors). So-called transcription vectors are mainly used to amplify their insert. The manipulation of DNA is normally conducted on E. coli vectors, which contain elements necessary for their maintenance in E. coli. However, vectors may also have elements that allow them to be maintained in another organism such as yeast, plant or mammalian cells, and these vectors are called shuttle vectors. Insertion of a vector into the target or host cell is usually called transformation for bacterial cells and transfection for eukaryotic cells, while insertion of a viral vector is often called transduction.


In general, engineered vectors comprise an origin of replication, a multicloning site and a selectable marker. The vector itself is generally a nucleotide sequence, commonly a DNA sequence, that comprises an insert (transgene) and a larger sequence that serves as the “backbone” of the vector. While the genetic code determines the polypeptide sequence for a given coding region, other genomic regions can influence when and where these polypeptides are produced. Modem vectors may therefore encompass additional features besides the transgene insert and a backbone: promoter, genetic marker, antibiotic resistance, reporter gene, targeting sequence, protein purification tag. Vectors called expression vectors (expression constructs) specifically are for the expression of the transgene in the target cell, and generally have control sequences.


The term “control sequences” refers to DNA sequences necessary for the expression of an operably linked coding sequence in a specific host organism. The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally also an operator sequence, and a ribosome binding site. Eukaryotic cells are known to utilize promoters, polyadenylation signals, a Kozak sequence and enhancers.


A nucleic acid is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned to facilitate translation. Generally, “operably linked” means that the nucleotide sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.


“Transfection” is the process of deliberately introducing nucleic acid molecules or polynucleotides (including vectors) into target cells. The term is mostly used for non-viral methods in eukaryotic cells. Transduction is often used to describe virus-mediated transfer of nucleic acid molecules or polynucleotides. Transfection of animal cells typically involves opening transient pores or “holes” in the cell membrane, to allow the uptake of material. Transfection can be carried out using biological particles (such as viral transfection, also called viral transduction), chemical-based methods (such as using calcium phosphate, lipofection, Fugene, cationic polymers, nanoparticles) or physical treatment (such as electroporation, microinjection, gene gun, cell squeezing, magnetofection, hydrostatic pressure, impalefection, sonication, optical transfection, heat shock).


The term “transformation” is used to describe non-viral transfer of nucleic acid molecules or polynucleotides (including vectors) into bacteria, and into non-animal eukaryotic cells, including plant cells. Transformation is hence the genetic alteration of a bacterial or non-animal eukaryotic cell resulting from the direct uptake through the cell membrane(s) from its surroundings and subsequent incorporation of exogenous genetic material (nucleic acid molecules). Transformation can be achieved by artificial means. For transformation to happen, cells or bacteria must be in a state of competence, which might occur as a time-limited response to environmental conditions such as starvation and cell density and can also be artificially induced.


Moreover, disclosed is a host cell transformed or transfected with the polynucleotide/nucleic acid molecule used in accordance with the invention or with the vector used in accordance with the invention.


As used herein, the terms “host cell” or “recipient cell” are intended to include any individual cell or cell culture that can be or has been recipient of vectors, exogenous nucleic acid molecules and/or polynucleotides encoding the antibody construct used in accordance with the present invention; and/or recipients of the antibody construct itself. The introduction of the respective material into the cell is carried out by way of transformation, transfection and the like (vide supra). The term “host cell” is also intended to include progeny or potential progeny of a single cell. Because certain modifications may occur in succeeding generations due to either natural, accidental, or deliberate mutation or due to environmental influences, such progeny may not, in fact, be completely identical (in morphology or in genomic or total DNA complement) to the parent cell but is still included within the scope of the term as used herein. Suitable host cells include prokaryotic or eukaryotic cells and include—but are not limited to—bacteria (such as E. coli), yeast cells, fungi cells, plant cells, and animal cells such as insect cells and mammalian cells, e.g., hamster, murine, rat, macaque or human.


In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for the antibody construct used in accordance with the invention. Saccharomyces cerevisiae, or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms. However, a number of other genera, species, and strains are commonly available and useful herein, such as Schizosaccharomyces pombe, Kluyveromyces hosts such as K. lactis, K. fragilis (ATCC 12424), K. bulgaricus (ATCC 16045), K. wickeramii (ATCC 24178), K. waltii (ATCC 56500), K. drosophilarum (ATCC 36906), K. thermotolerans, and K. marxianus; yarrowia (EP 402 226); Pichia pastoris (EP 183 070); Candida; Trichoderma reesia (EP 244 234); Neurospora crassa; Schwanniomyces such as Schwanniomyces occidentalis; and filamentous fungi such as Neurospora, Penicillium, Tolypocladium, and Aspergillus hosts such as A. nidulans and A. niger.


Suitable host cells for the expression of a glycosylated antibody construct are derived from multicellular organisms. Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains and variants and corresponding permissive insect host cells from hosts such as Spodoptera frugiperda (caterpillar), Aedes aegypti (mosquito), Aedes albopictus (mosquito), Drosophila melanogaster (fruit fly), and Bombyx mori (silkmoth) have been identified. A variety of viral strains for transfection are publicly available, e.g., the L-1 variant of Autographa californica NPV and the Bm-5 strain of Bombyx mori NPV, and such viruses may be used as the virus, particularly for transfection of Spodoptera frugiperda cells.


Plant cell cultures of cotton, corn, potato, soybean, petunia, tomato, Arabidopsis and tobacco can also be used as hosts. Cloning and expression vectors useful in the production of proteins in plant cell culture are known to those of skill in the art. See e.g. Hiatt et al., Nature (1989) 342: 76-78, Owen et al. (1992) Bio/Technology 10: 790-794, Artsaenko et al. (1995) The Plant J 8: 745-750, and Fecker et al. (1996) Plant Mol Biol 32: 979-986.


However, interest has been greatest in vertebrate cells, and propagation of vertebrate cells in culture (cell culture) has become a routine procedure. Examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (such as COS-7, ATCC CRL 1651); human embryonic kidney line (such as 293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36: 59 (1977)); baby hamster kidney cells (such as BHK, ATCC CCL 10); Chinese hamster ovary cells/-DHFR (such as CHO, Urlaub et al., Proc. Natl. Acad. Sci. USA 77: 4216 (1980)); mouse sertoli cells (such as TM4, Mather, Biol. Reprod. 23: 243-251 (1980)); monkey kidney cells (such as CVI ATCC CCL 70); African green monkey kidney cells (such as VERO-76, ATCC CRL1587); human cervical carcinoma cells (such as HELA, ATCC CCL 2); canine kidney cells (such as MDCK, ATCC CCL 34); buffalo rat liver cells (such as BRL 3A, ATCC CRL 1442); human lung cells (such as W138, ATCC CCL 75); human liver cells (such as Hep G2,1413 8065); mouse mammary tumor (such as MMT 060562, ATCC CCL-51); TRI cells (Mather et al., Annals N. Y Acad. Sci. (1982) 383: 44-68); MRC 5 cells; FS4 cells; and a human hepatoma line (such as Hep G2).


Also disclosed herein is a process for producing an antibody construct used in accordance with the invention, said process comprising culturing a host cell n under conditions allowing the expression of the antibody construct used in accordance with the invention and recovering the produced antibody construct from the culture.


As used herein, the term “culturing” refers to the in vitro maintenance, differentiation, growth, proliferation and/or propagation of cells under suitable conditions in a medium. Cells are grown and maintained in a cell growth medium at an appropriate temperature and gas mixture. Culture conditions vary widely for each cell type. Typical growth conditions are a temperature of about 37° C., a CO2 concentration of about 5% and a humidity of about 95%. Recipes for growth media can vary e.g. in pH, concentration of the carbon source (such as glucose), nature and concentration of growth factors, and the presence of other nutrients (such as amino acids or vitamins). The growth factors used to supplement media are often derived from the serum of animal blood, such as fetal bovine serum (FBS), bovine calf serum (FCS), equine serum, and porcine serum. Cells can be grown either in suspension or as adherent cultures. There are also cell lines that have been modified to be able to survive in suspension cultures, so they can be grown to a higher density than adherent conditions would allow.


The term “expression” includes any step involved in the production of an antibody construct used in accordance with the invention including, but not limited to, transcription, post-transcriptional modification, translation, folding, post-translational modification, targeting to specific subcellular or extracellular locations, and secretion. The term “recovering” refers to a series of processes intended to isolate the antibody construct from the cell culture. The “recovering” or “purification” process may separate the protein and non-protein parts of the cell culture, and finally separate the desired antibody construct from all other polypeptides and proteins. Separation steps usually exploit differences in protein size, physico-chemical properties, binding affinity and biological activity. Preparative purifications aim to produce a relatively large quantity of purified proteins for subsequent use, while analytical purification produces a relatively small amount of a protein for a variety of research or analytical purposes.


When using recombinant techniques, the antibody construct can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody construct is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, are removed, for example, by centrifugation or ultrafiltration. The antibody construct used in accordance with the invention may e.g. be produced in bacteria such as E. coli. After expression, the construct is isolated from the bacterial cell paste in a soluble fraction and can be purified e.g. via affinity chromatography and/or size exclusion. Final purification can be carried out in a manner that is similar to the process for purifying an antibody construct expressed in mammalian cells and secreted into the medium. Carter et al. (Biotechnology (NY) 1992 February; 10(2):163-7) describe a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli.


Where the antibody is secreted into the medium, supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an ultrafiltration unit.


The antibody construct used in accordance with the invention prepared from the host cells can be recovered or purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography. Other techniques for protein purification such as fractionation on an ion-exchange column, mixed mode ion exchange, HIC, ethanol precipitation, size exclusion chromatography, reverse phase HPLC, chromatography on silica, chromatography on heparin sepharose, chromatography on an anion or cation exchange resin (such as a polyaspartic acid column), immunoaffinity (such as Protein A/G/L) chromatography, chromato-focusing, SDS-PAGE, ultracentrifugation, and ammonium sulfate precipitation are also available depending on the antibody construct to be recovered.


A protease inhibitor may be included in any of the foregoing steps to inhibit proteolysis, and antibiotics may be included to prevent the growth of contaminants.


According to the invention, the combination therapy or combination products/compositions comprise an inhibitor/antagonist of TNF/TNFR. INF is a cytokine that is involved in inflammation and regulation of the immune system. It is mainly produced by activated macrophages and well-known in the art (Holbrook, J. et al., F1000Research 2019, 8(F1000 Faculty Rev):111). Human TNF binds to two receptors, TNFR1 and TNFR2, respectively. While TNFR1 is expressed on essentially all human tissues, expression of TNFR2 is primarily confined to cells of the immune system, neurons, and endothelial cells. Interaction of TNF with its receptors results in conformational changes and binding to its receptor(s) induces, depending on the type of receptor (TNFR1 or TNFR2) and different signaling cascades, e.g., cell death by apoptosis or necrosis, but also cell proliferation, tissue regeneration and inflammation. Agonists/inhibitors of TNF, e.g., infliximab, etanercept, etc., are used as drugs in the treatment of various diseases such as autoimmune diseases (Rheumatoid Arthritis, Crohn's Disease, Ankylosing Spondylitis, etc.; Sedger and McDermott, Cytokine & Growth Factor Reviews 25 (2014) 453-472). In one particular embodiment of the invention, the antagonist/inhibitor of TNF/TNFR-mediated signaling is etanercept that is used in combination with an antibody construct as defined in any one of the preceding paragraphs.


Moreover, the invention provides a pharmaceutical composition or formulation comprising an antibody construct used in accordance with the invention or an antibody construct produced according to the process disclosed herein in combination with an inhibitor/antagonist of TNF/TNFR.


As used herein, an “inhibitor” or “antagonist” of TNF/TNFR is capable of completely or partially blocking or reducing TNF/TNFR-signaling. In embodiments of the invention, the “inhibitor” or “antagonist” of TNF/TNFR blocks signaling by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or completely, i.e. the effects based on TNF/TNFR-signaling that can be measured using suitable assays are no longer or only partially detectable. Suitable assays for the measurement of TNF/TNFR-signaling are, for example, based on the detection of TNFR-induced activation of NF-□B, but any other reliable and art-recognized test in vitro can be used (see also Chapter 4 of Z̆igon-Branc, Barlic̆ and Jeras' publication in IntechOpen entitled: In vitro Cell-Based Assays for Potency Testing of Anti-TNF-α Biological Drugs; Mar. 25, 2019 and references cited therein). “Reducing” has its commonly accepted meaning, i.e. the amount of a given parameter (number, signaling activity, etc.) is lowered compared to the status without exposure to a herein described inhibitor/antagonist.


Examples of “inhibitors” or “antagonists” of TNF/TNFR signaling are FDA)- and EMA-approved originator and biosimilar anti-TNF drugs, i.e. full-length monoclonal antibodies (mAbs) infliximab (IFX), a chimeric mouse/human mAb (Remicade® and its biosimilars: Remsima®, Inflectra®, Flixabi®, Ixifi®, Renflexis®, and Zessly®), adalimumab (ADA), a fully humanized mAb (Humira® and its biosimilars: Cyltezo®, Imraldi®, Amgevita®, Solymbic®, Hyrimoz®, Hulio®, Halimatoz®, and Heyifa®), and golimumab, another fully humanized mAb (Simponi®). The additional two anti-TNF biological drugs, which are not mAbs, are etanercept (ETA) (Enbrel® and its biosimilars: Erelzi® and Benepali®), a fusion protein consisting of two extracellular parts of the human TNFR2 and the Fc portion of human IgG1, and certolizumab pegol (Cimzia®) composed of a human Fab′ fragment, covalently attached to two cross-linked 20 kDa polyethylene glycol chains.


According to one embodiment of the present invention, the pharmaceutical compositions comprises an antagonist/inhibitor of TNF/TNFR-mediated signaling, which is preferably etanercept in combination with an antibody construct as defined in any one of the preceding paragraphs.


As used herein, an “inhibitor” or “antagonist” of interleukin 6 and the interleukin 6 receptor (IL6 and IL6R) is capable of completely or partially blocking or reducing IL6/IL6R-signaling. In embodiments of the invention, the “inhibitor” or “antagonist” of IL6/IL6R blocks signaling by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or completely, i.e. the effects based on IL6/IL6R-signaling that can be measured using suitable assays are no longer or only partially detectable. Suitable assays for the measurement of IL6/IL6R-signaling are, for example, based on the detection of IL-6 binding to the non-signal transducing IL-6 receptor (IL-6R), followed by complex formation with the signal-transducing coreceptor glycoprotein 130 (gp130) as disclosed in Baran et al. (http://www.jbc.org/cgi/doi/10.1074/jbc.RA117.001163).


As used herein, the term “pharmaceutical composition” relates to a composition which is suitable for administration to a patient, preferably a human patient. The particularly preferred pharmaceutical composition of this invention comprises one or a plurality of the antibody construct(s) used in accordance with the invention, preferably in a therapeutically effective amount, in combination with an inhibitor/antagonist of TNF/TNFR, preferably in a therapeutically effective amount. Preferably, the pharmaceutical composition further comprises suitable formulations of one or more (pharmaceutically effective) carriers, stabilizers, excipients, diluents, solubilizers, surfactants, emulsifiers, preservatives and/or adjuvants. Acceptable constituents of the composition are preferably nontoxic to recipients at the dosages and concentrations employed. Pharmaceutical compositions of the invention include, but are not limited to, liquid, frozen, and lyophilized compositions. The pharmaceutical compositions according to the present invention are combination products that may be combined to form a single pharmaceutical composition immediately prior to their administration to a patient in need thereof. Alternatively, the combination products may be prepared as pharmaceutical compostions by the manufacturer and may be ready used. This includes also combination products that must be reconstituted, diluted, or otherwise handled prior to use, but which contain already the active ingredients disclosed herein, i.e. one or a plurality of the antibody construct(s) used in accordance with the invention, preferably in a therapeutically effective amount, in combination with an inhibitor/antagonist of TNF/TNFR, preferably in a therapeutically effective amount.


The compositions may comprise a pharmaceutically acceptable carrier. In general, as used herein, “pharmaceutically acceptable carrier” means all aqueous and non-aqueous solutions, sterile solutions, solvents, buffers, e.g. phosphate buffered saline (PBS) solutions, water, suspensions, emulsions, such as oil/water emulsions, various types of wetting agents, liposomes, dispersion media and coatings, which are compatible with pharmaceutical administration, in particular with parenteral administration. The use of such media and agents in pharmaceutical compositions is well known in the art, and the compositions comprising such carriers can be formulated by well-known conventional methods.


Certain embodiments provide pharmaceutical compositions comprising the antibody construct used in accordance with the invention and further one or more excipients such as those illustratively described in this section and elsewhere herein. Excipients can be used in the invention for a wide variety of purposes, such as adjusting physical, chemical, or biological properties of formulations, such as adjustment of viscosity, and or processes to improve effectiveness and/or to stabilize such formulations and processes against degradation and spoilage e.g. due to stresses that occur during manufacturing, shipping, storage, pre-use preparation, administration, and thereafter. Excipients should in general be used in their lowest effective concentrations.


In certain embodiments, the pharmaceutical composition may contain formulation materials for modifying, maintaining or preserving certain characteristics of the composition such as the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration (see, Remington's Pharmaceutical Sciences, 18″ Edition, 1990, Mack Publishing Company). In such embodiments, suitable formulation materials may include, but are not limited to:

    • amino acids
    • antimicrobials such as antibacterial and antifungal agents
    • antioxidants
    • buffers, buffer systems and buffering agents that are used to maintain the composition at physiological pH or at a slightly lower pH, typically within a pH range of from about 5 to about 8 or 9
    • non-aqueous solvents, vegetable oils, and injectable organic esters
    • aqueous carriers including water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media
    • biodegradable polymers such as polyesters
    • bulking agents
    • chelating agents
    • isotonic and absorption delaying agents
    • complexing agents
    • fillers
    • carbohydrates
    • (low molecular weight) proteins, polypeptides or proteinaceous carriers, preferably of human origin
    • coloring and flavouring agents
    • sulfur containing reducing agents
    • diluting agents
    • emulsifying agents
    • hydrophilic polymers
    • salt-forming counter-ions
    • preservatives
    • metal complexes
    • solvents and co-solvents
    • sugars and sugar alcohols
    • suspending agents
    • surfactants or wetting agents
    • stability enhancing agents
    • tonicity enhancing agents
    • parenteral delivery vehicles
    • intravenous delivery vehicles


It is common knowledge that the different constituents of the pharmaceutical composition can have different effects, for example, and amino acid can act as a buffer, a stabilizer and/or an antioxidant; mannitol can act as a bulking agent and/or a tonicity enhancing agent; sodium chloride can act as delivery vehicle and/or tonicity enhancing agent; etc


In the context of the present invention, a pharmaceutical composition may comprise:

    • (a) an antibody construct as described herein,
    • (b) at least one buffer agent,
    • (c) at least one saccharide, and
    • (d) at least one surfactant;


      wherein the pH of the pharmaceutical composition is in the range of 3.5 to 6.0.


In the composition described above, the first domain preferably has an isoelectric point (pI) in the range of 4 to 9.5; the second domain has a pI in the range of 8 to 10, preferably 8.5 to 9.0; and the antibody construct optionally also comprises a third domain comprising two polypeptide monomers, each comprising a hinge, a CH2 domain and a CH3 domain, wherein said two polypeptide monomers are fused to each other via a peptide linker;


In the composition described above, it is further envisaged that the at least one buffer agent is present at a concentration range of 5 to 200 mM, more preferably at a concentration range of 10 to 50 mM. It is also envisaged that the at least one saccharide is selected from the group consisting of monosaccharide, disaccharide, cyclic polysaccharide, sugar alcohol, linear branched dextran or linear non-branched dextran. It is also envisaged that the disacchade is selected from the group consisting of sucrose, trehalose and mannitol, sorbitol, and combinations thereof. It is further envisaged that the sugar alcohol is sorbitol. It is also envisaged that the at least one saccharide is present at a concentration in the range of 1 to 15% (mN), preferably in a concentration range of 9 to 12% (mN). It is further envisaged that the antibody construct is present in a concentration range of 0.1 to 8 mg/ml, preferably of 0.2-2.5 mg/ml, more preferably of 0.25-1.0 mg/ml.


According to one embodiment of the composition described above, the at least one surfactant is selected from the group consisting of polysorbate 20, polysorbate 40, polysorbate 60, polysorbate 80, poloxamer 188, pluronic F68, triton X-100, polyoxyethylen, PEG 3350, PEG 4000 and combinations thereof. It is further envisaged that the at least one surfactant is present at a concentration in the range of 0.004 to 0.5% (mN), preferably in the range of 0.001 to 0.01% (mN). It is envisaged that the pH of the composition is in the range of 4.0 to 5.0, preferably 4.2. It is also envisaged that the pharmaceutical composition has an osmolarity in the range of 150 to 500 mOsm. It is further envisaged that the pharmaceutical composition further comprises an excipient selected from the group consisting of one or more polyol(s) and one or more amino acid(s). It is envisaged in the context of the present invention that said one or more excipient is present in the concentration range of 0.1 to 15% (w/V).


The present invention also provides a pharmaceutical composition comprising

    • (a) the antibody construct as described herein, preferably in a concentration range of 0.1 to 8 mg/ml, preferably of 0.2-2.5 mg/ml, more preferably of 0.25-1.0 mg/ml;
    • (b) 10 mM glutamate or acetate;
    • (c) 9% (mN) sucrose or 6% (mN) sucrose and 6% (mN) hydroxypropyl-β-cyclodextrin;
    • (d) 0.01% (m/V) polysorbate 80;
    • (e) wherein the pH of the liquid pharmaceutical composition is 4.2.


It is envisaged that the composition of the invention might comprise, in addition to the antibody construct and the inhibitor or antagonist of TNF/TNFR-mediated signaling used in accordance with the invention defined herein, further biologically active agents, depending on the intended use of the composition. Such agents might be drugs acting on the gastro-intestinal system, drugs acting as cytostatica, drugs preventing hyperurikemia, drugs inhibiting immunoreactions, drugs modulating the inflammatory response, drugs acting on the circulatory system and/or agents such as cytokines known in the art. It is also envisaged that the antibody construct used in accordance with the present invention is applied in a co-therapy, i.e., in combination with another anti-cancer medicament.


In this context, it is envisaged that the pharmaceutical composition of the invention (which comprises an antibody construct comprising a first domain which binds to the target antigen(s) on the surface of a target cell and a second domain which binds to CD3 on the surface of a T cell, and an inhibitor/antagonist of TNF/TNFR signaling, as described in more detail herein above) furthermore comprises an agent, preferably an antibody or antibody construct, which binds to a protein of the immune checkpoint pathway (such as PD-1 or CTLA-4) or to a co-stimulatory immune checkpoint receptor (such as 4-1BB). The present invention also refers to a combination of an antibody construct according used in accordance with the invention (which comprises an antibody construct comprising a first domain which binds to the target antigen(s) on the surface of a target cell and a second domain which binds to CD3 on the surface of a T cell, and an inhibitor/antagonist of TNF/TNFR signaling, as described in more detail herein above) and an agent, preferably an antibody or antibody construct, which binds to a protein of the immune checkpoint pathway (such as PD-1 or CTLA-4) or to a co-stimulatory immune checkpoint receptor (such as 4-1BB). Due to the nature of the at least three ingredients of the combination, namely their pharmaceutical activity, the combination can also be referred to as a therapeutic combination. In some embodiments, the combination can be in the form of a pharmaceutical composition or of a kit. According to one embodiment, the pharmaceutical composition or the combination comprises an antibody construct used in accordance with the invention, an inhibitor/antagonist of TNF/TNFR signaling, and an antibody or antibody construct which binds to PD-1. Anti-PD-1 binding proteins useful for this purpose are e.g. described in detail in PCT/US2019/013205.


Hence, in a further aspect, the present invention is directed to a pharmaceutical composition or to a combination comprising:


(i) an antibody construct comprising a first domain which binds to the target antigen(s) on the surface of a target cell and a second domain which binds to CD3 on the surface of a T cell and at least one inhibitor/antagonist of TNF/TNFR, as described in more detail herein above, and


(ii) an antibody or antibody construct which binds to PD-1 and comprises: a VH region comprising CDR-H1 as depicted in SEQ ID NO: 122, CDR-H2 as depicted in SEQ ID NO: 123, and CDR-H3 as depicted in SEQ ID NO: 124, and/or a VL region comprising CDR-L1 as depicted in SEQ ID NO: 125, CDR-L2 as depicted in SEQ ID NO: 126 and CDR-L3 as depicted in SEQ ID NO: 127; a VH region comprising CDR-H1 as depicted in SEQ ID NO: 128, CDR-H2 as depicted in SEQ ID NO: 129, and CDR-H3 as depicted in SEQ ID NO: 130, and/or a VL region comprising CDR-L1 as depicted in SEQ ID NO: 131, CDR-L2 as depicted in SEQ ID NO: 132 and CDR-L3 as depicted in SEQ ID NO: 133; a VH region comprising CDR-H1 as depicted in SEQ ID NO: 134, CDR-H2 as depicted in SEQ ID NO: 135, and CDR-H3 as depicted in SEQ ID NO: 136, and/or a VL region comprising CDR-L1 as depicted in SEQ ID NO: 137, CDR-L2 as depicted in SEQ ID NO: 138 and CDR-L3 as depicted in SEQ ID NO: 139; a VH region comprising CDR-H1 as depicted in SEQ ID NO: 140, CDR-H2 as depicted in SEQ ID NO: 141, and CDR-H3 as depicted in SEQ ID NO: 142, and/or a VL region comprising CDR-L1 as depicted in SEQ ID NO: 143, CDR-L2 as depicted in SEQ ID NO: 144 and CDR-L3 as depicted in SEQ ID NO: 145; a VH region comprising CDR-H1 as depicted in SEQ ID NO: 146, CDR-H2 as depicted in SEQ ID NO: 147, and CDR-H3 as depicted in SEQ ID NO: 148, and/or a VL region comprising CDR-L1 as depicted in SEQ ID NO: 149, CDR-L2 as depicted in SEQ ID NO: 150 and CDR-L3 as depicted in SEQ ID NO: 151; a VH region comprising CDR-H1 as depicted in SEQ ID NO: 152, CDR-H2 as depicted in SEQ ID NO: 153, and CDR-H3 as depicted in SEQ ID NO: 154, and/or a VL region comprising CDR-L1 as depicted in SEQ ID NO: 155, CDR-L2 as depicted in SEQ ID NO: 156 and CDR-L3 as depicted in SEQ ID NO: 157; a VH region comprising CDR-H1 as depicted in SEQ ID NO: 158, CDR-H2 as depicted in SEQ ID NO: 159, and CDR-H3 as depicted in SEQ ID NO: 160, and/or a VL region comprising CDR-L1 as depicted in SEQ ID NO: 161, CDR-L2 as depicted in SEQ ID NO: 162 and CDR-L3 as depicted in SEQ ID NO: 163; or a VH region comprising CDR-H1 as depicted in SEQ ID NO: 164, CDR-H2 as depicted in SEQ ID NO: 165, and CDR-H3 as depicted in SEQ ID NO: 166, and/or a VL region comprising CDR-L1 as depicted in SEQ ID NO: 167, CDR-L2 as depicted in SEQ ID NO: 168 and CDR-L3 as depicted in SEQ ID NO: 169.


(iii) In one embodiment, the above described antibody or antibody construct which binds to PD-1 comprises a VH region as depicted in SEQ ID NO: 170, and a VL region as depicted in SEQ ID NO: 171; a VH region as depicted in SEQ ID NO: 172, and a VL region as depicted in SEQ ID NO: 173; a VH region as depicted in SEQ ID NO: 174, and a VL region as depicted in SEQ ID NO: 175; a VH region as depicted in SEQ ID NO: 176, and a VL region as depicted in SEQ ID NO: 177; a VH region as depicted in SEQ ID NO: 178, and a VL region as depicted in SEQ ID NO: 179; a VH region as depicted in SEQ ID NO: 180, and a VL region as depicted in SEQ ID NO: 181; a VH region as depicted in SEQ ID NO: 182, and a VL region as depicted in SEQ ID NO: 183; or a VH region as depicted in SEQ ID NO: 184, and a VL region as depicted in SEQ ID NO: 185.


(iv) In one embodiment, the above antibody or antibody construct which binds to PD-1 comprises: a heavy chain as depicted in SEQ ID NO: 186, and a light chain as depicted in SEQ ID NO: 187; a heavy chain as depicted in SEQ ID NO: 188, and a light chain as depicted in SEQ ID NO: 189; a heavy chain as depicted in SEQ ID NO: 190, and a light chain as depicted in SEQ ID NO: 191; a heavy chain as depicted in SEQ ID NO: 192, and a light chain as depicted in SEQ ID NO: 193; a heavy chain as depicted in SEQ ID NO: 194, and a light chain as depicted in SEQ ID NO: 195; a heavy chain as depicted in SEQ ID NO: 196, and a light chain as depicted in SEQ ID NO: 197; a heavy chain as depicted in SEQ ID NO: 198, and a light chain as depicted in SEQ ID NO: 199; or a heavy chain as depicted in SEQ ID NO: 200, and a light chain as depicted in SEQ ID NO: 201.


In certain embodiments, the optimal pharmaceutical composition is determined depending upon, for example, the intended route of administration, delivery format and desired dosage. See, for example, Remington's Pharmaceutical Sciences, supra. In certain embodiments, such compositions may influence the physical state, stability, rate of in vivo release and rate of in vivo clearance of the antibody construct used in accordance with the invention. In certain embodiments, the primary vehicle or carrier in a pharmaceutical composition may be either aqueous or non-aqueous in nature. For example, a suitable vehicle or carrier may be water for injection or physiological saline solution, possibly supplemented with other materials common in compositions for parenteral administration. In certain embodiments, the compositions comprising the antibody construct used in accordance with the invention may be prepared for storage by mixing the selected composition having the desired degree of purity with optional formulation agents (Remington's Pharmaceutical Sciences, supra) in the form of a lyophilized cake or an aqueous solution. Further, in certain embodiments, the antibody construct used in accordance with the invention may be formulated as a lyophilizate using appropriate excipients.


When parenteral administration is contemplated, the therapeutic compositions used in this invention may be provided in the form of a pyrogen-free, parenterally acceptable aqueous solution comprising the desired antibody construct used in accordance with the invention in a pharmaceutically acceptable vehicle. A particularly suitable vehicle for parenteral injection is sterile distilled water in which the antibody construct used in accordance with the invention is formulated as a sterile, isotonic solution, properly preserved. In certain embodiments, the preparation can involve the formulation of the desired molecule with an agent that may provide controlled or sustained release of the product which can be delivered via depot injection, or that may promote sustained duration in the circulation. In certain embodiments, implantable drug delivery devices may be used to introduce the desired antibody construct.


Additional pharmaceutical compositions will be evident to those skilled in the art, including formulations including the antibody construct used in accordance with the invention in sustained or controlled delivery formulations. Techniques for formulating a variety of sustained- or controlled-delivery means are known to those skilled in the art. The antibody construct may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, in colloidal drug delivery systems, or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences, supra.


Pharmaceutical compositions used for in vivo administration are typically provided as sterile preparations. Sterilization can be accomplished by filtration through sterile filtration membranes. When the composition is lyophilized, sterilization using this method may be conducted either prior to or following lyophilization and reconstitution. Compositions for parenteral administration can be stored in lyophilized form or in a solution. Parenteral compositions are generally placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.


Another aspect of the invention includes self-buffering formulations comprising the antibody construct used in accordance with the invention, which can be used as pharmaceutical compositions, as described in international patent application WO 2006/138181. A variety of publications are available on protein stabilization and formulation materials and methods useful in this regard, such as Arawaka T. et al., Pharm Res. 1991 March; 8(3):285-91; Kendrick et al., “Physical stabilization of proteins in aqueous solution” in: Rational Design of Stable Protein Formulations: Theory and Practice, Carpenter and Manning, eds. Pharmaceutical Biotechnology. 13: 61-84 (2002), and Randolph and Jones, Pharm Biotechnol. 2002; 13:159-75, see particularly the parts pertinent to excipients and processes for self-buffering protein formulations, especially as to protein pharmaceutical products and processes for veterinary and/or human medical uses.


Salts may be used in accordance with certain embodiments of the invention, e.g. to adjust the ionic strength and/or the isotonicity of a composition or formulation and/or to improve the solubility and/or physical stability of an antibody construct or other ingredient of a composition in accordance with the invention. Ions can stabilize the native state of proteins by binding to charged residues on the protein's surface and by shielding charged and polar groups in the protein and reducing the strength of their electrostatic interactions, attractive, and repulsive interactions. Ions also can stabilize the denatured state of a protein by binding to, particularly the denatured peptide linkages (—CONH) of the protein. Furthermore, ionic interaction with charged and polar groups in a protein also can reduce intermolecular electrostatic interactions and, thereby, prevent or reduce protein aggregation and insolubility.


Ionic species differ significantly in their effects on proteins. Several categorical rankings of ions and their effects on proteins have been developed that can be used in formulating pharmaceutical compositions in accordance with the invention. One example is the Hofmeister series, which ranks ionic and polar non-ionic solutes by their effect on the conformational stability of proteins in solution. Stabilizing solutes are referred to as “kosmotropic”. Destabilizing solutes are referred to as “chaotropic”. Kosmotropes are commonly used at high concentrations to precipitate proteins from solution (“salting-out”). Chaotropes are commonly used to denature and/or to solubilize proteins (“salting-in”). The relative effectiveness of ions to “salt-in” and “salt-out” defines their position in the Hofmeister series.


Free amino acids can be used in formulations or compositions comprising the antibody construct used in accordance with the invention in accordance with various embodiments of the invention as bulking agents, stabilizers, and antioxidants, as well as for other standard uses. Certain amino acids can be used for stabilizing proteins in a formulation, others are useful during lyophilization to ensure correct cake structure and properties of the active ingredient. Some amino acids may be useful to inhibit protein aggregation in both liquid and lyophilized formulations, and others are useful as antioxidants.


Polyols are kosmotropic and are useful as stabilizing agents in both liquid and lyophilized formulations to protect proteins from physical and chemical degradation processes. Polyols are also useful for adjusting the tonicity of formulations and for protecting against freeze-thaw stresses during transport or the preparation of bulks during the manufacturing process. Polyols can also serve as cryoprotectants in the context of the present invention.


Certain embodiments of the formulation or composition comprising the antibody construct used in accordance with the invention can comprise surfactants. Proteins may be susceptible to adsorption on surfaces and to denaturation and resulting aggregation at air-liquid, solid-liquid, and liquid-liquid interfaces. These deleterious interactions generally scale inversely with protein concentration and are typically exacerbated by physical agitation, such as that generated during the shipping and handling of a product. Surfactants are routinely used to prevent, minimize, or reduce surface adsorption. Surfactants also are commonly used to control protein conformational stability. The use of surfactants in this regard is protein specific, since one specific surfactant will typically stabilize some proteins and destabilize others.


Certain embodiments of the formulation or composition comprising the antibody construct used in accordance with the invention can comprise one or more antioxidants. To some extent deleterious oxidation of proteins can be prevented in pharmaceutical formulations by maintaining proper levels of ambient oxygen and temperature and by avoiding exposure to light. Antioxidant excipients can also be used to prevent oxidative degradation of proteins. It is envisaged that antioxidants used in therapeutic protein formulations in accordance with the present invention can be water-soluble and maintain their activity throughout the shelf life of the product (the composition comprising the antibody construct). Antioxidants can also damage proteins and should hence—among other things—be selected in a way to eliminate or sufficiently reduce the possibility of antioxidants damaging the antibody construct or other proteins in the formulation.


Certain embodiments of the formulation or composition comprising the antibody construct used in accordance with the invention can comprise one or more preservatives. Preservatives are necessary for example when developing multi-dose parenteral formulations that involve more than one extraction from the same container. Their primary function is to inhibit microbial growth and ensure product sterility throughout the shelf-life or term of use of the drug product. Although preservatives have a long history of use with small-molecule parenterals, the development of protein formulations that include preservatives can be challenging. Preservatives very often have a destabilizing effect (aggregation) on proteins, and this has become a major factor in limiting their use in multi-dose protein formulations. To date, most protein drugs have been formulated for single-use only. However, when multi-dose formulations are possible, they have the added advantage of enabling patient convenience, and increased marketability. A good example is that of human growth hormone (hGH) where the development of preserved formulations has led to commercialization of more convenient, multi-use injection pen presentations. Several aspects need to be considered during the formulation and development of preserved dosage forms. The effective preservative concentration in the drug product must be optimized. This requires testing a given preservative in the dosage form with concentration ranges that confer anti-microbial effectiveness without compromising protein stability.


As might be expected, development of liquid formulations containing preservatives are more challenging than lyophilized formulations. Freeze-dried products can be lyophilized without the preservative and reconstituted with a preservative containing diluent at the time of use. This shortens the time during which a preservative is in contact with the antibody construct, significantly minimizing the associated stability risks. With liquid formulations, preservative effectiveness and stability should be maintained over the entire product shelf-life. An important point to note is that preservative effectiveness should be demonstrated in the final formulation containing the active drug and all excipient components. Once the pharmaceutical composition has been formulated, it may be stored in sterile vials as a solution, suspension, gel, emulsion, solid, crystal, or as a dehydrated or lyophilized powder. Such formulations may be stored either in a ready-to-use form or in a form (e.g., lyophilized) that is reconstituted prior to administration.


The biological activity of the pharmaceutical composition defined herein can be determined for instance by cytotoxicity assays, as described in the following examples, in WO 99/54440 or by Schlereth et al. (Cancer Immunol. Immunother. 20 (2005), 1-12). “Efficacy” or “in vivo efficacy” as used herein refers to the response to therapy by the pharmaceutical composition of formulation of the invention, using e.g. standardized NCI response criteria. The success or in vivo efficacy of the therapy using a pharmaceutical composition of the invention refers to the effectiveness of the composition for its intended purpose, i.e. the ability of the composition to cause its desired effect, i.e. depletion of pathologic cells, e.g. tumor cells. The in vivo efficacy may be monitored by established standard methods for the respective disease entities including, but not limited to, white blood cell counts, differentials, fluorescence activated cell sorting, bone marrow aspiration. In addition, various disease specific clinical chemistry parameters and other established standard methods may be used. Furthermore, computer-aided tomography, X-ray, nuclear magnetic resonance tomography, positron-emission tomography scanning, lymph node biopsies/histologies and other established standard methods may be used.


Another major challenge in the development of drugs such as the pharmaceutical composition of the invention is the predictable modulation of pharmacokinetic properties. To this end, a pharmacokinetic profile of the drug candidate, i.e. a profile of the pharmacokinetic parameters that affect the ability of a specific drug to treat a given condition, can be established. Pharmacokinetic parameters of the drug influencing the ability of a drug for treating a certain disease entity include, but are not limited to: half-life, volume of distribution, hepatic first-pass metabolism and the degree of blood serum binding. The efficacy of a given drug agent can be influenced by each of the parameters mentioned above.


“Half-life” is the time required for a quantity to reduce to half its initial value. The medical sciences refer to the half-life of substances or drugs in the human body. In a medical context, half-life may refer to the time it takes for a substance/drug to lose one-half of its activity, e.g. pharmacologic, physiologic, or radiological activity. The half-life may also describe the time that it takes for the concentration of a drug or substance (e.g., an antibody construct used in accordance with the invention) in blood plasma/serum to reach one-half of its steady-state value (“serum half-life”). Typically, the elimination or removal of an administered substance/drug refers to the body's cleansing through biological processes such as metabolism, excretion, also involving the function of kidneys and liver. The “first-pass metabolism” is a phenomenon of drug metabolism whereby the concentration of a drug is reduced before it reaches the circulation. It is the fraction of drug lost during the process of absorption. Accordingly, by “hepatic first-pass metabolism” is meant the propensity of a drug to be metabolized upon first contact with the liver, i.e. during its first pass through the liver. “Volume of distribution” (VD) means the degree to which a drug is distributed in body tissue rather than the blood plasma, a higher VD indicating a greater amount of tissue distribution. The retention of a drug can occur throughout the various compartments of the body, such as intracellular and extracellular spaces, tissues and organs, etc. “Degree of blood serum binding” means the propensity of a drug to interact with and bind to blood serum proteins, such as albumin, leading to a reduction or loss of biological activity of the drug.


Pharmacokinetic parameters also include bioavailability, lag time (T lag), Tmax, absorption rates, and/or Cmax for a given amount of drug administered. “Bioavailability” refers to the fraction of an administered dose of a drug/substance that reaches the systemic circulation (the blood compartment). When a medication is administered intravenously, its bioavailability is considered to be 100%. However, when a medication is administered via other routes (such as orally), its bioavailability generally decreases. “Lag time” means the time delay between the administration of the drug and its detection and measurability in blood or plasma. Cmax is the maximum plasma concentration that a drug achieves after its administration (and before the administration of a second dose). Tmax is the time at which Cmax is reached. The time to reach a blood or tissue concentration of the drug which is required for its biological effect is influenced by all parameters. Pharmacokinetic parameters of antibody constructs exhibiting cross-species specificity may be determined in preclinical animal testing in non-chimpanzee primates as outlined above and set forth e.g. in Schlereth et al. (supra).


One embodiment provides the antibody construct used in accordance with the invention (or the antibody construct produced according to the process disclosed herein) used in the prevention, treatment or amelioration of a disease, preferably a neoplasm. Another embodiment provides the use of the antibody construct used in accordance with the invention in the manufacture of a medicament for the prevention, treatment or amelioration of a disease, preferably a neoplasm. It is also envisaged to provide a method for the prevention, treatment or amelioration of a disease, preferably a neoplasm, comprising the step of administering to a subject in need thereof the antibody construct. The terms “subject in need”, “patient” or those “in need of treatment” include those already with the disease, as well as those in which the disease is to be prevented. The terms also include human and other mammalian subjects that receive either prophylactic or therapeutic treatment unless the species or genus is specifically indicated. In particular embodiments of all other embodiments or claims herein, the term “patient” relates to human patients and/or non-human primates.


The antibody constructs used in accordance with the invention and the formulations/pharmaceutical compositions described herein are useful in the treatment, amelioration and/or prevention of the medical condition as described herein in a patient in need thereof. The term “treatment” refers to both therapeutic treatment and prophylactic or preventative measures. Treatment includes the application or administration of the antibody constructs/pharmaceutical composition to the body, to an isolated tissue, or to a cell from a patient or a subject in need who has a disease/disorder as described herein, a symptom of such disease/disorder, or a predisposition toward such disease/disorder, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disease, the symptom of the disease, or the predisposition toward the disease. The term “amelioration” as used herein refers to any improvement of the disease state of a patient, by the administration of an antibody construct according to the invention to such patient or subject in need thereof. Such an improvement may be a slowing down or stopping of the progression of the disease of the patient, and/or as a decrease in severity of disease symptoms, an increase in frequency or duration of disease symptom-free periods or a prevention of impairment or disability due to the disease. The term “prevention” as used herein means the avoidance of the occurrence or of the re-occurrence of a disease as specified herein, by the administration of an antibody construct used in accordance with the invention to a subject in need thereof. Further, a “patient at risk of developing an adverse event” or “patient with an intolerance to” a given substance/drug includes patients that are known to have previously reacted adversely to such given substance/drug. Also encompassed can be patients having a total B cell count of less than about 50 B cells/microliter of peripheral blood, which are known as susceptible to potential adverse effects also including the onset of an adverse effect to immunotherapy with CD3-binding antibody-based molecules, particularly with blinatumumab, while a patient who has a total B cell count of greater than about 50 B cells/microliter of peripheral blood does not have (is not at) or at least has (is at) a decreased risk of potential adverse effects. Also patients with a B:T cell ratio that is lower than 1:5 to 1:10, particularly lower than 1:5 are often at higher risk of developing adverse events to immunotherapy with CD3-binding antibody-based molecules. Such patients form are particular group that profits from the herein described methods of preventing adverse effects and is a particular group that is contemplated for a preventive method using the herein described TNF/TNFR signaling antagonists or inhibitors. To determine the B cell numbers or the B:T ratio, A sample which includes peripheral blood mononuclear cells (PBMCs), in particular B cells and T cells is preferably taken from peripheral blood of a patient. The B:T cell ratio of the patient population treated according to the present disclosure may be about 1:5 or lower including a B:T cell ratio of about 1:6, 1:7, 1:8, 1:9, 1:10, 1:11, 1:12, 1:13, 1:14, 1:15, 1:20, 1:100, 1:200, 1:400, 1:500, 1:1000, 1:2000, 1:3000, 1:4000, 1:5000 or even lower, with less than about 1:8, 1:9, 1:10, 1:50, 1:100, 1:500, 1:1000 being indicative for a risk of potential adverse effects for said patient.


“Determining the B:T cell ratio” includes determining the total B cell number in a sample from a patient, preferably in a peripheral blood sample of the patient; determining the total T cell number in sample from a patient, preferably in a peripheral blood sample of the patient; and calculating the ratio of the B cell number of step (a) and the T cell number of step (b) in order to obtain a B:T cell ratio. Of note, a low B:T cell ratio can also be seen as high T:B ratio; and vice versa. Accordingly, the ratios provided herein for a low B:T cell ratio would then have to be reversed.


The term “disease” refers to any condition that would benefit from treatment with the antibody construct or the pharmaceutical composition described herein. This includes chronic and acute disorders or diseases including those pathological conditions that predispose the mammal to the disease in question. The disease is preferably a neoplasm, cancer or tumor. The disease, neoplasm, cancer or tumor is preferably the target antigen(s) positive, i.e. it is characterized by expression or overexpression of the target antigen(s).


A “neoplasm” is an abnormal growth of tissue, usually but not always forming a mass. When also forming a mass, it is commonly referred to as a “tumor”. Neoplasms or tumors can be benign, potentially malignant (pre-cancerous), or malignant (cancerous). Malignant neoplasms/tumors are commonly called cancer. They usually invade and destroy the surrounding tissue and may form metastases, i.e., they spread to other parts, tissues or organs of the body. A “primary tumor” is a tumor growing at the anatomical site where tumor progression began and proceeded to yield a cancerous mass. Most cancers develop at their primary site but then go on to metastasize or spread to other parts (e.g. tissues and organs) of the body. These further tumors are “secondary tumors”. Most cancers continue to be called after their primary site, even after they have spread to other parts of the body.


The term “target cell” as used herein relates to cells expressing a target antigen, e.g. a tumor associated antigen, hence the target cells may also be referred to as cancer cells, independent of their stage of transformation or cancer stage, provided the cells express or are induced to express a target antigen that is selectively bound by a domain of the herein described antibody construct and which is different from CD3.


Lymphomas and leukemias are lymphoid neoplasms. For the purposes of the present invention, they are also encompassed by the terms “tumor” or “cancer”. For the purposes of the present invention, the terms “neoplasm”, “tumor” and “cancer” may be used interchangeably, and they comprise both primary tumors/cancers and secondary tumors/cancers (or “metastases”) as well as mass-forming neoplasms (tumors) and lymphoid neoplasms (such as lymphomas and leukemias), and minimal residual disease (MRD).


The term “minimal residual disease” (MRD) refers to the evidence for the presence of small numbers of residual cancer cells that remain in the patient after cancer treatment, e.g. when the patient is in remission (no symptoms or signs of disease). A very small number of remaining cancer cells usually cannot be detected by routine means because the standard tests used to assess or detect cancer are not sensitive enough to detect MRD. Nowadays, very sensitive molecular biology tests for MRD are available, such as flow cytometry, PCR and next-generation sequencing. These tests can measure minimal levels of cancer cells in tissue samples, sometimes as low as one cancer cell in a million normal cells. In the context of the present invention, the terms “prevention”, “treatment” or “amelioration” of a cancer are envisaged to also encompass “prevention, treatment or amelioration of MRD”, whether the MRD was detected or not.


In one embodiment of the invention, the neoplasm, cancer or tumor is selected from the group comprising: carcinoma, sarcoma, myeloma, leukemia, or lymphoma, including, but not limited to, (or consisting of) ovarian cancer, uterine cancer, germinal cancer, breast cancer, brain cancer, prostate cancer, pancreas cancer, liver cancer, colon cancer, intestinal cancer, bone cancer, mouth, gastric cancer, bone cancer, mouth cancer, esophagus cancer, leukemia, melanoma, renal carcinoma, bladder carcinoma, small cell carcinoma, head and neck cancer, and lung cancer.


The antibody construct used in accordance with the invention will generally be designed for specific routes and methods of administration, for specific dosages and frequencies of administration, for specific treatments of specific diseases, with ranges of bio-availability and persistence, among other things. The materials of the composition are preferably formulated in concentrations that are acceptable for the site of administration. Formulations and compositions thus may be designed in accordance with the invention for delivery by any suitable route of administration. In the context of the present invention, the routes of administration include, but are not limited to topical routes, enteral routes and parenteral routes. The herein described antibody constructs are particularly suitable for intravenous administration. The TNF/TNFR and/or IL6/IL6R signaling pathway inhibitors are particularly for intravenous and/or subcutaneous administration as commonly known in the art.


If the pharmaceutical composition has been lyophilized, the lyophilized material is first reconstituted in an appropriate liquid prior to administration. The lyophilized material may be reconstituted in, e.g., bacteriostatic water for injection (BWFI), physiological saline, phosphate buffered saline (PBS), or the same formulation the protein had been in prior to lyophilization. The pharmaceutical compositions and the antibody construct used in accordance with this invention are particularly useful for parenteral administration, e.g., intravenous delivery, for example by injection or infusion. Pharmaceutical compositions may be administered using a medical device. Examples of medical devices for administering pharmaceutical compositions are described in U.S. Pat. Nos. 4,475,196; 4,439,196; 4,447,224; 4,447, 233; 4,486,194; 4,487,603; 4,596,556; 4,790,824; 4,941,880; 5,064,413; 5,312,335; 5,312,335; 5,383,851; and 5,399,163.


The compositions of the present invention can be administered to the subject at a suitable dose which can be determined e.g. in dose escalating studies. As set forth above, the antibody construct used in accordance with the invention exhibiting cross-species specificity as described herein can also be advantageously used in in preclinical testing in non-chimpanzee primates. The dosage regimen will be determined by the attending physician and clinical factors. As is well known in the medical art, dosages for any one patient depend upon many factors, including the patient's size, body surface area, age, the specific compound to be administered, sex, time and route of administration, general health, and other drugs being administered concurrently.


An “effective dose” is an amount of a therapeutic agent that is sufficient to achieve or at least partially achieve a desired effect. A “therapeutically effective dose” is an amount that is sufficient to cure or at least partially arrest the disease and its complications, signs and symptoms in a patient suffering from the disease. Amounts or doses effective for this use will depend on the disease to be treated (the indication), the delivered antibody construct, the therapeutic context and objectives, the severity of the disease, prior therapy, the patient's clinical history and response to the therapeutic agent, the route of administration, the size (body weight, body surface) and/or condition (the age and general health) of the patient, and the general state of the patient's own immune system. The proper dose can be adjusted according to the judgment of the attending physician, to obtain the optimal therapeutic effect.


A therapeutically effective amount of an antibody construct used in accordance with the invention preferably results in a decrease in severity of disease symptoms, an increase in frequency or duration of disease symptom-free periods or a prevention of impairment or disability due to the disease. In the treatment of the target antigen(s)-expressing tumors, a therapeutically effective amount of the antibody construct of the invention preferably inhibits tumor cell growth by at least about 20%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90% relative to untreated patients. The ability of a compound to inhibit tumor growth may also be evaluated in an animal model predictive of efficacy in human tumors.


In a further embodiment, the invention provides a kit comprising an antibody construct used in accordance with the invention, an antibody construct produced according to the process disclosed herein, a polynucleotide disclosed herein, a vector disclosed herein, and/or a host cell disclosed herein. In the context of the present invention, the term “kit” means two or more components—one of which corresponding to the antibody construct, the pharmaceutical composition, the polynucleotide, the vector or the host cell of the invention—packaged together in a container, recipient or otherwise. A kit can hence be described as a set of products and/or utensils that are sufficient to achieve a certain goal, which can be marketed as a single unit. In a preferred embodiment of the present invention, the kit comprises an antibody construct as defined above as well as an inhibitor/antagonist of TNFa/TNFaR-signaling (for example, etanercept).


It is envisaged that a further component of the kit of the invention is an agent, preferably an antibody or antibody construct, which binds to a protein of the immune checkpoint pathway (such as PD-1 or CTLA-4) or to a co-stimulatory immune checkpoint receptor (such as 4-1BB). These agents are described in more detail herein above. According to one embodiment, the kit comprises an antibody construct as defined herein, an inhibitor/antagonist of TNFa/TNFaR-signaling (for example, etanercept), and an antibody or antibody construct which binds to PD-1. Anti-PD-1 binding proteins useful for this purpose are e.g. described in detail in PCT/US2019/013205. In certain embodiment, the kit allows for the simultaneous and/or sequential administration of the components.


The kit may comprise one or more recipients (such as vials, ampoules, containers, syringes, bottles, bags) of any appropriate shape, size and material (preferably waterproof, e.g. plastic or glass) containing the antibody construct or the pharmaceutical composition of the present invention in an appropriate dosage for administration (see above). The kit may additionally contain directions used (e.g. in the form of a leaflet or instruction manual), means for administering the antibody construct or the pharmaceutical composition of the present invention such as a syringe, pump, infuser or the like, means for reconstituting the antibody construct as defined above, the inhibitor/antagonist of TNFa/TNFaR-signaling (for example, etanercept) and/or means for diluting the antibody construct used in accordance with the invention.


The invention also provides kits for a single-dose administration unit. The kit of the invention may also contain a first recipient comprising a dried/lyophilized antibody construct or pharmaceutical composition, a second recipient comprising an inhibitor/antagonist of TNFa/TNFaR-signaling (for example, etanercept) and a third recipient comprising an aqueous formulation. In certain embodiments of this invention, kits containing single-chambered and multi-chambered pre-filled syringes are provided.


As used herein, the singular forms “a”, “an”, and “the” include plural references unless the context clearly indicates otherwise. Thus, for example, reference to “a reagent” includes one or more of such different reagents and reference to “the method” includes reference to equivalent steps and methods known to those of ordinary skill in the art that could be modified or substituted for the methods described herein.


Unless otherwise indicated, the term “at least” preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.


The term “and/or” wherever used herein includes the meaning of “and”, “or” and “all or any other combination of the elements connected by said term”.


The term “about” or “approximately” as used herein means within ±20%, preferably within ±15%, more preferably within ±10%, and most preferably within 15% of a given value or range. It also includes the concrete value, e.g., “about 50” includes the value “50”.


Throughout this specification and the claims, unless the context requires otherwise, the word “comprise”, and variations such as “comprises” and “comprising”, will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integer or step. When used herein the term “comprising” can be substituted with the term “containing” or “including” or sometimes when used herein with the term “having”.


When used herein “consisting of” excludes any element, step, or ingredient not specified in the claim element. When used herein, “consisting essentially of” does not exclude materials or steps that do not materially affect the basic and novel characteristics of the claim.


In each instance herein, any of the terms “comprising”, “consisting essentially of” and “consisting of” may be replaced with either of the other two terms.


The above description and the below examples provide exemplary arrangements, but the present invention is not limited to the specific methodologies, techniques, protocols, material, reagents, substances, etc., described herein and as such can vary. The terminology used herein serves to describe specific embodiments only. The terminology used herein does not intend to limit the scope of the present invention, which is defined solely by the claims. Aspects of the invention are provided in the independent claims. Some optional features of the invention are provided in the dependent claims.


All publications and patents cited throughout the text of this specification (including all patents, patent applications, scientific publications, manufacturer's specifications, instructions, etc.), whether supra or infra, are hereby incorporated by reference in their entirety. Nothing herein is to be construed as an admission that the invention is not entitled to antedate such disclosure by virtue of prior invention. To the extent the material incorporated by reference contradicts or is inconsistent with this specification, the specification will supersede any such material.


Sequences of binders that target BCMA, Claudin 6, Claudin 18.2, and Mucin 17 are disclosed in WO2017/134134, provisional application U.S. 63/110,817, WO2020/025792, and WO2019/133961, respectively. Some of the sequences are also shown in the Sequence listing that forms part of the present disclosure.





DESCRIPTION OF THE FIGURES


FIG. 1—Pretreatment with TNFα blockade did not affect BITE® molecule efficacy: CD3, preferably human CD3,ε knock-in mice were pretreated with either a control antibody, TNFα blockade agents (anti-TNFα antibody or a TNFRII-Fc) administered once per day for two days prior to dosing either a negative control BITE® molecule (1000 μg/kg) or a mouse CD19 BITE® molecule (100 μg/kg or 1000 μg/kg) that recognizes CD19 on B cells (n=5 animals per group). At 72 hours post-BiTE® dose, animals were euthanized, and spleens were harvested for analysis. B cells were enumerated by flow cytometry as described in Methods. The engagement of T cells in vivo using a murine CD19 targeted BiTE® molecule resulted in depletion of B cells in the spleen, and administration of TNFα blocking reagents prior to BiTE® administration did not affect the ability of the BiTE® molecule to mediate depletion of splenic B cells. Significance values: ns, p>0.05; *p≤0.05, **p≤0.01, ***p≤0.001, ****p≤0.0001 (one-way ANOVA with Tukey's test); TNFα=tumor necrosis factor alpha, BiTE®=bispecific T cell engager, anti-TNFα Ab=TNFα blocking antibody, TNFRII-Fc=tumor necrosis factor receptor II-Fc fusion protein.



FIG. 2. BiTE® molecule-induced serum IFNγ and IL-2 were not significantly reduced by TNFα blockade prior to BiTE® molecule administration: CD3, preferably human CD3,ε knock-in mice were pretreated with either a control antibody, TNFα blockade agents (anti-TNFα antibody or a TNFRII-Fc) for two days prior to dosing with either a negative control BiTE® molecule (1000 μg/kg) or a mouse CD19 BiTE® molecule (100 μg/kg and 1000 μg/kg) that recognizes CD19 on B cells (n=5 animals per group). Serum IFNγ and IL-2 were measured four hours after BiTE® treatment. Mean (A) IFNγ, (B) IL-2 levels in groups pretreated with both TNFα blocking agents were not significantly lower after administration of CD19 BiTE® at both doses compared to control antibody pretreatment groups (one-way ANOVA with Tukey's test). Significance values: ns, p>0.05; *p≤0.05, **p≤0.01, ***p≤0.001, ****p≤0.0001; IFNγ=interferon gamma, IL-2=interleukin 2, BiTE®=bispecific T cell engager, TNFα=tumor necrosis factor alpha, anti-TNFα Ab=TNFα blocking antibody, TNFRII-Fc=TNF receptor II Fe-fusion protein, ULOD=upper limit of detection.



FIG. 3. BiTE® molecule-induced Serum IL-6 was significantly reduced by TNFα blockade prior to BiTE® administration: CD3, preferably human CD3,ε knock-in mice were pretreated with either a control antibody, TNFα blockade agents (anti-TNFα antibody or a TNFRII-Fc) for two days prior to dosing with either a negative control BiTE® molecule (1000 μg/kg) or a mouse CD19 BiTE® molecule (100 μg/kg and 1000 μg/kg) that recognizes CD19 on B cells (n=5 animals per group). Serum IL-6 was measured four hours after BiTE® treatment. Mean IL-6 levels in groups pretreated with both TNFα blocking agents were significantly lower after administration of CD19 BiTE® at both doses compared to control antibody pretreatment groups (one-way ANOVA with Tukey's test). Significance values: ns, p>0.05; *p≤0.05, **p≤0.01, ***p≤0.001, ****p≤0.0001; IL-6=interleukin 6, BiTE®=bispecific T cell engager, TNFα=tumor necrosis factor alpha, anti-TNFα Ab=TNFα blocking antibody, TNFRII-Fc=TNF receptor II Fe-fusion protein, ULOD=upper limit of detection.



FIG. 4. Cytokine measurement in Example 2: Blood samples of 5 animals were collected 4 and 24 hours after each vehicle and muS110 administration, respectively and TNF, IL-6 and MCP1 serum concentrations were determined using the BD™ CBA Mouse Flex Set System (BD) in accordance to the manufactures instructions.



FIG. 5. Impact of TNF Blockage on AMG 110 Bioactivity



FIGS. 6A-C. A) and B): AMG 110-mediated redirected target cell lysis was determined after 24, 48 and 72 hours. TNF and IL-6 concentrations in the cell culture supernatant. C): AMG 103-mediated MCP-1 Secretion: MCP-1 concentrations in cell culture supernatants were quantified by the BD Cytometric CBA human MCP-1 Flex Set. Error bars in both graphs indicate the standard error of the mean of duplicate measurements.



FIG. 7. VCAM-1 Expression on HUVEC in AMG 103 Co-culture Assays: VCAM-1 expression by flow cytometry. ICAM-1 expression levels are expressed as Median Fluorescence Intensity (MFI). VCAM-1 expressing HUVEC are expressed as percentage of CD31+ HUVEC. Error bars indicate the standard error of the mean of duplicate measurements. Two PBMC donors were used in this experiment.





A better understanding of the present invention and of its advantages will be obtained from the following examples, offered for illustrative purposes only. The examples are not intended and should not be construed as to limit the scope of the present invention in any way.


Example 1

Immunocompetent C57BL/6 mice engineered to express human CD3 (huCD3 knock-in) were pretreated with either a control antibody or two different TNFα blocking agents, an anti-TNFα blocking antibody (anti-TNFα Ab) or a tumor necrosis factor receptor II-Fc fusion protein (TNFRII-Fc). These agents were administered once per day for two days prior to dosing with either an anti-mouse CD19 BiTE® molecule (100 μg/kg or 1000 μg/kg) that recognizes CD19 on B cells, or a negative control BiTE® molecule (n=5 animals per group). Serum cytokines were measured four hours after BiTE® treatment and B cell depletion was measured at 72 hours after BiTE® treatment. The engagement of T cells in vivo using the anti-mouse CD19-targeted BiTE® molecule resulted in activation of T cells, production of cytokines that could be measured in the serum, and depletion of B cells in the spleen. Administration of TNFα blocking reagents prior to BiTE® administration did not affect the ability of the BiTE® molecule to deplete B cells in the spleen (FIG. 1), nor did it impair the release of IFN-γ (FIG. 2), which is important for continued to T cell cytotoxicity, or IL-2 (FIG. 2), which is important for T cell proliferation. However, TNFα blockade did decrease the expression of IL-6 in the serum of animals post-BiTE® administration (FIG. 3). These results show that TNFα blockade can reduce circulating IL-6, which has been implicated in immunotherapy-induced CRS, without affecting BiTE®-mediated cytotoxicity.


Cytokine Measurements

Milliplex Mouse Cytokine/Chemokine kits (EMD Millipore) were used on Curiox 96w DropArray microplates per both manufacturers' protocols to test the cytokine levels in the original samples collected. Assays were performed such that contents of one EMD Millipore Milliplex kit was used in smaller amounts on 4 Curiox microplates. The lots of the Curiox plates and all items included in the Millipore kits were as shown in Table 1 below.














Description
Cat#
Kit lot#







Pre-mixed blend of analytes
MCYPMX32
3136598


Standard
MXM8070-2
SC7N807-8K


QC1
MXM6070-2
MCY-108


QC2
MXM6070-2
MCY-208


Serum Matrix
MXMSM
3075213


Detection Antibodies
MXM1070-3
3207309


Streptavidin-Phycoerythrin
L-SAPE10
3216830


Assay Buffer
L-AB
3231126


Curiox 96w drop Array
#96-CC-BD-
C96C2219135-B


plates
05


Curiox Wash Buffer

1x PBS, 0.1% BSA, 0.05%




Tween20




(PBS 14190-136, lot




17765965)









Preparation of Curiox Items





    • All samples were run on four Curiox microplates.

    • Two Curiox Humid Boxes were prepared with 8 paper towels and 100 mL PBS.

    • Lid sponges on each of two Curiox plates were wetted with 12 mL PBS.

    • Plates were blocked with 20 μL/well 1% BSA/PBS

    • Plates were left inside humid box on a Titramax 1000 Shaker (Heidolph Instruments) at ˜400 rpm for 30 minutes





Preparation of Milliplex Reagents
Beads:

A premix of beads was used in this assay. Analytes IFNγ, IL-2, IL-6 and TNFα were read by the software and subsequently analyzed.


Quality Controls:

One vial of each Quality Control 1 and 2 was reconstituted with 250 μL ddH2O per vial, vortexed lightly (5 seconds), and allowed to sit at room temp for at least 10 minutes before being used.


Wash Buffer:

Curiox Wash Buffer (1×PBS, 0.1% BSA, 0.05% Tween20) was created by mixing. Each liter contains:

    • 900 mL 1×PBS
    • 100 mL 1% BSA in PBS
    • 500 μL 10% Tween20 in PBS


Serum Matrix:

One vial of lyophilized serum matrix was freshly reconstituted with 2 mL Assay Buffer, left to sit at room temp for 10 minutes and then used according to protocol 5 μL per well in standards, quality control, and blank wells.


Serum Dilutions:

Each serum sample was assessed in duplicate and neat only with no dilutions.


Standard Reconstitution and Dilution:

One vial of cytokine standard was freshly reconstituted with 250 μL, ddH2O, vortexed lightly (5 seconds), and allowed to sit at room temperature for at least 10 minutes before being diluted and readied for the assay. Standard dilutions were then made at 1:2 such that 100 μL of higher concentrated standard was serially diluted into 100 μL assay buffer to create 13 total dilutions; highest concentration being 10,000 μg/mL, and lowest concentration at 2.4 μg/mL, for all analytes.


Immunoassay Procedure

The Curiox plates (currently in Block) were each washed 1×using the Curiox DropArray plate washer. Using reverse pipetting (for more accurate dispensing of pipet contents), the following were added to the plates using the plate layouts captured in ELN 20191022-00064. 5 μL bead mix was added per well to all wells. 5 μL Serum Matrix was added to Standards and Quality Control wells. 5 μL Assay Buffer was added to the sample wells. 5 μL Standards and QC controls were added to the appropriate wells. 5 μL sample was added to the appropriate wells. The plates were each mixed 10 seconds using a Vortex Genie plate mixer at 1000 rpm and then left to incubate in the Humid Boxes on a Titramax Shaker, with the magnet array, at ˜400 rpm overnight at 4° C. The following day, plates were washed 3×using the Curiox DropArray plate washer. 5 μL of biotinylated Detection Antibody was added to each well, plates were mixed 10 seconds using a Vortex Genie plate mixer at 1000 rpm, and then were left to incubate in the Humid Boxes, without magnet array, on a Titramax Shaker at ˜400 rpm for 1 hour at room temperature. 5 4 of Streptavidin-PE-labeled detection antibody was added to each well, plates were mixed 10 seconds using a Vortex Genie plate mixer at 1000 rpm and then were left to incubate in the Humid Boxes, without the magnet array, at ˜400 rpm shaking for 30 minutes at room temperature. The plates were again washed 3×using the Curiox DropArray plate washer. 20 μL of sheath fluid was added to each of the wells, plates were mixed 10 seconds using a Vortex Genie plate mixer at 1000 rpm and then were left to incubate in the Humid Boxes, without the magnet array, on a Titramax Shaker at ˜400 rpm for at least 5 minutes at room temperature. Individual well contents from each of the Curiox microplates were then mixed by pipetting up and down at least 10 times and transferred to the wells in a quadrant of a 384-well plate. After all Curiox plates' contents were transferred, 50 μL/well sheath fluid was added to each 384-well plate (now 70 μL/well), and the 384-well plates were mixed 30 seconds using a Vortex Genie plate mixer at 1000 rpm. The 384-well plate was read on a Luminex FlexMap 3D eader using xPONENT software.


Spleen Flow Cytometry Analysis

At the end of the study, animals were euthanized by carbon dioxide asphyxiation followed by physical cervical dislocation. Spleens were removed and collected in RPMI into individual wells of a 24-well plate. Spleens were pulverized through a 100 μm filter, rinsed with PBS, and 100 μL counting beads (Invitrogen, cat: 01-2222-42, lot:2037700, Carlsbad, Calif.) were added. The disaggregated spleens were then centrifuged at 500 rpm for 5 minutes at 4° C. After decanting the supernatant, the cell pellet was lysed with 1 mL RBC lysis buffer (Unity Lab Services, Amgen, South San Francisco) and quenched with FACS buffer containing FBS (2%). Cells were centrifuged a second time at 500 rpm for 5 minutes at 4° C. After decanting the supernatant, the cell pellet was resuspended in 1 mL FBS-free media. 200 μL of cell suspension was transferred to a 96-well V-bottom plate, live/dead dye exclusion (Invitrogen, Eugene, Oreg.) was added (at a 1:500 dilution) and the cells were incubated for 45 minutes at room temperature in the dark. Cells were washed, centrifuged as previously, and resuspended in 50 μL of Fc block (BD Biosciences, San Jose, Calif.) prior to staining with the following antibodies: BUV395 anti-mouse CD4 clone GK1.5, BV650 anti-mouse CD44 clone IM7, BV421 anti-mouse CD8a clone 53-6.7, PE anti-mouse CD25 clone PC61, BV711 anti-mouse CD62L clone MEL-14 (all from BD Biosciences, San Jose, Calif.), BV510 anti-mouse CD45 clone 30-F11, BV605 anti-mouse Thy1.2 clone 53-2.1, FITC anti-mouse CD19 clone 1D3/CD19, APC anti-mouse CD20 clone SA275A11, AF700 anti-mouse CD69 clone H1.2F3 (all from Biolegend, San Diego, Calif.) and Pe-Cy7 anti-mouse PD1 clone J43 (Thermo Fisher, San Diego, Calif.). Cells were washed and resuspended prior to analysis on a FACSymphony flow cytometer (BD Biosciences, San Jose, Calif.).


Statistical Analysis

Graphs were generated, and data analysis was performed using GraphPad Prism software (version 7.04, Lo Jolla, Calif.). Mean serum cytokine levels and B cell counts (n=5 animals per group) were expressed as the mean±standard deviation. The p value of 0.05 was used to determine significant differences between all groups using a one-way ANOVA with Tukey's test (GraphPad Prism).


Example 2

Female BALB/cJ Rj mice (n=10/group) were treated with either vehicle or the BiTE® antibody construct muS110, directed against murine Epithelial Cell Adhesion Molecule for 2 days (Table 2). Animals in group 3 were pre-treated with etanercept (Enbrel) on days −2 and −1 as well as 1 hour before each muS110 administration. Animals in group 4 were administered an anti-IL6 monoclonal antibody (MP5-20F3, BD) on day −1 and one hour before each muS110 treatment. Blood samples were collected 4 and 24 hours after each vehicle and muS110 administration and serum concentrations of IL-6, TNF and MCP1 were determined using the BD™ CBA Mouse Enhanced Sensitivity Flex Set System (Becton Dickinson, BD) in accordance to the manufacturer's instructions (Table 2).









TABLE 2







Study Design














Route of






Administra-
Treatment


Group
Compound
Dosages
tion
Schedule*





1
Vehicle

i.v.
Days: 1, 2


2
muS110
0.05 g/kg/d
i.v.
Days: 1, 2


3
Enbrel +
Enbrel*: 10
Enbrel:
Enbrel:



muS110
mg/kg/d
i.p.
days −2, −1,




muS110: 0.05
muS110:
1, 2




mg/kg/d
i.v.
muS110: days 1,






2


4
Anti-IL6 +
Anti-IL6: 2.5
mAb: i.v.
Anti-IL6:



muS110
mg/kg/d
muS110:
days −1, 1




muS110: 0.05
i.v.
muS110: days 1,




mg/kg/d

2





Etanercept (Enbrel*) and the anti-IL6 monoclonal antibody were administered 1 hour before muS110 treatment on days 1 and 2.






In Vitro Anti-TNF Assay

Cytotoxicity, T-cell activation (CD69 upregulation) and cytokine release were determined in multiparametric cytotoxicity assays. Redirected T cell cytotoxicity was evaluated by flow cytometry using isolated human CD3+ T cells as effector cells and Epithelial Cell Adhesion Molecule (EpCAM)-expressing KatoIII tumor cells as target cells. Effector and target cells were co-cultured at an E:T cell ratio of 10:1 and serial dilutions of BiTE® antibody construct AMG110, directed against murine Epithelial Cell Adhesion Molecule in the absence or presence of an anti-TNF monoclonal antibody (BD) or the respective isotype control. AMG 110-mediated redirected target cell lysis was determined after 24, 48 and 72 hours (as shown in FIGS. 6A and 6B). TNF and IL-6 concentrations in the cell culture supernatant were measured with the CBA human TH1/TH2 Kit in accordance to the manufacturer's instruction.


BiTE® Molecule Induced MCP-1 Release Blocked by Etanercept (Enbrel)

Human umbilical vein endothelial cells (HUVEC) were co-cultured with CD19-expressing NALM-6 cells and human PBMC and increasing concentrations of BiTE® antibody construct blinatumumab (AMG 103) against CD19 in the absence or presence of etanercept. MCP-1 concentrations were determined with the BD Cytometric CBA human MCP-1 Flex set system (BD, Germany after 2 and hours, respectively according to the manufacturer's instructions and are shown in FIG. 6C.


Blinatumumab VCAM Assay

The effect of blinatumumab (AMG 103) on T cell activation and the induction of VCAM-1 on endothelial cells was analyzed in co-cultures of HUVEC, isolated T cells and CD19-expressing NALM-6 target cells. VCAM-1 expression on CD31+ HUVEC was analyzed by flow cytometry. The T cell activation marker VCAM-1 was up-regulated by AMG 103, which was sensitive to etanercept, indicating the potential role of TNF in BiTE® molecule-mediated endothelial activation (FIG. 7).


Example 3

Results with the antibody construct blinatumomab (CD19×CD3) demonstrate that TNF levels increased rapidly after the blinatumomab in cycle 1, reaching maximum levels within 2 hours, and reach peak levels earlier than other cytokines. CRS symptoms seem to be mediated by cytokines including interleukin-6 (IL-6) and TNF, tocilizumab and etanercept are evaluated, which block IL-6 and TNF, respectively, as separate premedications for CRS prophylaxis in subjects with RJR AML. Blocking TNF with etanercept premedication may prevent CRS or decrease the frequency and severity of CRS symptoms.


In a clinical study that is performed as described in study NCT02520427 (clinicaltrials.gov) in patients that have relapsed/refractory Acute Myeloid Leukemia, a recombinant monoclonal bispecific T-cell engager (BITE®) antibody construct directed against CD33 on target cells that simultaneously binds to CD3 on T cells (CD33×CD3-BiTE) was investigated. Previously, dexamethasone premedication was used for prophylaxis of CRS 1 hour before CD33×CD3-BiTE molecule administration. However, dexamethasone is a known immunosuppressant that may have an influence on the efficacy of said antibody construct.


Because increased serum IL-6 levels may contribute to the development of CRS symptoms, blocking interactions of IL-6 with its receptor (IL-6R) using tocilizumab as a premedication to prevent CRS or decrease the frequency and severity of CRS symptoms. IL-6 levels increase within first 6 hours following CD33×CD3-BiTE administration. Thus, tocilizumab was given to subjects 1 hour prior to CD33×CD3-BiTE administration to allow a blockade of the pro-inflammatory effects mediated by IL-6 upon the increase of its levels. Tocilizumab as a premedication for CRS prophylaxis was evaluated at the dose approved for treatment of CRS (8 mg/kg administered intravenously).


Further, pretreatment with etanercept to block the biological effects of TNF, which is released by T cells in response to CD33×CD3-BiTE treatment, was evaluated. Etanercept was administered subcutaneously (SC) at the approved dose of 50 mg on days −1 and 4 relative to the first dose of CD33×CD3-BiTE. This dose and timing were selected based on the PK properties of etanercept (slow absorption with mean±SD time of maximum concentration [tmax] of 69±34 hours; half-life of 102±30 hours) (Enbrel US Prescribing Information; Zhou et al, 2011), and on the direct relationship between the PK and PD of etanercept. Specifically, within 24 hours of etanercept administration, there is a significant increase in the inactive form of TNF (Madhusudan et al, 2005) and a decrease in IL-6 concentrations (Sato et al, 2011). The etanercept concentrations achieved from a 50-mg dose were expected to be within the dose target range (ie, 0.5 to 2 μg/mL as established for patients with rheumatoid arthritis; Breedveld et al, 2018) before the first dose of CD33×CD3-BiTE was administered on day 1 and remained above the lower target range up to day 14. Comparable peak TNF concentrations after administration of the BiTE antibody constructs blinatumomab and a half-life extended CD33×CD3-BiTE-binding T-cell engaging antibody construct have been observed in patients with cancer (30 to 60 μg/mL) and rheumatoid arthritis (mean peak levels of 32.9 and 31.6 μg/mL) (Nagele et al, 2017; Ebrahimi et al, 2009; Manicourt et al, 1993). Accordingly, an etanercept target range of 0.5 to 2 μg/mL was expected to provide adequate TNF inhibition and mitigate the CRS risk associated with administration of the first dose of CD33×CD3-BiTE.


Prior to administration of CD33×CD3-BiTE at increasing doses, subjects with R/R AML received tocilizumab (group 1) or etanercept (group 2) instead of dexamethasone. Tocilizumab (8 mg/kg IV) was administered on the first day of each cycle 1 hour before the first dose of AMG 330; etanercept (50 mg SC) was administered on study days −1 and 4.


Each premedication treatment group comprised a total of 6 evaluable subjects. Within each group, 3 subjects were initially enrolled and administered tocilizumab (8 mg/kg) or etanercept (50 mg) premedication as described above followed by treatment with CD33×CD3-BiTE. For these initial 3 subjects in each group, once no more than 1 dose-limiting toxicity (DLT) was observed within the DLT window, then the study was expanded to enroll 6 subjects for that group. If 2 subjects had a DLT in either group, then, upon resolution of the adverse event, these subjects proceeded with a combination of tocilizumab plus dexamethasone (group 1) or etanercept plus dexamethasone (group 2). The remaining subjects for the group for treatment were treated with the combination regimen (ie, tocilizumab plus dexamethasone [group 1] or etanercept plus dexamethasone [group 2]) for CRS prophylaxis. If no more than 1 DLT was observed in the 6 evaluable subjects in either group, then the premedication used in that group was considered safe and tolerable, substudy 2, in which either tocilizumab or etanercept were evaluated as single agent for CRS prophylaxis was initiated.


Subjects who received tocilizumab or etanercept prior to administration of AMG 330 were monitored for CRS using the guidance currently described in Protocol 20120252. Briefly, subjects were monitored for clinical signs (e.g., fever, hypotension, tachycardia, dyspnea, tremors) and laboratory changes (eg, transaminase increase) which may be related to CRS. If a subject treated with CD33×CD3-BiTE at the 10-μg step dose level developed grade 2 or higher CRS, the subject continued the study using both tocilizumab and dexamethasone or etanercept and dexamethasone as premedication for CRS prophylaxis to assess whether a combination regimen is more effective than monotherapy for CRS prophylaxis. When a subject treated with CD33×CD3-BiTE at the target dose level developed grade 3 or higher CRS, CD33×CD3-BiTE was stopped until the severity of CRS decreases to grade 1, at which point the subject was able to restart the study using both tocilizumab and dexamethasone or etanercept and dexamethasone as premedication for CRS prophylaxis.


For those patients from study part 1 in which it was shown that CRS incidence/severity with tocilizumab or etanercept is similar to that observed with dexamethasone premedication (ie, 1 DLT and some reported grade 2 CRS events in the etanercept or tocilizumab group), a mini-step approach was tested to improve CRS onset dynamics. With this approach, subjects were treated with tocilizumab or etanercept premedication followed by CD33×CD3-BiTE administered with daily mini-step doses, followed by the target dose.


For those patients from study part 1 in which it was shown that CRS incidence/severity with tocilizumab or etanercept was lower than that with dexamethasone premedication (ie, no DLTs and no reported grade 2 CRS events in the etanercept or tocilizumab group), a maxi-step approach was tested to reach the efficacious dose faster. With this approach, subjects were treated with tocilizumab or etanercept premedication followed by administration of CD33×CD3-BiTE at increasing doses.


For those patients from study part 1 in which combination regimen (ie, tocilizumab and dexamethasone or etanercept and dexamethasone as premedication for CRS prophylaxis) was needed, a similar approach has been used to determine whether the mini-step or maxi-step approach should be tested in part 2 for the combination regimen.


Example 4

In this example, it is further evaluated, if pretreatment with etanercept will block the biological effects of TNF, which is released by T cells in response to treatment with an antibody construct binding FLT3 and CD3 (Flt3×CD3-BiTE). TNF levels after Flt3×CD3-BiTE infusion are consistent with that of blinatumomab, with TNF-α and IL-6 peak levels seen at 6 hour collection time points after Flt3×CD3-BiTE dosing. Collectively, these data demonstrate consistent and reproducible cytokine release after BiTE therapy infusion.


Etanercept at 50 mg dose was given on day minus 2 relative to the first dose of Flt3×CD3-BiTE. This dose and timing were selected based on the PK/PD properties of etanercept, which showed slow absorption (mean±SD time of maximum concentration [tmax] of 69±34 hours) (Enbrel US Prescribing Information; Zhou et al, 2011), and is expected to provide maximal TNF inhibition by the time of Flt3×CD3-BiTE dosing.


As mentioned above in Example 3, approximately similar peak TNF concentrations after administration of the BiTE antibody constructs Flt3×CD3-BiTE, blinatumomab, and others have been observed in patients with cancer (30 to 60 μg/mL) and rheumatoid arthritis (mean peak levels of 32.9 and 31.6 μg/mL) (Nagele et al, 2017; Ebrahimi et al, 2009; Manicourt et al, 1993). These results suggest that an etanercept target range of 0.5 to 2 μg/mL provides adequate TNF inhibition and mitigate the CRS risk associated with administration of the first dose of Flt3×CD3-BiTE.


During dose escalation, a separate parallel substudy evaluated the effect of etanercept with dexamethasone and etanercept alone for CRS prophylaxis. This substudy will run in parallel to the primary dose escalation, which currently requires administration of a prophylactic steroid dose (8 mg IV dexamethasone) within 1 hour prior to start of Flt3×CD3-BiTE infusion, and prior to each dose step of Flt3×CD3-BiTE, to mitigate CRS.


This substudy tested as to whether the inhibition of TNF lead to decreased rates and/or grades of CRS symptoms by blocking this early and necessary cytokine. The results of this substudy assess better CRS risk mitigation strategies for subjects and obviate the need for prophylactic dexamethasone.


Six subjects received an initial dose of Flt3×CD3-BiTE and etanercept/dexamethasone prophylaxis and were monitored for decreased or similar rates or grades of CRS (overall CRS rate <60%, or grade ≥2 CRS in <40% of subjects) compared to subjects who received only dexamethasone premedication. Subsequently, higher dose levels of Flt3×CD3-BiTE that had been cleared as safe and tolerable, were tested in an additional 3-6 subjects. These additional 3-6 subject who received Flt3×CD3-BiTE were monitored for the occurrence of decreased or similar rates or grades of CRS (overall CRS rate <75%, or grade ≥2 CRS in <75% of subjects), before etanercept as CRS prophylaxis was tested in an additional 3-6 subjects at the same dose of Flt3×CD3-BiTE.


Further, 6 subjects who received an initial dose of the Flt3×CD3-BiTE and etanercept/dexamethasone prophylaxis were monitored for the occurrence of decreased or similar rates or grades of CRS (overall CRS rate <60%, or grade ≥2 CRS in <40% of subjects) compared to subjects who received only dexamethasone premedication, and subsequently testing of only etanercept as CRS prophylaxis in an additional 3-6 subjects at the same dose cohort level of Flt3×CD3-BiTE was performed.


During dose escalation, a separate parallel substudy evaluated subjects to test the effect of etanercept with dexamethasone and etanercept alone for CRS prophylaxis. This substudy was run in parallel to the primary dose escalation, which required administration of a prophylactic steroid dose (8 mg IV dexamethasone) within 1 hour prior to start of Flt3×CD3-BiTE infusion prior to each dose step of Flt3×CD3-BiTE, to mitigate CRS. This substudy tested the hypothesis that inhibition of TNF leads to decreased rates and/or grades of CRS symptoms by blocking this early and necessary cytokine.


Example 5

Etanercept Prophylaxis for PSMA-targeting BiTE related CRS in humans: Etanercept premedication occurred within two days before BiTE administration to assess whether prophylaxis with the TNF-α inhibitor decreases the frequency and severity of CRS without compromising the efficacy of the BiTE. In an initial cohort of 6 to 8 subjects, the PSMA-targeting BiTE is administered. In addition to dexamethasone prophylaxis, subjects in the cohort received prophylaxis with etanercept (50 mg subcutaneously [SC]) two days prior to each dose of PSMA-targeting BiTE in the first administration cycle. This dose and timing was selected based on the PK properties of etanercept (slow absorption with mean SD time of maximum concentration [tmax] of 69±34 hours; half-life of 102 f 30 hours) (Enbrel Package Insert, 2017; Zhou et al, 2011).


Subject incidence of safety events, including dose-limiting toxicities (DLTs), serious adverse events (SAEs), and adverse events leading to treatment discontinuation or dose reduction, will be reviewed when at least 3 DLT-evaluable subjects complete the DLT window. Subjects receiving three individual increasing doses of PSMA-targeting BiTE with etancercept prophylaxis experienced 1 DLT/SAE (grade 3 (G3) thrombocytopenia), 1 SAE (Grade 3 (G3) Afib), 0 dose reductions, 1 discontinuation (tolerability), CRS events in cycle 1: 4 grade 2 (G2), no grade 3/4 (G3/4). Etanercept prophylaxis improves CRS safety profile compared with no premedication or premedication with tocilizumab (8 mg/kg) given two hours before administration of the first dose of the PSMA-targeting BiTE. In the latter group 1 DLT/SAE (G3 Hypoacusis), 2 SAE (grade 3 (G3) Pruritus, grade 2/3 (G2/G3) CRS), 2 dose reductions, 2 discontinuations (disease progression), and CRS events in cycle 1: 4 grade 1 (G1), 7 grade 2 (G2), 4 grade 3 (G3) were observed. In the etanercept prophylaxis group the PSMA-targeting BiTE was administered at the same dosages and frequency as in the group without etanercept prophylaxis.


Example 6

Adult patients with R/R AML received one cycle of continuous IV infusions of CD33×CD3 BiTE® molecules at increasing doses (10 μg, 60 μg and 240 μg on days 1, 3 and 6) preceded by administration of either 50 mg etanercept subcutaneously (about 24 hours prior to the initial administration of the 10 μg BiTE-treatment) or 8 mg dexamethasone IV (about 30 minutes prior to the initial administration of the 10 μg BiTE-treatment).


Etanercept-mediated CRS prevention is at least comparable to or even slightly better than CRS prevention with dexamethasone. Surprisingly, the duration of CRS in patients treated with etanercept for CRS prophylaxis as compared to dexamethasone is considerably shorter as shown in Table 3.















(a) Frequency and (b) dura-
(a) Frequency and (b) dura-


Number of
tion (hrs) of CRS events in
tion (hrs) of CRS events in


patients
etanercept-treated group
dexamethasone-treated group







4
(a) 7 CRS events (1.75 per




patient)



(b) average duration: 12 hrs


6

(a) 14 CRS events (2.3 per




patient)




(b) average duration: 58 hrs






















SEQ





ID

Format/



NO
Designation
Source
Amino acid sequence


















1
CD3ϵ ECD
human
QDGNEENGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDED





DKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCEN





CNEND





2
CD3ϵ ECD pos. 1-27
human
QDGNEENGGITQTPYKVSISGTTVILT





3
CDR-L1 of H2C
artificial
GSSTGAVTSGYYPN





4
CDR-L2 of H2C
artificial
GTKFLAP





5
CDR-L3 of H2C
artificial
ALWYSNRWV





6
CDR-L1 of E2M
artificial
RSSTGAVTSGYYPN





7
CDR-L2 of E2M
artificial
ATDNRPS





8
CDR-L3 of E2M
artificial
ALWYSNRWV





9
CDR-L1 of F12Q
artificial
GSSTGAVTSGNYPN





10
CDR-L2 of F12Q
artificial
GTKFLAP





11
CDR-L3 of F12Q
artificial
VLWYSNRWV





12
CDR-H1 of F6A
artificial
IYAMN





13
CDR-H2 of F6A
artificial
RIRSKYNNYATYYADSVKS





14
CDR-H3 of F6A
artificial
HGNFGNSYVSFFAY





15
CDR-H1 of H2C
artificial
KYAMN





16
CDR-H2 of H2C
artificial
RIRSKYNNYATYYADSVKD





17
CDR-H3 of H2C
artificial
HGNFGNSYISYWAY





18
CDR-H1 of H1E
artificial
SYAMN





19
CDR-H2 of H1E
artificial
RIRSKYNNYATYYADSVKG





20
CDR-H3 of H1E
artificial
HGNFGNSYLSFWAY





21
CDR-H1 of G4H
artificial
RYANN





22
CDR-H2 of G4H
artificial
RIRSKYNNYATYYADSVKG





23
CDR-H3 of G4H
artificial
HGNFGNSYLSYFAY





24
CDR-H1 of A2J
artificial
VYANN





25
CDR-H2 of A2J
artificial
RIRSKYNNYATYYADSVKK





26
CDR-H3 of A2J
artificial
HGNFGNSYLSWWAY





27
CDR-H1 of E1L
artificial
KYAMN





28
CDR-H2 of E1L
artificial
RIRSKYNNYATYYADSVKS





29
CDR-H3 of E1L
artificial
HGNFGNSYTSYYAY





30
CDR-H1 of E2M
artificial
GYANN





31
CDR-H2 of E2M
artificial
RIRSKYNNYATYYADSVKE





32
CDR-H3 of E2M
artificial
HRNFGNSYLSWFAY





33
CDR-H1 of F7O
artificial
VYAMN





34
CDR-H2 of F7O
artificial
RIRSKYNNYATYYADSVKK





35
CDR-H3 of F7O
artificial
HGNFGNSYISWWAY





36
CDR-H1 of F12Q
artificial
SYAMN





37
CDR-H2 of F12Q
artificial
RIRSKYNNYATYYADSVKG





38
CDR-H3 of F12Q
artificial
HGNFGNSYVSWWAY





39
CDR-H1 of I2C
artificial
KYAMN





40
CDR-H2 of I2C
artificial
RIRSKYNNYATYYADSVKD





41
CDR-H3 of I2C
artificial
HGNFGNSYISYWAY





42
CDR-L2 of H2C
artificial
GTKFLAP





43
CDR-L3 of H2C
artificial
ALWYSNRWV





44
CDR-H1 of H2C
artificial
KYAMN





45
CDR-L1 of H1E
artificial
GSSTGAVTSGYYPN





46
CDR-L2 of H1E
artificial
GTKFLAP





47
CDR-L3 of H1E
artificial
ALWYSNRWV





48
CDR-H1 of H1E
artificial
SYAMN





49
CDR-H2 of H1E
artificial
RIRSKYNNYATYYADSVKG





50
CDR-H3 of H1E
artificial
HGNFGNSYLSFWAY





51
CDR-L1 of G4H
artificial
GSSTGAVTSGYYPN





52
CDR-L2 of G4H
artificial
GTKFLAP





53
CDR-L3 of G4H
artificial
ALWYSNRWV





54
CDR-L1 of A2J
artificial
RSSTGAVTSGYYPN





55
CDR-L2 of A2J
artificial
ATDMRPS





56
CDR-L3 of A2J
artificial
ALWYSNRWV





57
CDR-L1 of E1L
artificial
GSSTGAVTSGYYPN





58
CDR-L2 of E1L
artificial
GTKFLAP





59
CDR-L3 of E1L
artificial
ALWYSNRWV





60
CDR-L1 of F7O
artificial
GSSTGAVTSGYYPN





61
CDR-L2 of F7O
artificial
GTKFLAP





62
CDR-L3 of F7O
artificial
ALWYSNRWV





63
CDR-L1 of I2C
artificial
GSSTGAVTSGNYPN





64
CDR-L2 of I2C
artificial
GTKFLAP





65
CDR-L3 of I2C
artificial
VLWYSNRWV





66
VL of H2C
artificial
QTVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLI





GGTKFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVF





GGGTKLTVL





67
VL of E2M
artificial
QTVVTQEPSLTVSPGGTVTLTCRSSTGAVTSGYYPNWVQQKPGQAPRGLI





GATDMRPSGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVF





GGGTKLTVL





68
VL of F12Q
artificial
QTVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLI





GGTKFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVF





GGGTKLTVL





69
VL variant of H2C
artificial
ELVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLI





GGTKFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVF





GGGTKLTVL





70
VL variant of A2J
artificial
ELVVTQEPSLTVSPGGTVTLTCRSSTGAVTSGYYPNWVQQKPGQAPRGLI





GATDMRPSGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVF





GGGTKLTVL





71
VL variant of F12Q
artificial
ELVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLI





GGTKFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVF





GGGTKLTVL





72
VH of F6A
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNIYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKSRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYVSFFAYWGQGTLVTVSS





73
VH of H2C
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYISYWAYWGQGTLVTVSS





74
VH of H1E
artificial
EVQLVESGGGLEQPGGSLKLSCAASGFTFNSYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYLSFWAYWGQGTLVTVSS





75
VH of G4H
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNRYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYLSYFAYWGQGTLVTVSS





76
VH of A2J
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNVYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKKRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYLSWWAYWGQGTLVTVSS





77
VH of E1L
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKSRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYTSYYAYWGQGTLVTVSS





78
VH of E2M
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNGYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKERFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HRNFGNSYLSWFAYWGQGTLVTVSS





79
VH of F7O
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNVYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKKRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYISWWAYWGQGTLVTVSS





80
VH of F12Q
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNSYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYVSWWAYWGQGTLVTVSS





81
VH of I2C
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYISYWAYWGQGTLVTVSS





82
VH of F12q
artificial
EVQLVESGGGLVQPGGSLRLSCAASGFTFNSYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCVR





HGNFGNSYVSWWAYWGQGTLVTVSS





83
VH variant of F6A
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNIYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKSRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYVSFFAYWGQGTLVTVSS





84
VH variant of H2C
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYISYWAYWGQGTLVTVSS





85
VH variant of H1E
artificial
EVQLLESGGGLEQPGGSLKLSCAASGFTFNSYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYLSFWAYWGQGTLVTVSS





86
VH variant of G4H
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNRYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYLSYFAYWGQGTLVTVSS





87
VH variant of A2J
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNVYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKKRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYLSWWAYWGQGTLVTVSS





88
VH variant of E1L
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKSRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYTSYYAYWGQGTLVTVSS





89
VH variant of E2M
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNGYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKERFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HRNFGNSYLSWFAYWGQGTLVTVSS





90
VH variant of F7O
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNVYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKKRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYISWWAYWGQGTLVTVSS





91
VH variant of F12Q
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNSYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYVSWWAYWGQGTLVTVSS





92
VH variant of I2C
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYISYWAYWGQGTLVTVSS





93
VL of F6A
artificial
QTVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLI





GGTKFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVF





GGGTKLTVL





94
VL of H1E
artificial
QTVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLI





GGTKFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVF





GGGTKLTVL





95
VL of G4H
artificial
QTVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLI





GGTKFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVF





GGGTKLTVL





96
VL of A2J
artificial
QTVVTQEPSLTVSPGGTVTLTCRSSTGAVTSGYYPNWVQQKPGQAPRGLI





GATDMRPSGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVF





GGGTKLTVL





97
VL of E1L
artificial
QTVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLI





GGTKFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVF





GGGTKLTVL





98
VL of F7O
artificial
QTVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLI





GGTKFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVF





GGGTKLTVL





99
VL of I2C
artificial
QTVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLI





GGTKFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVF





GGGTKLTVL





100
VL of F12q
artificial
QTVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLI





GGTKFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVF





GGGTKLTVL





101
scFv of F6A
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNIYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKSRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYVSFFAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





102
scFv of H2C
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





103
scFv of H1E
artificial
EVQLVESGGGLEQPGGSLKLSCAASGFTFNSYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYLSFWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





104
scFv of G4H
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNRYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYLSYFAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





105
scFv of A2J
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNVYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKKRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYLSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSL





TVSPGGTVTLTCRSSTGAVTSGYYPNWVQQKPGQAPRGLIGATDMRPSGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





106
scFv of E1L
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKSRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYTSYYAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





107
SCEV of E2M
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNGYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKERFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HRNFGNSYLSWFAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSL





TVSPGGTVTLTCRSSTGAVTSGYYPNWVQQKPGQAPRGLIGATDMRPSGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





108
SCEV of F7O
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNVYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKKRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYISWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





109
SCEv of F12Q
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNSYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYVSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





110
scFv of I2C
artificial
EVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





111
scFv of F12q
artificial
EVQLVESGGGLVQPGGSLRLSCAASGFTFNSYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCVR





HGNFGNSYVSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





112
scFv variant of F6A
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNIYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKSRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYVSFFAYWGQGTLVTVSSGGGGSGGGGSGGGGSELVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





113
scFv variant of H2C
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSELVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





114
SCEV variant of H1E
artificial
EVQLLESGGGLEQPGGSLKLSCAASGFTFNSYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYLSFWAYWGQGTLVTVSSGGGGSGGGGSGGGGSELVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





115
SCEV variant of G4H
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNRYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYLSYFAYWGQGTLVTVSSGGGGSGGGGSGGGGSELVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





116
SCEV variant of A2J
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNVYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKKRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYLSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSELVVTQEPSL





TVSPGGTVTLTCRSSTGAVTSGYYPNWVQQKPGQAPRGLIGATDMRPSGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





117
scFv variant of E1L
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKSRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYTSYYAYWGQGTLVTVSSGGGGSGGGGSGGGGSELVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





118
scFv variant of E2M
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNGYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKERFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HRNFGNSYLSWFAYWGQGTLVTVSSGGGGSGGGGSGGGGSELVVTQEPSL





TVSPGGTVTLTCRSSTGAVTSGYYPNWVQQKPGQAPRGLIGATDMRPSGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





119
scFv variant of F7O
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNVYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKKRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYISWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSELVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVFGGGTKLTVL





120
scFv variant of
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNSYAMNWVRQAPGKGLEWVAR



F12Q

IRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYVSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSELVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





121
SCEV variant of I2C
artificial
EVQLLESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVAR





IRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR





HGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSELVVTQEPSL





TVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGT





PARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





122
20A2 VH CDR1
artificial
NYGMH





123
20A2 VH CDR2
artificial
LIWYDGSKKYYADSVKG





124
20A2 VH CDR3
artificial
DPSSLTGSTGYYGMDV





125
20A2 VL CDR1
artificial
SGDKLGDKYAC





126
20A2 VL CDR2
artificial
QDRKRPS





127
20A2 VL CDR3
artificial
QAWDSSTEV





128
20A2 light chain
artificial
MAWALLLLTLLTQGTGSWASYELTQPPSVSVSPGQTASITCSGDKLGDKY





ACWYQQKPGQSPVLVIYQDRKRPSGIPERFSGSNSGNTATLTISGTQAMD





EADYYCQAWDSSTEVFGGGT





KLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKAD





SSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGST





VEKTVAPTECS





129
20C1 VH CDR1
artificial
SYDMS





130
20C1 VH CDR2
artificial
LISGGGSNTYYADSVKG





131
20C1 VH CDR3
artificial
PSGHYFYAMDV





132
20C1 VL CDR1
artificial
RASQGISNWLA





133
20C1 VL CDR2
artificial
AASSLQS





134
22D4 VH CDR1
artificial
DYSMS





135
22D4 VH CDR2
artificial
GINWNGGRTRYADSVKG





136
22D4 VH CDR3
artificial
EFNNFESNWEDP





137
22D4 VL CDR1
artificial
SGDALPKKYAY





138
22D4 VL CDR2
artificial
EDSKRPS





139
22D4 VL CDR3
artificial
YSTDSSGNHRV





140
20C1.006 VH CDR1
artificial
SYDMS





141
20C1.006 VH CDR2
artificial
LISGGGSNTYYAESVKG





142
20C1.006 VH CDR3
artificial
PSGHYFYAMDV





143
20C1.006 VL CDR1
artificial
RASQGISNWLA





144
20C1.006 VL CDR2
artificial
AASSLQS





145
20C1.006 VL CDR3
artificial
QQAESFPHT





146
20C1.009 VH CDR1
artificial
SYDMS





147
20C1.009 VH CDR2
artificial
LISGGGSQTYYAESVKG





148
20C1.009 VH CDR3
artificial
PSGHYFYAMDV





149
20C1.009 VL CDR1
artificial
RASQGISNWLA





150
20C1.009 VL CDR2
artificial
AASSLQS





151
20C1.009 VL CDR3
artificial
QQAESFPHT





152
20A2.003 VH CDR1
artificial
NYGMH





153
20A2.003 VH CDR2
artificial
LIWYDASKKYYAESVKG





154
20A2.003 VH CDR3
artificial
DPSSLTGSTGYYGMDV





155
20A2.003 VL CDR1
artificial
SGDKLGDKYAS





156
20A2.003 VL CDR2
artificial
QDRKRPS





157
20A2.003 VL CDR3
artificial
QAFESSTEV





158
22D4.006 VH CDR1
artificial
DYSMS





159
22D4.006 VH CDR2
artificial
GINWNGGRTRYADAVKG





160
22D4.006 VH CDR3
artificial
EFNNFESNWFDP





161
22D4.006 VL CDR1
artificial
SGDALPKKYAY





162
22D4.006 VL CDR2
artificial
EDAKRPS





163
22D4.006 VL CDR3
artificial
YSTDASGNHRV





164
22D4.017 VH CDR1
artificial
DYSMS





165
22D4.017 VH CDR2
artificial
GINWNAGRTRYADAVKG





166
22D4.017 VH CDR3
artificial
EFNNFESNWFDP





167
22D4.017 VL CDR1
artificial
SGDALPKKYAY





168
22D4.017 VL CDR2
artificial
EDAKRPS





169
22D4.017 VL CDR3
artificial
YSTDASGNHRV





170
20A2 VH
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYGMHWVRQAPGKGLEWVAL





IWYDGSKKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAAYYCARDP





SSLTGSTGYYGMDVWGQGTTVTVSS





171
20A2 VL
artificial
SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQD





RKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTEVFGGG





TKLTVL





172
20C1 VH
artificial
EVQLLESGGGLVQPGGALRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSL





ISGGGSNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYFCASPS





GHYFYAMDVWGQGTTVTVSS





173
20C1 VL
artificial
DIQMTQSPSSVSASVGDRVTITCRASQGISNWLAWYQQKPGKAPKLLIFA





ASSLQSGVPSRFGGSGSGTDFTFTISSLQPEDFATYYCQQADSFPHTFGG





GTKVEIK





174
22D4 VH
artificial
EVQLVESGGSVVRPGGSLRLSCAASGFTVDDYSMSWVRQVPGKGLEWVSG





INWNGGRTRYADSVKGRFTISRDSAKNSLYLQMNSLRAEDTALYYCAREF





NNFESNWFDPWGQGTLVTVSS





175
22D4 VL
artificial
SYELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQKSGQAPVLVISED





SKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNHRVFG





GGTKLTVL





176
20C1.006 VH
artificial
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSL





ISGGGSNTYYAESVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYFCASPS





GHYFYAMDVWGQGTTVTVSS





177
20C1.006 VL
artificial
DIQMTQSPSSVSASVGDRVTITCRASQGISNWLAWYQQKPGKAPKLLIFA





ASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQAESFPHTFGG





GTKVEIK





178
20C1.009 VH
artificial
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSL





ISGGGSQTYYAESVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYFCASPS





GHYFYAMDVWGQGTTVTVSS





179
20C1.009 VL
artificial
DIQMTQSPSSVSASVGDRVTITCRASQGISNWLAWYQQKPGKAPKLLIFA





ASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQAESFPHTFGG





GTKVEIK





180
20A2.003 VH
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYGMHWVRQAPGKGLEWVAL





IWYDASKKYYAESVKGRFTISRDNSKNTLYLQMNSLRAEDTAAYYCARDP





SSLTGSTGYYGMDVWGQGTTVTVSS





181
20A2.003 VL
artificial
SYELTQPPSVSVSPGQTASITCSGDKLGDKYASWYQQKPGQSPVLVIYQD





RKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAFESSTEVFGGG





TKLTVL





182
22D4.006 VH
artificial
EVQLVESGGSVVRPGGSLRLSCAASGFTVDDYSMSWVRQVPGKGLEWVSG





INWNGGRTRYADAVKGRFTISRDSAKNSLYLQMNSLRAEDTALYYCAREF





NNFESNWFDPWGQGTLVTVSS





183
22D4.006 VL
artificial
SYELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQKPGQAPVLVISED





AKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDASGNHRVFG





GGTKLTVL





184
22D4.017 VH
artificial
EVQLVESGGSVVRPGGSLRLSCAASGFTVDDYSMSWVRQVPGKGLEWVSG





INWNAGRTRYADAVKGRFTISRDSAKNSLYLQMNSLRAEDTALYYCAREF





NNFESNWFDPWGQGTLVTVSS





185
22D4.017 VL
artificial
SYELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQKPGQAPVLVISED





AKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDASGNHRVFG





GGTKLTVL





186
20A2 heavy chain
artificial
MDMRVPAQLLGLLLLWLRGARCQVQLVESGGGVVQPGRSLRLSCAASGFT





FSNYGMHWVRQAPGKGLEWVALIWYDGSKKYYADSVKGRFTISRDNSKNT





LYLQMNSLRAEDTAAYYCAR





DPSSLTGSTGYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTA





ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS





SSLGTQTYICNVNHKPSNTK





VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT





CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLH





QDWLNGKEYKCKVSNKALPA





PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE





WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE





ALHNHYTQKSLSLSPGK





187
20A2 light chain
artificial
MAWALLLLTLLTQGTGSWASYELTQPPSVSVSPGQTASITCSGDKLGDKY





ACWYQQKPGQSPVLVIYQDRKRPSGIPERFSGSNSGNTATLTISGTQAMD





EADYYCQAWDSSTEVFGGGT





KLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKAD





SSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGST





VEKTVAPTECS





188
20C1 heavy chain
artificial
MDMRVPAQLLGLLLLWLRGARCEVQLLESGGGLVQPGGALRLSCAASGFT





FSSYDMSWVRQAPGKGLEWVSLISGGGSNTYYADSVKGRFTISRDNSKNT





LYLQMNSLRAEDTAVYFCAS





PSGHYFYAMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL





VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT





QTYICNVNHKPSNTKVDKKV





EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD





VSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKT





ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG





QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH





YTQKSLSLSPGK





189
20C1 light chain
artificial
MDMRVPAQLLGLLLLWLRGARCDIQMTQSPSSVSASVGDRVTITCRASQG





ISNWLAWYQQKPGKAPKLLIFAASSLQSGVPSRFGGSGSGTDFTFTISSL





QPEDFATYYCQQADSFPHTF





GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW





KVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH





QGLSSPVTKSFNRGEC





190
22D4 heavy chain
artificial
MDMRVPAQLLGLLLLWLRGARCEVQLVESGGSVVRPGGSLRLSCAASGFT





VDDYSMSWVRQVPGKGLEWVSGINWNGGRTRYADSVKGRFTISRDSAKNS





LYLQMNSLRAEDTALYYCAR





EFNNFESNWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC





LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG





TQTYICNVNHKPSNTKVDKK





VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV





DVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHODWL





NGKEYKCKVSNKALPAPIEK





TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESN





GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN





HYTQKSLSLSPGK





191
22D4 light chain
artificial
MAWALLLLTLLTQGTGSWASYELTQPPSVSVSPGQTARITCSGDALPKKY





AYWYQQKSGQAPVLVISEDSKRPSGIPERFSGSSSGTMATLTISGAQVED





EADYYCYSTDSSGNHRVFGG





GTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWK





ADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEG





STVEKTVAPTECS





192
20C1.006
artificial
MDMRVPAQLLGLLLLWLRGARCEVQLLESGGGLVQPGGSLRLSCAASGFT



heavy chain

FSSYDMSWVRQAPGKGLEWVSLISGGGSNTYYAESVKGRFTISRDNSKNT





LYLQMNSLRAEDTAVYFCAS





PSGHYFYAMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL





VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT





QTYICNVNHKPSNTKVDKKV





EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD





VSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKT





ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG





QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH





YTQKSLSLSPGK





193
20C1.006
artificial
MDMRVPAQLLGLLLLWLRGARCDIQMTQSPSSVSASVGDRVTITCRASQG



light chain

ISNWLAWYQQKPGKAPKLLIFAASSLQSGVPSRFSGSGSGTDFTLTISSL





QPEDFATYYCQQAESFPHTF





GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW





KVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH





QGLSSPVTKSFNRGEC





194
20C1.009
artificial
MDMRVPAQLLGLLLLWLRGARCEVQLLESGGGLVQPGGSLRLSCAASGFT



heavy chain

FSSYDMSWVRQAPGKGLEWVSLISGGGSQTYYAESVKGRFTISRDNSKNT





LYLQMNSLRAEDTAVYFCAS





PSGHYFYAMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL





VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT





QTYICNVNHKPSNTKVDKKV





EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD





VSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKT





ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG





QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH





YTQKSLSLSPGK





195
20C1.009
artificial
MDMRVPAQLLGLLLLWLRGARCDIQMTQSPSSVSASVGDRVTITCRASQG



light chain

ISNWLAWYQQKPGKAPKLLIFAASSLQSGVPSRFSGSGSGTDFTLTISSL





QPEDFATYYCQQAESFPHTF





GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW





KVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH





QGLSSPVTKSFNRGEC





196
20A2.003
artificial
MDMRVPAQLLGLLLLWLRGARCQVQLVESGGGVVQPGRSLRLSCAASGFT



heavy chain

FSNYGMHWVRQAPGKGLEWVALIWYDASKKYYAESVKGRFTISRDNSKNT





LYLQMNSLRAEDTAAYYCAR





DPSSLTGSTGYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTA





ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS





SSLGTQTYICNVNHKPSNTK





VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT





CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLH





QDWLNGKEYKCKVSNKALPA





PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE





WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE





ALHNHYTQKSLSLSPGK





197
20A2.003
artificial
MAWALLLLTLLTQGTGSWASYELTQPPSVSVSPGQTASITCSGDKLGDKY



light chain

ASWYQQKPGQSPVLVIYQDRKRPSGIPERFSGSNSGNTATLTISGTQAMD





EADYYCQAFESSTEVFGGGT





KLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKAD





SSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGST





VEKTVAPTECS





198
22D4.006
artificial
MDMRVPAQLLGLLLLWLRGARCEVQLVESGGSVVRPGGSLRLSCAASGFT



heavy chain

VDDYSMSWVRQVPGKGLEWVSGINWNGGRTRYADAVKGRFTISRDSAKNS





LYLQMNSLRAEDTALYYCAR





EFNNFESNWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC





LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG





TQTYICNVNHKPSNTKVDKK





VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV





DVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHODWL





NGKEYKCKVSNKALPAPIEK





TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESN





GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN





HYTQKSLSLSPGK





199
22D4.006
artificial
MAWALLLLTLLTQGTGSWASYELTQPPSVSVSPGQTARITCSGDALPKKY



light chain

AYWYQQKPGQAPVLVISEDAKRPSGIPERFSGSSSGTMATLTISGAQVED





EADYYCYSTDASGNHRVFGG





GTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWK





ADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEG





STVEKTVAPTECS





200
22D4.017
artificial
MDMRVPAQLLGLLLLWLRGARCEVQLVESGGSVVRPGGSLRLSCAASGFT



heavy chain

VDDYSMSWVRQVPGKGLEWVSGINWNAGRTRYADAVKGRFTISRDSAKNS





LYLQMNSLRAEDTALYYCAR





EFNNFESNWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC





LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG





TQTYICNVNHKPSNTKVDKK





VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV





DVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWL





NGKEYKCKVSNKALPAPIEK





TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESN





GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN





HYTQKSLSLSPGK





201
22D4.017
artificial
MAWALLLLTLLTQGTGSWASYELTQPPSVSVSPGQTARITCSGDALPKKY



light chain

AYWYQQKPGQAPVLVISEDAKRPSGIPERFSGSSSGTMATLTISGAQVED





EADYYCYSTDASGNHRVFGG





GTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWK





ADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEG





STVEKTVAPTECS





202
linker 1
artificial
GGGG





203
linker 2
artificial
GGGGS





204
linker 3
artificial
GGGGQ





205
linker 4
artificial
SGGGGS





206
linker 5
artificial
PGGGGS





207
linker 6
artificial
PGGDGS





208
linker 7
artificial
GGGGSGGGS





209
linker 8 = (G4S)2
artificial
GGGGSGGGGS



linker







210
linker 9 = (64S)3
artificial
GGGGSGGGGSGGGGS



linker







211
(G4S)4 linker
artificial
GGGGSGGGGSGGGGSGGGGS





212
(G4S)5 linker
artificial
GGGGSGGGGSGGGGSGGGGSGGGGS





213
(G4S)6 linker
artificial
GGGGSGGGGSGGGGSGGGGSGGGGSGGGGS





214
(G4S)7 linker
artificial
GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS





215
(G4S)8 linker
artificial
GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS





216
Ab156
artificial
RDWDFDVFGGGTPVGG





217
linear FcRn BP
artificial
QRFVTGHFGGLXPANG





218
linear FcRn BP-Y
artificial
QRFVTGHFGGLYPANG





219
linear FcRn BP-H
artificial
QRFVTGHFGGLHPANG





220
core FcRn BP-H
artificial
TGHFGGLHP





221
cyclic FcRn BP-H
artificial
QRFCTGHFGGLHPCNG





222
HALB
human
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFA





KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL





223
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFA



variant 1

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAGTFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAAMDD





FAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL





224
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFA



variant 2

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGPKLVAASQAALGL





225
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFA



variant 3

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALDVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGPHLVAASKAALGL





226
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFA



variant 4

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALGVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDK





FAAFVEKCCKADDKETCFAEEGPKLVAASQAALGL





227
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFA



variant 5

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALDVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDK





FAAFVEKCCKADDKETCFAEEGPKLVAASQAALGL





228
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFA



variant 6

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDK





FAAFVEKCCKADDKETCFAEEGPHLVAASQAALGL





229
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFA



variant 7

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGPHLVAASKAALGL





230
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFA



variant 8

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDK





FAAFVEKCCKADDKETCFAEEGPKLVAASKAALGL





231
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFA



variant 9

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALDVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGPKLVAASKAALGL





232
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFA



variant 10

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL





233
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFA



variant 11

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAGTFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAAMDD





FAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL





234
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFA



variant 12

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGPKLVAASQAALGL





235
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFA



variant 13

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALDVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGPHLVAASKAALGL





236
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFA



variant 14

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALGVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDK





FAAFVEKCCKADDKETCFAEEGPKLVAASQAALGL





237
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFA



variant 15

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALDVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDK





FAAFVEKCCKADDKETCFAEEGPKLVAASQAALGL





238
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFA



variant 16

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDK





FAAFVEKCCKADDKETCFAEEGPHLVAASQAALGL





239
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFA



variant 17

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGPHLVAASKAALGL





240
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFA



variant 18

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDK





FAAFVEKCCKADDKETCFAEEGPKLVAASKAALGL





241
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFA



variant 19

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALDVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGPKLVAASKAALGL





242
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQAPFEDHVKLVNEVTEFA



variant 20

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL





243
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQAPFEDHVKLVNEVTEFA



variant 21

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAGTFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAAMDD





FAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL





244
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQAPFEDHVKLVNEVTEFA



variant 22

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGPKLVAASQAALGL





245
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQAPFEDHVKLVNEVTEFA



variant 23

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALDVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGPHLVAASKAALGL





246
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQAPFEDHVKLVNEVTEFA



variant 24

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALGVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDK





FAAFVEKCCKADDKETCFAEEGPKLVAASQAALGL





247
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQAPFEDHVKLVNEVTEFA



variant 25

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALDVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDK





FAAFVEKCCKADDKETCFAEEGPKLVAASQAALGL





248
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQAPFEDHVKLVNEVTEFA



variant 26

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDK





FAAFVEKCCKADDKETCFAEEGPHLVAASQAALGL





249
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQAPFEDHVKLVNEVTEFA



variant 27

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGPHLVAASKAALGL





250
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQAPFEDHVKLVNEVTEFA



variant 28

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDK





FAAFVEKCCKADDKETCFAEEGPKLVAASKAALGL





251
HALB
artificial
DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQAPFEDHVKLVNEVTEFA



variant 29

KTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNE





CFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFY





APELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKC





ASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDL





LECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA





DLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLA





KTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGE





YKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAE





DYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALDVDETYVPK





EFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD





FAAFVEKCCKADDKETCFAEEGPKLVAASKAALGL





252
Cross body 1 HC
artificial
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV





HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP





KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMTSRTPEVTCVVVDVS





HEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGK





EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC





LVKGFYPSDIAVEWESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKSRW





QQGNVFSCSVMHEALHNHYTQKSLSLSPGK





253
Cross body 1 LC
artificial
GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVK





AGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTV





APTECSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV





DVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWL





NGKEYKCKVSNKALPAPTEKTTSKAKGQPREPQVYTLPPSRKEMTKNQVS





LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLKSDGSFFLYSKLTVDK





SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





254
Cross body 2 HC
artificial
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGV





HTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVEP





KSSDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMTSRTPEVTCVVVDVS





HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK





EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC





LVKGFYPSDIAVEWESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKSRW





QQGNVFSCSVMHEALHNHYTQKSLSLSPGK





255
Cross body 2 LC
artificial
GQPKAAPSVTLFPPSSEELQANKATLVCLTSDFYPGAVTVAWKADSSPVK





AGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTV





APTECSEPKSSDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMTSRTPEV





TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL





HQDWLNGKEYKCKVSNKALPAPTEKTTSKAKGQPREPQVYTLPPSRKEMT





KNQVSLTCLVKGFYPSDTAVEWESNGQPENNYKTTPPVLKSDGSFFLYSK





LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





256
Hetero-Fc binder Fc
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMTSRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRKEMTKNQVSLTCLVK





GFYPSDTAVEWESNGQPENNYKTTPPVLKSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGK





257
Hetero-Fc partner
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMTSRTPEVTCVVVDVSHED



Fc

PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDTAVEWESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGK





258
Maxi-body 1 target
artificial
EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD



Fc

VSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRKEMTKNQVSL





TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLKSDGSFFLYSKLTVDKS





RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





259
Maxi-body 1 CD3 Fc
artificial
EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD





VSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL





TCLVKGFYPSDIAVEWESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKS





RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





260
Maxi-body 2 target
artificial
EPKSSDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVD



Fc

VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRKEMTKNQVSL





TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLKSDGSFFLYSKLTVDKS





RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





261
Maxi-body 2 CD3 Fc
artificial
EPKSSDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVD





VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL





TCLVKGFYPSDIAVEWESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKS





RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





262
Mono Fc
artificial
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD





GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA





PIEKTISKAKGQPREPQVTTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE





WESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKSRWQQGNVFSCSVMHE





ALHNHYTQKSLSLSPGK





263
Fc monomer-1
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED



+c/-g

PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGK





264
Fc monomer-2
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED



+c/-g/delGK

PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSP





265
Fc monomer-3
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED



-c/+g

PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGK





266
Fc monomer-4
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED



-c/+g/delGK

PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSP





267
Fc monomer-5
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED



-c/-g

PEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGK





268
Fc monomer-6
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED



-c/-g/delGK

PEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSP





269
Fc monomer-7
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED



+c/+g

PEVKFNWYVDGVEVHNAKTKPCEEQYNSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGK





270
Fc monomer-8
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED



+c/+g/delGK

PEVKFNWYVDGVEVHNAKTKPCEEQYNSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSP





271
scFc-1
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





272
SCFc-2
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGGGGSGGGGSGGGGSGGGGSGGGGS





GGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD





VSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL





TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS





RWQQGNVFSCSVMHEALHNHYTQKSLSLSP





273
SCFC-3
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GEYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





274
ScFc-4
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGGGGSGGGGSGGGGSGGGGSGGGGS





GGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD





VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL





TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS





RWQQGNVFSCSVMHEALHNHYTQKSLSLSP





275
SCFc-5
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





276
scFc-6
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTOKSLSLSPGGGGSGGGGSGGGGSGGGGSGGGGS





GGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD





VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL





TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS





RWQQGNVFSCSVMHEALHNHYTQKSLSLSP





277
scFc-7
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPCEEQYNSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYNSTYRCVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





278
scFc-8
artificial
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPCEEQYNSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGGGGSGGGGSGGGGSGGGGSGGGGS





GGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCWVD





VSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYNSTYRCVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL





TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS





RWQQGNVFSCSVMHEALHNHYTQKSLSLSP





279
5x his-tag
artificial
HHHHH





280
6x his-tag
artificial
HHHHHH





281
CL-1 x I2C
bispecific
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQCLEWMGW




molecule
INPNSGGTKYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDR





ITVAGTYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSS





VSASVGDRVTITCRASQGVNNWLAWYQQKPGKAPKLLIYTASSLQSGVPS





RFSGSGSGTDFTLTIRSLQPEDFATYYCQQANSFPITFGCGTRLEIKSGG





GGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEW





VARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYY





CVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQE





PSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLA





PGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLT





VL





282
CL-2 x I2C
bispecific
QVQMVQSGAEVKKHGASVKVSCKASGYTFTGYYMHWVRQAPGQCLEWMGW




molecule
INPNSGGTKYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDR





ITVAGTYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTOSPSS





VSASVGDRVTITCRASQGVNNWLAWYQQKPGKAPKLLIYTASSLQSGVPS





RFSGSGSGTDFTLTIRSLQPEDFATYYCQQANSFPITFGCGTRLEIKSGG





GGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEW





VARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYY





CVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQE





PSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLA





PGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLT





VL





283
CL-1 x I2C-6His
bispecific
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQCLEWMGW




molecule-his
INPNSGGTKYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDR




tag
ITVAGTYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSS





VSASVGDRVTITCRASQGVNNWLAWYQQKPGKAPKLLIYTASSLQSGVPS





RFSGSGSGTDFTLTIRSLQPEDFATYYCQQANSFPITFGCGTRLEIKSGG





GGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEW





VARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLOMNNLKTEDTAVYY





CVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQE





PSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLA





PGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLT





VLHHHHHH





284
CL-2 x I2C-6His
bispecific
QVQMVQSGAEVKKHGASVKVSCKASGYTFTGYYMHWVRQAPGQCLEWMGW




molecule-
INPNSGGTKYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDR




his tag
ITVAGTYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSS





VSASVGDRVTITCRASQGVNNWLAWYQQKPGKAPKLLIYTASSLQSGVPS





RFSGSGSGTDFTLTIRSLQPEDFATYYCQQANSFPITFGCGTRLEIKSGG





GGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEW





VARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYY





CVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQE





PSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLA





PGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLT





VLHHHHHH





285
AU1 epitope
artificial
DTYRYI





286
AU5 epitope
artificial
TDFYLK





287
T-7 tag
artificial
MASMTGGQQMG





288
V-5 tag
artificial
GKPIPNPLLGLDST





289
B-tag
artificial
QYPALT





290
E2 epitope
artificial
SSTSSDFRDR





291
FLAG tag
artificial
DYKDDDK





292
Glu-Glu tag 1
artificial
EYMPME





293
Glu-Glu tag 2
artificial
EFMPME





294
Histidine affinity
artificial
KDHL1HNVHKEFHAHAHNK



tag







295
HSV epitope
artificial
QPELAPED





296
KT3 epitope
artificial
KPPTPPPEPET





297
Myc epitope
artificial
CEQKLISEEDL





298
7x his-tag
artificial
HHHHHHH





299
8x his-tag
artificial
HHHHHHHH





300
S1 tag
artificial
NANNPDWDF





301
S-tag
artificial
KETAAAKFERQHMDS





302
Strep-tag 1
artificial
WSHPQFEK





303
Strep-tag 2
artificial
AWAHPQPGG





304
Universal tag
artificial
HTTPHH





305
VSV-G
artificial
YTDIEMNRLGK





306
Protein C
artificial
EDQVDPRLIDGK





307
CD19XCD3 BISPECIFIC
artificial
DIQLTQSPASLAVSLGQRATISCKASQSVDYDGDSYLNWYQQIPGQPPKL



SINGLE CHAIN

LIYDASNLVSGIPPRFSGSGSGTDFTLNIHPVEKVDAATYHCQQSTEDPW



ANTIBODY

TFGGGTKLEIKGGGGSGGGGSGGGGSQVQLQQSGAELVRPGSSVKISCKA





SGYAFSSYWMNWVKQRPGQGLEWIGQIWPGDGDTNYNGKFKGKATLTADE





SSSTAYMQLSSLASEDSAVYFCARRETTTVGRYYYAMDYWGQGTTVTVSS





GGGGSDIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGL





EWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYY





CARYYDDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSP





AIMSASPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASGVP





YRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK





308
VH ANTI CD19
artificial
QVQLQQSGAELVRPGSSVKISCKASGYAFSSYWMNWVKQRPGQGLEWIGQ





IWPGDGDTNYNGKFKGKATLTADESSSTAYMQLSSLASEDSAVYFCARRE





TTTVGRYYYAMDYWGQGTTVTVSS





309
VL ANTI CD19
artificial
DIQLTQSPASLAVSLGQRATISCKASQSVDYDGDSYLNWYQQIPGQPPKL





LIYDASNLVSGIPPRFSGSGSGTDFTLNIHPVEKVDAATYHCQQSTEDPW





TEGGGTKLEIK





310
CD19 CDR-H1
artificial
SYWMN





311
CD19 CDR-H1
artificial
GYAFSSYWMN





312
CD19 CDR-H2
artificial
QIWPGDGDTNYNGKFKG





313
CD19 CDR-H3
artificial
RETTTVGRYYYAMDY





314
CD19 CDR-L1
artificial
KASQSVDYDGDSYLN





315
CD19 CDR-L2
artificial
DASNLVS





316
CD19 CDR-L3
artificial
QQSTEDPWT





317
CD33 CDR-L1
artificial
KSSQSVLDSSTNKNSLA





318
CD33 CDR-L2
artificial
WASTRES





319
CD33 CDR-L3
artificial
QQSAHFPIT





320
CD33 CDR-L1
artificial
KSSQSVLDSSKNKNSLA





321
CD33 CDR-L2
artificial
WASTRE





322
CD33 CDR-L1
artificial
KSSQSVLDSSNNKNSLA





323
CD33 CDR-H1
ARTIFICIAL
NYGMN





324
CD33 CDR-H2
artificial
WINTYTGEPTYADKFQG





325
CD33 CDR-H3
artificial
WSWSDGYYVYFDY





326
CD33 CDR-H2
artificial
WINTYTGEPTYADDFKG





327
CD33 CDR-H2
artificial
WINTYTGETNYADKFQG





328
CD33VL REGION
artificial
DIVMTQSPDSLTVSLGERTTINCKSSQSVLDSSTNKNSLAWYQQKPGQPP





KLLLSWASTRESGIPDRFSGSGSGTDFTLTIDSPQPEDSATYYCQQSAHF





PITFGQGTRLEIK





329
CD33VL REGION
artificial
DIVMTQSPDSLTVSLGERTTINCKSSQSVLDSSKNKNSLAWYQQKPGQPP





KLLLSWASTRESGIPDRFSGSGSGTDFTLTIDSLQPEDSATYYCQQSAHF





PITFGQGTRLEIK





330
CD33VL REGION
artificial
DIVMTQSPDSMTVSLGERTTINCKSSQSVLDSSTNKNSLAWYQQKPGQPP





KLLLSWASTRESGIPDRFSGSGSGTDFTLTIDSLQPEDSATYYCQQSAHF





PITFGQGTRLDIK





331
CD33VL REGION
artificial
DIVMTQSPDSLSVSLGERTTINCKSSQSVLDSSTNKNSLAWYQQKPGQPP





KLLLSWASTRESGIPDRFSGSGSGTDFTLTIDSLQPEDSATYYCQQSAHF





PITFGQGTRLEIK





332
CD33VL REGION
artificial
DIVMTQSPDSLTVSLGERTTINCKSSQSVLDSSNNKNSLAWYQQKPGQPP





KLLLSWASTRESGIPDRFSGSGSGTDFTLTIDGLQPEDSATYYCQQSAHF





PITFGQGTRLEIK





333
CD33VH REGION
artificial
QVQLVQSGAEVKKPGESVKVSCKASGYTFTNYGMNWVKQAPGQGLEWMGW





INTYTGEPTYADKFQGRVTMTTDTSTSTAYMEIRNLGGDDTAVYYCARWS





WSDGYYVYFDYWGQGTSVTVSS





334
CD33VH
artificial
QVQLVQSGAEVKKPGESVKVSCKASGYTFTNYGMNWVRQAPGQGLEWMGW





INTYTGEPTYADDFKGRVTMSSDTSTSTAYLEINSLRSDDTAIYYCARWS





WSDGYYVYFDYWGQGTTVTVSS





335
CD33VH
artificial
QVQLVQSGAEVKKPGESVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGW





INTYTGEPTYADDFKGRVTMTTDTSTSTAYMEIRNLRNDDTAVYYCARWS





WSDGYYVYFDYWGQGTTVTVSS





336
CD33VH
artificial
QVQLVQSGAEVKKPGESVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGW





INTYTGEPTYADDFKGRVTMTTDTSTSTAYMEIRNLRNDDTAVYYCARWS





WSDGYYVYFDYWGQGTTVTVSS





337
CD33VH
artificial
QVQLVQSGAEVKKPGESVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGW





INTYTGEPTYADDFKGRVTMTSDTSTSTAYMEISSLRSDDTAVYYCARWS





WSDGYYVYFDYWGQGTTVTVSS





338
CD33VH
artificial
QVQLVQSGAEVKKPGESVKVSCKASGYTFTNYGMNWVKQAPGQGLEWMGW





INTYTGETNYADKFQGRVTFTSDTSTSTAYMELRNLKSDDTAVYYCARWS





WSDGYYVYFDYWGQGTTVTVSS





339
CD33VH
artificial
QVQLVQSGAEVKKPGESVKVSCKASGYTFTNYGMNWVKQAPGQGLEWMGW





INTYTGEPTYADKFQGRVTMTTDTSTSTAYMEIRNLRSDDTAVYYCARWS





WSDGYYVYFDYWGQGTTVTVSS





340
CD33 UNIPROT ENTRY
human
MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYY



P20138

DKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNN





CSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIP





GTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIIT





PRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGK





QETRAGVVHGAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTH





PTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNP





SKDTSTEYSEVRTQ





341
Flt3 VH-CDR1
artificial
NARMGVS





342
Flt3 VH-CDR2
artificial
HIFSNAEKSYRTSLKS





343
Flt3 VH-CDR3
artificial
IPGYGGNGDYHYYGMDV





344
Flt3 VL-CDR1
artificial
RASQGIRNDLG





345
Flt3 VL-CDR2
artificial
ASSTLQS





346
Flt3 VL-CDR3
artificial
LQHNNFPWT





347
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLINARMGVSWIRQPPGKALEWL





AHIFSNAEKSYRTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI





PGYGGNGDYHYYGMDVWGQGTTVTVSS





348
Flt3 VL region
artificial
DIQMTQSPSSLSASLGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYA





SSTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNNFPWTFGQ





GTKVEIK





349
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLINARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNAEKSYRTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



comprises a

PGYGGNGDYHYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSP



polypeptide

SSLSASLGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYASSTLQSGV





PSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNNFPWTFGQGTKVEIK





350
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLINARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNAEKSYRTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



FLT3

PGYGGNGDYHYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSP





SSLSASLGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYASSTLQSGV





PSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNNFPWTFGQGTKVEIKS





GGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGL





EWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAV





YYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVT





QEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKF





LAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTK





LTVL





351
Flt3 VH-CDR1
artificial
NARMGVS





352
Flt3 VH-CDR2
artificial
HIFSNDEKTYSTSLKS





353
Flt3 VH-CDR3
artificial
IPYYGSGSHNYGMDV





354
Flt3 VL-CDR1
artificial
RASQDIRNDFG





355
Flt3 VL-CDR2
artificial
AASTLQS





356
Flt3 VL-CDR3
artificial
LQYNTYPWT





357
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNARMGVSWIRQPPGKALEWL





AHIFSNDEKTYSTSLKSRLTISRDTSKGQVVLTMTKMDPVDTATYYCARI





PYYGSGSHNYGMDVWGQGTTVTVSS





358
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIRNDFGWYQQKPGKAPQRLLYA





ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYNTYPWTFGQ





GTKVEIK





359
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKTYSTSLKSRLTISRDTSKGQVVLTMTKMDPVDTATYYCARI



comprises a

PYYGSGSHNYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSS



polypeptide

LSASVGDRVTITCRASQDIRNDFGWYQQKPGKAPQRLLYAASTLQSGVPS





RFSGSGSGTEFTLTISSLQPEDFATYYCLQYNTYPWTFGQGTKVEIK





360
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKTYSTSLKSRLTISRDTSKGQVVLTMTKMDPVDTATYYCARI



FLT3

PYYGSGSHNYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSS





LSASVGDRVTITCRASQDIRNDFGWYQQKPGKAPQRLLYAASTLQSGVPS





RFSGSGSGTEFTLTISSLQPEDFATYYCLQYNTYPWTFGQGTKVEIKSGG





GGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEW





VARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYY





CVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQE





PSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLA





PGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLT





VL





361
Flt3 VH-CDR1
artificial
NARMAVS





362
Flt3 VH-CDR2
artificial
HIFSNGEKSYSTSLKS





363
Flt3 VH-CDR3
artificial
IVGYSDWLLPFDH





364
Flt3 VL-CDR1
artificial
RASQNINRFLN





365
Flt3 VL-CDR2
artificial
AASSLQS





366
Flt3 VL-CDR3
artificial
LQHNSYPWT





367
Flt3 VH region
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLSNARMAVSWIRQPPGKALEWL





AHIFSNGEKSYSTSLKSRLTISKDTSKTQVVLTMTNTDPVDTATYFCARI





VGYSDWLLPFDHWGQGIMVTVSS





368
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQNINRFLNWYQQKPGKAPKLLIYA





ASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQHNSYPWTFGQ





GTKVDIK





369
second domain which
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLSNARMAVSWIRQPPGKALEWL



binds to FLT3

AHIFSNGEKSYSTSLKSRLTISKDTSKTQVVLTMTNTDPVDTATYFCARI



comprises a

VGYSDWLLPFDHWGQGIMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLS



polypeptide

ASVGDRVTITCRASQNINRFLNWYQQKPGKAPKLLIYAASSLQSGVPSRF





SGSGSGTDFTLTISSLQPEDFATYYCLQHNSYPWTFGQGTKVDIK





370
Antibody construct
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLSNARMAVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNGEKSYSTSLKSRLTISKDTSKTQVVLTMTNTDPVDTATYFCARI



FLT3

VGYSDWLLPFDHWGQGIMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLS





ASVGDRVTITCRASQNINRFLNWYQQKPGKAPKLLIYAASSLQSGVPSRF





SGSGSGTDFTLTISSLQPEDFATYYCLQHNSYPWTFGQGTKVDIKSGGGG





SEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVA





RIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCV





RHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPS





LTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPG





TPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





371
Flt3 VH-CDR1
artificial
NAKMGVS





372
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





373
Flt3 VH-CDR3
artificial
IVGYGSGWYGYFDY





374
Flt3 VL-CDR1
artificial
RASQDIRDDLG





375
Flt3 VL-CDR2
artificial
GASTLQS





376
Flt3 VL-CDR3
artificial
LQHNSYPLT





377
Flt3 VH region
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNAKMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI





VGYGSGWYGYFDYWGQGTLVTVSS





378
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIRDDLGWYQQKPGNAPKRLIYG





ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVDIK





379
second domain which
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNAKMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI



comprises a

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIRDDLGWYQQKPGNAPKRLIYGASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVDIK





380
Antibody construct
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNAKMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI



FLT3

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIRDDLGWYQQKPGNAPKRLIYGASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVDIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





381
Flt3 VH-CDR1
artificial
NARMGVS





382
Flt3 VH-CDR2
artificial
HIFWNDEKSYSTSLKS





383
Flt3 VH-CDR3
artificial
IPYYGSGSYNYGMDV





384
Flt3 VL-CDR1
artificial
RASQGIRNDLG





385
Flt3 VL-CDR2
artificial
AASSLQS





386
Flt3 VL-CDR3
artificial
LQHNTYPLT





387
Flt3 VH region
artificial
QVTLKESGPMLVKPTETLTLTCTFSGFSLRNARMGVSWIRQPPGKALEWL





AHIFWNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI





PYYGSGSYNYGMDVWGQGTTVTVSS





388
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNTYPLTFGG





GTKVDIK





389
second domain which
artificial
QVTLKESGPMLVKPTETLTLTCTFSGFSLRNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFWNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



comprises a

PYYGSGSYNYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSS



polypeptide

LSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPS





RFSGSGSGTEFTLTISSLQPEDFATYYCLQHNTYPLTFGGGTKVDIK





390
Antibody construct
artificial
QVTLKESGPMLVKPTETLTLTCTFSGFSLRNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFWNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



FLT3

PYYGSGSYNYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSS





LSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPS





RFSGSGSGTEFTLTISSLQPEDFATYYCLQHNTYPLTFGGGTKVDIKSGG





GGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEW





VARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYY





CVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQE





PSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLA





PGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLT





VL





391
Flt3 VH-CDR1
artificial
NARMAVS





392
Flt3 VH-CDR2
artificial
HIFSNDEKSYSPSLKS





393
Flt3 VH-CDR3
artificial
IVGYGTGWYGFFDY





394
Flt3 VL-CDR1
artificial
RASQGIRNDLG





395
Flt3 VL-CDR2
artificial
AASVLQS





396
Flt3 VL-CDR3
artificial
LQHNSYPLT





397
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKTLEWL





AHIFSNDEKSYSPSLKSRLTISKDTSKSQVVLTMTNMDPEDTATYYCARI





VGYGTGWYGFFDYWGQGILVTVSS





398
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWFQQKPGKAPKRLIYA





ASVLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVDIK





399
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKTLEWL



binds to FLT3

AHIFSNDEKSYSPSLKSRLTISKDTSKSQVVLTMTNMDPEDTATYYCARI



comprises a

VGYGTGWYGFFDYWGQGILVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLGWFQQKPGKAPKRLIYAASVLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVDIK





400
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKTLEWL



binding to CD3 and

AHIFSNDEKSYSPSLKSRLTISKDTSKSQVVLTMTNMDPEDTATYYCARI



FLT3

VGYGTGWYGFFDYWGQGILVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLGWFQQKPGKAPKRLIYAASVLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVDIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





401
Flt3 VH-CDR1
artificial
NARMGVS





402
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKN





403
Flt3 VH-CDR3
artificial
IVGYGTGWFGYFDY





404
Flt3 VL-CDR1
artificial
RASQDIRTDLA





405
Flt3 VL-CDR2
artificial
AASSLQS





406
Flt3 VL-CDR3
artificial
LQHNRYPLT





407
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLNNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI





VGYGTGWFGYFDYWGQGTQVTVSS





408
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIRTDLAWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNRYPLTFGG





GTKVDIK





409
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLNNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI



comprises a

VGYGTGWFGYFDYWGQGTQVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIRTDLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNRYPLTFGGGTKVDIK





410
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLNNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI



FLT3

VGYGTGWFGYFDYWGQGTQVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIRTDLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNRYPLTFGGGTKVDIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





411
Flt3 VH-CDR1
artificial
YARMGVS





412
Flt3 VH-CDR2
artificial
QIFSNDEKSYSTSLKS





413
Flt3 VH-CDR3
artificial
IVGYGTGWYGFFDY





414
Flt3 VL-CDR1
artificial
RASQGIRNDLG





415
Flt3 VL-CDR2
artificial
AASSLQS





416
Flt3 VL-CDR3
artificial
LQHNSYPLT





417
Flt3 VH region
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLSYARMGVSWIRQPPGKALEWL





AQIFSNDEKSYSTSLKSRLTISKGTSNSQVVLTMTNMDPEDTATYYCARI





VGYGTGWYGFFDYWGQGILVTVSS





418
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVDIK





419
second domain which
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLSYARMGVSWIRQPPGKALEWL



binds to FLT3

AQIFSNDEKSYSTSLKSRLTISKGTSNSQVVLTMTNMDPEDTATYYCARI



comprises a

VGYGTGWYGFFDYWGQGILVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVDIK





420
Antibody construct
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLSYARMGVSWIRQPPGKALEWL



binding to CD3 and

AQIFSNDEKSYSTSLKSRLTISKGTSNSQVVLTMTNMDPEDTATYYCARI



FLT3

VGYGTGWYGFFDYWGQGILVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVDIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





421
Flt3 VH-CDR1
artificial
NARMGVS





422
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





423
Flt3 VH-CDR3
artificial
IPGYGGNFYYHYYGMDV





424
Flt3 VL-CDR1
artificial
RASQGIRNDLA





425
Flt3 VL-CDR2
artificial
AASTVQS





426
Flt3 VL-CDR3
artificial
LQHNSFPWT





427
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI





PGYGGNFYYHYYGMDVWGQGTTVTVSS





428
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLAWYQQKPGKAPKRLIYA





ASTVQSGVPSRFSGSGSGTEFALTISSLQPEDFATYYCLQHNSFPWTFGQ





GTKVDIK





429
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



comprises a

PGYGGNFYYHYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSP



polypeptide

SSLSASVGDRVTITCRASQGIRNDLAWYQQKPGKAPKRLIYAASTVQSGV





PSRFSGSGSGTEFALTISSLQPEDFATYYCLQHNSFPWTFGQGTKVDIK





430
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



FLT3

PGYGGNFYYHYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSP





SSLSASVGDRVTITCRASQGIRNDLAWYQQKPGKAPKRLIYAASTVQSGV





PSRFSGSGSGTEFALTISSLQPEDFATYYCLQHNSFPWTFGQGTKVDIKS





GGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGL





EWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAV





YYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVT





QEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKF





LAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTK





LTVL





431
Flt3 VH-CDR1
artificial
NARMGVS





432
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





433
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





434
Flt3 VL-CDR1
artificial
RASQDIRDDLG





435
Flt3 VL-CDR2
artificial
GASTLQS





436
Flt3 VL-CDR3
artificial
LQHNSYPLT





437
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTMVTVSS





438
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIRDDLGWYQQKPGNAPKRLIYG





ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVDIK





439
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIRDDLGWYQQKPGNAPKRLIYGASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVDIK





440
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIRDDLGWYQQKPGNAPKRLIYGASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVDIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





441
Flt3 VH-CDR1
artificial
NAKMGVS





442
Flt3 VH-CDR2
artificial
QIFSNGEKSYSTSLKS





443
Flt3 VH-CDR3
artificial
IVGYGSGWYGYFDY





444
Flt3 VL-CDR1
artificial
RASQGIRNDLG





445
Flt3 VL-CDR2
artificial
GASTLQS





446
Flt3 VL-CDR3
artificial
LQHNSYPLT





447
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTLSGFSLNNAKMGVSWIRQPPGKALEWL





AQIFSNGEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCSRI





VGYGSGWYGYFDYWGQGTLVTVSS





448
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYG





ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





449
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTLSGFSLNNAKMGVSWIRQPPGKALEWL



binds to FLT3

AQIFSNGEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCSRI



comprises a

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYGASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK





450
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTLSGFSLNNAKMGVSWIRQPPGKALEWL



binding to CD3 and

AQIFSNGEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCSRI



FLT3

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYGASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





451
Flt3 VH-CDR1
artificial
NARMGVS





452
Flt3 VH-CDR2
artificial
NIFSNDEKSYSTSLKS





453
Flt3 VH-CDR3
artificial
IVGYGSGWYGYFDY





454
Flt3 VL-CDR1
artificial
RASQGIRNDLG





455
Flt3 VL-CDR2
artificial
AASSLQS





456
Flt3 VL-CDR3
artificial
LQHNSYPLT





457
Flt3 VH region
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWL





ANIFSNDEKSYSTSLKSRLTISKGTSKSQVVLTMTNMDPEDTATYYCARI





VGYGSGWYGYFDYWGQGTLVTVSS





458
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPQRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





459
second domain which
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWL



binds to FLT3

ANIFSNDEKSYSTSLKSRLTISKGTSKSQVVLTMTNMDPEDTATYYCARI



comprises a

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPQRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK





460
Antibody construct
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWL



binding to CD3 and

ANIFSNDEKSYSTSLKSRLTISKGTSKSQVVLTMTNMDPEDTATYYCARI



FLT3

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPQRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





461
Flt3 VH-CDR1
artificial
NARMGVS





462
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKN





463
Flt3 VH-CDR3
artificial
IVGYGSGWYGFFDY





464
Flt3 VL-CDR1
artificial
RASQGIRNDLG





465
Flt3 VL-CDR2
artificial
AASTLQS





466
Flt3 VL-CDR3
artificial
LQHNSYPLT





467
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTLSGFSLNNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI





VGYGSGWYGFFDYWGQGTLVTVSS





468
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYA





ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





469
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTLSGFSLNNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI



comprises a

VGYGSGWYGFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK





470
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTLSGFSLNNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI



FLT3

VGYGSGWYGFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





471
Flt3 VH-CDR1
artificial
NARMAVS





472
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





473
Flt3 VH-CDR3
artificial
IVGYGSGWYGYFDY





474
Flt3 VL-CDR1
artificial
RASQDIRNDLG





475
Flt3 VL-CDR2
artificial
AASTLQS





476
Flt3 VL-CDR3
artificial
LQHNSYPLT





477
Flt3 VH region
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKTLEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI





VGYGSGWYGYFDYWGQGTLVTVSS





478
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIRNDLGWYQQKPGKAPKRLIYA





ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





479
second domain which
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKTLEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI



comprises a

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIRNDLGWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK





480
Antibody construct
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKTLEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI



FLT3

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIRNDLGWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





481
Flt3 VH-CDR1
artificial
NARMAVS





482
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





483
Flt3 VH-CDR3
artificial
IVGYGSGWYGYFDY





484
Flt3 VL-CDR1
artificial
RASQDIGNDLG





485
Flt3 VL-CDR2
artificial
AASSLQS





486
Flt3 VL-CDR3
artificial
LQHNSYPLT





487
Flt3 VH region
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKTLEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI





VGYGSGWYGYFDYWGQGTLVTVSS





488
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIGNDLGWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





489
second domain which
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKTLEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI



comprises a

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIGNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK





490
Antibody construct
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKTLEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI



FLT3

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIGNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





491
Flt3 VH-CDR1
artificial
NARMAVS





492
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





493
Flt3 VH-CDR3
artificial
IVGYGSGWYGYFDY





494
Flt3 VL-CDR1
artificial
RASQDIRYDLA





495
Flt3 VL-CDR2
artificial
AASSLQS





496
Flt3 VL-CDR3
artificial
LQHNFYPLT





497
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNARMAVSWIRQPPGKTLEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI





VGYGSGWYGYFDYWGQGTLVTVSS





498
Flt3 VL region
artificial
DIQMTQSPSSVSASVGDRVTITCRASQDIRYDLAWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNFYPLTFGG





GTKVEIK





499
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNARMAVSWIRQPPGKTLEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



comprises a

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSV



polypeptide

SASVGDRVTITCRASQDIRYDLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNFYPLTFGGGTKVEIK





500
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNARMAVSWIRQPPGKTLEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



FLT3

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSV





SASVGDRVTITCRASQDIRYDLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNFYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





501
Flt3 VH-CDR1
artificial
NARMGVS





502
Flt3 VH-CDR2
artificial
NIFSNDEKSYSTSLKS





503
Flt3 VH-CDR3
artificial
IVGYGSGWYGYFDY





504
Flt3 VL-CDR1
artificial
RASQDIRNDLG





505
Flt3 VL-CDR2
artificial
ATSIRQS





506
Flt3 VL-CDR3
artificial
LQHNSFPLT





507
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWL





ANIFSNDEKSYSTSLKSRLTISKGTSKSQVVLTMTNVNPVDTGTYYCARI





VGYGSGWYGYFDYWGQGTLVTVSS





508
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIRNDLGWYQQKPGKAPKRLIYA





TSIRQSGVPSRFTGSGSGTEFTLTISGLQPEDFATYFCLQHNSFPLTFGG





GTKVEIK





509
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWL



binds to FLT3

ANIFSNDEKSYSTSLKSRLTISKGTSKSQVVLTMTNVNPVDTGTYYCARI



comprises a

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIRNDLGWYQQKPGKAPKRLIYATSIRQSGVPSR





FTGSGSGTEFTLTISGLQPEDFATYFCLQHNSFPLTFGGGTKVEIK





510
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWL



binding to CD3 and

ANIFSNDEKSYSTSLKSRLTISKGTSKSQVVLTMTNVNPVDTGTYYCARI



FLT3

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIRNDLGWYQQKPGKAPKRLIYATSIRQSGVPSR





FTGSGSGTEFTLTISGLQPEDFATYFCLQHNSFPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





511
Flt3 VH-CDR1
artificial
NARMGVS





512
Flt3 VH-CDR2
artificial
HIFSNDEKSFSTSLKN





513
Flt3 VH-CDR3
artificial
MVGYGSGWYAYFDY





514
Flt3 VL-CDR1
artificial
RASQSISSYLN





515
Flt3 VL-CDR2
artificial
AASSLQS





516
Flt3 VL-CDR3
artificial
LQHNSYPLT





517
Flt3 VH region
artificial
QVTLKESGPVLVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL





AHIFSNDEKSFSTSLKNRLTISKDTSKSQVVLTMTNMDPVDTATYYCARM





VGYGSGWYAYFDYWGQGTQVIVSS





518
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYA





ASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





519
second domain which
artificial
QVTLKESGPVLVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSFSTSLKNRLTISKDTSKSQVVLTMTNMDPVDTATYYCARM



comprises a

VGYGSGWYAYFDYWGQGTQVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSR





FSGSGSGTDFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK





520
Antibody construct
artificial
QVTLKESGPVLVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSFSTSLKNRLTISKDTSKSQVVLTMTNMDPVDTATYYCARM



FLT3

VGYGSGWYAYFDYWGQGTQVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSR





FSGSGSGTDFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





521
Flt3 VH-CDR1
artificial
YARMGVS





522
Flt3 VH-CDR2
artificial
QIFSNDEKSYSTSLKS





523
Flt3 VH-CDR3
artificial
IVGYGTGWYGYFDY





524
Flt3 VL-CDR1
artificial
RASQDIGDDLG





525
Flt3 VL-CDR2
artificial
AASTLQS





526
Flt3 VL-CDR3
artificial
LQHNSYPLT





527
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSYARMGVSWIRQPPGKALEWL





AQIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTDMDPEDTATYYCARI





VGYGTGWYGYFDYWGQGTQVTVSS





528
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIGDDLGWYQQKPGKAPKRLIYA





ASTLQSGVPFRFSGSGSGTDFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





529
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSYARMGVSWIRQPPGKALEWL



binds to FLT3

AQIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTDMDPEDTATYYCARI



comprises a

VGYGTGWYGYFDYWGQGTQVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIGDDLGWYQQKPGKAPKRLIYAASTLQSGVPFR





FSGSGSGTDFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK





530
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSYARMGVSWIRQPPGKALEWL



binding to CD3 and

AQIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTDMDPEDTATYYCARI



FLT3

VGYGTGWYGYFDYWGQGTQVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIGDDLGWYQQKPGKAPKRLIYAASTLQSGVPFR





FSGSGSGTDFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





531
Flt3 VH-CDR1
artificial
NARMAVS





532
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





533
Flt3 VH-CDR3
artificial
IVGYGTGWYGFFDY





534
Flt3 VL-CDR1
artificial
RASQGIRNDLA





535
Flt3 VL-CDR2
artificial
AASSLQS





536
Flt3 VL-CDR3
artificial
LQHNSYPLT





537
Flt3 VH region
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKTLEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPEDTATYYCARI





VGYGTGWYGFFDYWGQGILVTVSS





538
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLAWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





539
second domain which
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKTLEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPEDTATYYCARI



comprises a

VGYGTGWYGFFDYWGQGILVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK





540
Antibody construct
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKTLEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPEDTATYYCARI



FLT3

VGYGTGWYGFFDYWGQGILVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





541
Flt3 VH-CDR1
artificial
NARMGVS





542
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





543
Flt3 VH-CDR3
artificial
IPGYGGNFYYHYYGMDV





544
Flt3 VL-CDR1
artificial
RTSRGIRNDLG





545
Flt3 VL-CDR2
artificial
AASTLQS





546
Flt3 VL-CDR3
artificial
LQHNNFPWT





547
Flt3 VH region
artificial
QVTLKESGPALVKPTETLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI





PGYGGNFYYHYYGMDVWGQGTTVTVSS





548
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRTSRGIRNDLGWYQQIPGRAPKRLIYA





ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNNFPWTFGQ





GTKVEIK





549
second domain which
artificial
QVTLKESGPALVKPTETLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



comprises a

PGYGGNFYYHYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSP



polypeptide

SSLSASVGDRVTITCRTSRGIRNDLGWYQQIPGRAPKRLIYAASTLQSGV





PSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNNFPWTFGQGTKVEIK





550
Antibody construct
artificial
QVTLKESGPALVKPTETLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



FLT3

PGYGGNFYYHYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSP





SSLSASVGDRVTITCRTSRGIRNDLGWYQQIPGRAPKRLIYAASTLQSGV





PSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNNFPWTFGQGTKVEIKS





GGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGL





EWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAV





YYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVT





QEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKF





LAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTK





LTVL





551
Flt3 VH-CDR1
artificial
NARMGVS





552
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





553
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





554
Flt3 VL-CDR1
artificial
RASQGISNYLA





555
Flt3 VL-CDR2
artificial
AASTLQS





556
Flt3 VL-CDR3
artificial
LQHNTYPWT





557
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTMVTVSS





558
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKAPKRLIYA





ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNTYPWTFGQ





GTKVEIK





559
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGISNYLAWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNTYPWTFGQGTKVEIK





560
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGISNYLAWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNTYPWTFGQGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





561
Flt3 VH-CDR1
artificial
NARMGVS





562
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





563
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





564
Flt3 VL-CDR1
artificial
RASQDIGYDLG





565
Flt3 VL-CDR2
artificial
AASTLQS





566
Flt3 VL-CDR3
artificial
LQHNSFPWT





567
Flt3 VH region
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTMVTVSS





568
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIGYDLGWYQQKPGKAPKRLIYA





ASTLQSGVPSRFSGSGSGTEFTLIISSLQPEDFATYYCLQHNSFPWTFGQ





GTKVEIK





569
second domain which
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIGYDLGWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLIISSLQPEDFATYYCLQHNSFPWTFGQGTKVEIK





570
Antibody construct
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIGYDLGWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLIISSLQPEDFATYYCLQHNSFPWTFGQGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





571
Flt3 VH-CDR1
artificial
NVRMGVS





572
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





573
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





574
Flt3 VL-CDR1
artificial
RASQDIRDDLV





575
Flt3 VL-CDR2
artificial
AASTLQS





576
Flt3 VL-CDR3
artificial
LQHHSYPWT





577
Flt3 VH region
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLILTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTMVTVSS





578
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIRDDLVWYQQKPGKAPKRLIYA





ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHHSYPWTFGQ





GTKVEIK





579
second domain which
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLILTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIRDDLVWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHHSYPWTFGQGTKVEIK





580
Antibody construct
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLILTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIRDDLVWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHHSYPWTFGQGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





581
Flt3 VH-CDR1
artificial
NARMGVS





582
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





583
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





584
Flt3 VL-CDR1
artificial
RASQDIRDDLG





585
Flt3 VL-CDR2
artificial
AASTLQS





586
Flt3 VL-CDR3
artificial
LQHNSFPFT





587
Flt3 VH region
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTMVTVSS





588
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIRDDLGWYQQKPGKAPKRLIYA





ASTLQSGVPSRFTGGGSGTEFTLTISSLQPEDFATYYCLQHNSFPFTFGG





GTKVEIK





589
second domain which
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIRDDLGWYQQKPGKAPKRLIYAASTLQSGVPSR





FTGGGSGTEFTLTISSLQPEDFATYYCLQHNSFPFTFGGGTKVEIK





590
Antibody construct
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIRDDLGWYQQKPGKAPKRLIYAASTLQSGVPSR





FTGGGSGTEFTLTISSLQPEDFATYYCLQHNSFPFTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





591
Flt3 VH-CDR1
artificial
NARMGVS





592
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





593
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





594
Flt3 VL-CDR1
artificial
RASQGIRNDLV





595
Flt3 VL-CDR2
artificial
GTSTLQS





296
Flt3 VL-CDR3
artificial
LQHNSYPLT





597
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTMVTVSS





598
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLVWYQQKPGKAPKRLIYG





TSTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





599
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLVWYQQKPGKAPKRLIYGTSTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK





600
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLVWYQQKPGKAPKRLIYGTSTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





601
Flt3 VH-CDR1
artificial
NARMGVS





602
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





603
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





604
Flt3 VL-CDR1
artificial
RTSQGIRNDLV





605
Flt3 VL-CDR2
artificial
AASTLQS





606
Flt3 VL-CDR3
artificial
LQHYSYPLT





607
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTMVTVSS





608
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRTSQGIRNDLVWYQQKPGKAPKRLIYA





ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYFCLQHYSYPLTFGG





GTKVEIK





609
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRTSQGIRNDLVWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYFCLQHYSYPLTFGGGTKVEIK





610
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRTSQGIRNDLVWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYFCLQHYSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





611
Flt3 VH-CDR1
artificial
NARMGVS





612
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





613
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





614
Flt3 VL-CDR1
artificial
RASQGIGDDLG





615
Flt3 VL-CDR2
artificial
ATSVLQS





616
Flt3 VL-CDR3
artificial
LQHNSYPLT





617
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTMVTVSS





618
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIGDDLGWYQQIPGKAPKRLIYA





TSVLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





619
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIGDDLGWYQQIPGKAPKRLIYATSVLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK





620
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIGDDLGWYQQIPGKAPKRLIYATSVLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





621
Flt3 VH-CDR1
artificial
NARMGVS





622
Flt3 VH-CDR2
artificial
HIFSNDEKSYRTSLKS





623
Flt3 VH-CDR3
artificial
IVGYGSGWYAYFDY





624
Flt3 VL-CDR1
artificial
RASQGIRNDLG





625
Flt3 VL-CDR2
artificial
AASSLQS





626
Flt3 VL-CDR3
artificial
LQHNSYPLT





627
Flt3 VH region
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYRTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI





VGYGSGWYAYFDYWGQGTLVTVSS





628
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





629
second domain which
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYRTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



comprises a

VGYGSGWYAYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK





630
Antibody construct
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYRTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



FLT3

VGYGSGWYAYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





631
Flt3 VH-CDR1
artificial
NARMGVS





632
Flt3 VH-CDR2
artificial
LIYWNDDKRYSPSLKS





633
Flt3 VH-CDR3
artificial
MVGYGSGWYAYFDY





634
Flt3 VL-CDR1
artificial
RASQGIRNDLG





635
Flt3 VL-CDR2
artificial
AASSLQS





636
Flt3 VL-CDR3
artificial
LQHNSYPLT





637
Flt3 VH region
artificial
QVTLKESGPVLVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL





ALIYWNDDKRYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCARM





VGYGSGWYAYFDYWGQGTLVTVSS





638
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





639
second domain which
artificial
QVTLKESGPVLVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL



binds to FLT3

ALIYWNDDKRYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCARM



comprises a

VGYGSGWYAYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK





640
Antibody construct
artificial
QVTLKESGPVLVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL



binding to CD3 and

ALIYWNDDKRYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCARM



FLT3

VGYGSGWYAYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





641
Flt3 VH-CDR1
artificial
NARMGVS





642
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





643
Flt3 VH-CDR3
artificial
IVGYGTGWYGFFDY





644
Flt3 VL-CDR1
artificial
RTSQGIRNDLG





645
Flt3 VL-CDR2
artificial
AASSLQS





646
Flt3 VL-CDR3
artificial
LQHNSYPLT





647
Flt3 VH region
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTDMDPEDTATYYCARI





VGYGTGWYGFFDYWGQGILVTVSS





648
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRTSQGIRNDLGWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





649
second domain which
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTDMDPEDTATYYCARI



comprises a

VGYGTGWYGFFDYWGQGILVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRTSQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK





650
Antibody construct
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTDMDPEDTATYYCARI



FLT3

VGYGTGWYGFFDYWGQGILVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRTSQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





651
Flt3 VH-CDR1
artificial
NARMGVS





652
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





653
Flt3 VH-CDR3
artificial
IVGYGSGWYGYFDY





654
Flt3 VL-CDR1
artificial
RASQGIRNDLV





655
Flt3 VL-CDR2
artificial
AASTLQS





656
Flt3 VL-CDR3
artificial
LQHYSYPLT





657
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI





VGYGSGWYGYFDYWGQGTLVTVSS





658
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLVWYQQKPGKAPKRLIYA





ASTLQSGVPSRFSGSGSGTEFILTISSLQPEDFATYFCLQHYSYPLTFGG





GTKLEIK





659
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI



comprises a

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLVWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFILTISSLQPEDFATYFCLQHYSYPLTFGGGTKLEIK





660
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI



FLT3

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLVWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFILTISSLQPEDFATYFCLQHYSYPLTFGGGTKLEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





661
Flt3 VH-CDR1
artificial
NARMGVS





662
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





663
Flt3 VH-CDR3
artificial
IVGYGSGWYGYFDY





664
Flt3 VL-CDR1
artificial
RASQGIGDDLG





665
Flt3 VL-CDR2
artificial
ATSVLQS





666
Flt3 VL-CDR3
artificial
LQHNSYPLT





667
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNARMGVSWIRQPPGKTLEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI





VGYGSGWYGYFDYWGQGTLVTVSS





668
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIGDDLGWYQQIPGKAPKRLIYA





TSVLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKLEIK





669
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNARMGVSWIRQPPGKTLEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI



comprises a

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIGDDLGWYQQIPGKAPKRLIYATSVLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKLEIK





670
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNARMGVSWIRQPPGKTLEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKGQVVLTMTNMDPVDTATYYCARI



FLT3

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIGDDLGWYQQIPGKAPKRLIYATSVLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKLEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





671
Flt3 VH-CDR1
artificial
NARMGVS





672
Flt3 VH-CDR2
artificial
HIFWNDEKSYSTSLKS





673
Flt3 VH-CDR3
artificial
IPYYGSGSYNYGMDV





674
Flt3 VL-CDR1
artificial
RASQGIRNDLG





675
Flt3 VL-CDR2
artificial
AASSLQS





676
Flt3 VL-CDR3
artificial
LQHNSYPLT





677
Flt3 VH region
artificial
QVTLKESGPALVKPTETLTLTCTFSGFSLRNARMGVSWIRQPPGKALEWL





AHIFWNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI





PYYGSGSYNYGMDVWGQGTTVTVSS





678
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKLEIK





679
second domain which
artificial
QVTLKESGPALVKPTETLTLTCTFSGFSLRNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFWNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



comprises a

PYYGSGSYNYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSS



polypeptide

LSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPS





RFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKLEIK





680
Antibody construct
artificial
QVTLKESGPALVKPTETLTLTCTFSGFSLRNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFWNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



FLT3

PYYGSGSYNYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSS





LSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPS





RFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKLEIKSGG





GGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEW





VARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYY





CVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQE





PSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLA





PGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLT





VL





681
Flt3 VH-CDR1
artificial
NARMGVS





682
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKN





683
Flt3 VH-CDR3
artificial
IVGYGTGWYGFFDY





684
Flt3 VL-CDR1
artificial
RASQDIRDDLV





685
Flt3 VL-CDR2
artificial
GTSTLQS





686
Flt3 VL-CDR3
artificial
LQHHSYPLT





687
Flt3 VH region
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLNNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI





VGYGTGWYGFFDYWGQGTQVTVSS





688
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIRDDLVWYQQKPGKAPKRLIYG





TSTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHHSYPLTFGG





GTKLEIK





689
second domain which
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLNNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI



comprises a

VGYGTGWYGFFDYWGQGTQVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIRDDLVWYQQKPGKAPKRLIYGTSTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHHSYPLTFGGGTKLEIK





690
Antibody construct
artificial
QVTLKESGPALVKPTETLTLTCTVSGFSLNNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI



FLT3

VGYGTGWYGFFDYWGQGTQVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIRDDLVWYQQKPGKAPKRLIYGTSTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHHSYPLTFGGGTKLEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





691
Flt3 VH-CDR1
artificial
YARMGVS





692
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





693
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





694
Flt3 VL-CDR1
artificial
RASQDIRNDLA





695
Flt3 VL-CDR2
artificial
AASSLQS





696
Flt3 VL-CDR3
artificial
LQHNSYPLT





697
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTFSGFSLRYARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTMVTVSS





698
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIRNDLAWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKLEIK





699
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTFSGFSLRYARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIRNDLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKLEIK





700
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTFSGFSLRYARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIRNDLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKLEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





701
Flt3 VH-CDR1
artificial
NIKMGVS





702
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





703
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





704
Flt3 VL-CDR1
artificial
RASQDISNYLA





705
Flt3 VL-CDR2
artificial
AASSLQS





706
Flt3 VL-CDR3
artificial
LQHNSFPLT





707
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNIKMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTMVTVSS





708
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDISNYLAWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSFPLTFGG





GTKLEIK





709
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNIKMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDISNYLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSFPLTFGGGTKLEIK





710
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNIKMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDISNYLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSFPLTFGGGTKLEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





711
Flt3 VH-CDR1
artificial
NARMGVS





712
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





713
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





714
Flt3 VL-CDR1
artificial
RASQGIRNDLG





715
Flt3 VL-CDR2
artificial
AASSLQS





716
Flt3 VL-CDR3
artificial
LQHNSYPLT





717
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTLVTVSS





718
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKLEIK





719
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKLEIK





720
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKLEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





721
Flt3 VH-CDR1
artificial
NARMGVS





722
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKN





723
Flt3 VH-CDR3
artificial
IVGYGSGWYGFFDY





724
Flt3 VL-CDR1
artificial
RASQGIRNDLG





725
Flt3 VL-CDR2
artificial
AASTLQS





726
Flt3 VL-CDR3
artificial
LQHNSYPLT





727
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTLSGFSLNNARMGVSWIRQPPGKCLEWL





AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI





VGYGSGWYGFFDYWGQGTLVTVSS





728
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYA





ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGC





GTKVEIK





729
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTLSGFSLNNARMGVSWIRQPPGKCLEWL



binds to FLT3

AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI



comprises a

VGYGSGWYGFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIK





730
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTLSGFSLNNARMGVSWIRQPPGKCLEWL



binding to CD3 and

AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI



FLT3

VGYGSGWYGFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





731
Flt3 VH-CDR1
artificial
NARMGVS





732
Flt3 VH-CDR2
artificial
NIFSNDEKSYSTSLKS





733
Flt3 VH-CDR3
artificial
IVGYGSGWYGYFDY





734
Flt3 VL-CDR1
artificial
RASQDIRNDLG





735
Flt3 VL-CDR2
artificial
ATSIRQS





736
Flt3 VL-CDR3
artificial
LQHNSFPLT





737
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKCLEWL





ANIFSNDEKSYSTSLKSRLTISKGTSKSQVVLTMTNVNPVDTGTYYCARI





VGYGSGWYGYFDYWGQGTLVTVSS





738
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIRNDLGWYQQKPGKAPKRLIYA





TSIRQSGVPSRFTGSGSGTEFTLTISGLQPEDFATYFCLQHNSFPLTFGC





GTKVEIK





739
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKCLEWL



binds to FLT3

ANIFSNDEKSYSTSLKSRLTISKGTSKSQVVLTMTNVNPVDTGTYYCARI



comprises a

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIRNDLGWYQQKPGKAPKRLIYATSIRQSGVPSR





FTGSGSGTEFTLTISGLQPEDFATYFCLQHNSFPLTFGCGTKVEIK





740
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKCLEWL



binding to CD3 and

ANIFSNDEKSYSTSLKSRLTISKGTSKSQVVLTMTNVNPVDTGTYYCARI



FLT3

VGYGSGWYGYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIRNDLGWYQQKPGKAPKRLIYATSIRQSGVPSR





FTGSGSGTEFTLTISGLQPEDFATYFCLQHNSFPLTFGCGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





741
Flt3 VH-CDR1
artificial
NARMGVS





742
Flt3 VH-CDR2
artificial
HIFSNDEKSFSTSLKN





743
Flt3 VH-CDR3
artificial
MVGYGSGWYAYFDY





744
Flt3 VL-CDR1
artificial
RASQSISSYLN





745
Flt3 VL-CDR2
artificial
AASSLQS





746
Flt3 VL-CDR3
artificial
LQHNSYPLT





747
Flt3 VH region
artificial
QVTLKESGPVLVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKCLEWL





AHIFSNDEKSFSTSLKNRLTISKDTSKSQVVLTMTNMDPVDTATYYCARM





VGYGSGWYAYFDYWGQGTQVIVSS





748
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYA





ASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQHNSYPLTFGC





GTKVEIK





749
second domain which
artificial
QVTLKESGPVLVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKCLEWL



binds to FLT3

AHIFSNDEKSFSTSLKNRLTISKDTSKSQVVLTMTNMDPVDTATYYCARM



comprises a

VGYGSGWYAYFDYWGQGTQVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSR





FSGSGSGTDFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIK





750
Antibody construct
artificial
QVTLKESGPVLVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKCLEWL



binding to CD3 and

AHIFSNDEKSFSTSLKNRLTISKDTSKSQVVLTMTNMDPVDTATYYCARM



FLT3

VGYGSGWYAYFDYWGQGTQVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSR





FSGSGSGTDFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





751
Flt3 VH-CDR1
artificial
NARMAVS





752
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





753
Flt3 VH-CDR3
artificial
IVGYGTGWYGFFDY





754
Flt3 VL-CDR1
artificial
RASQGIRNDLA





755
Flt3 VL-CDR2
artificial
AASSLQS





756
Flt3 VL-CDR3
artificial
LQHNSYPLT





757
Flt3 VH region
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKCLEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPEDTATYYCARI





VGYGTGWYGFFDYWGQGILVTVSS





758
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLAWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGC





GTKVEIK





759
second domain which
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKCLEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPEDTATYYCARI



comprises a

VGYGTGWYGFFDYWGQGILVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIK





760
Antibody construct
artificial
QVTLKESGPALVKPTETLTLTCTLSGFSLNNARMAVSWIRQPPGKCLEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPEDTATYYCARI



FLT3

VGYGTGWYGFFDYWGQGILVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





761
Flt3 VH-CDR1
artificial
NARMGVS





762
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





763
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





764
Flt3 VL-CDR1
artificial
RASQGIRNDLV





765
Flt3 VL-CDR2
artificial
GTSTLQS





766
Flt3 VL-CDR3
artificial
LQHNSYPLT





767
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKCLEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTMVTVSS





768
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLVWYQQKPGKAPKRLIYG





TSTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGC





GTKVEIK





769
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKCLEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLVWYQQKPGKAPKRLIYGTSTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIK





770
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKCLEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLVWYQQKPGKAPKRLIYGTSTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





771
Flt3 VH-CDR1
artificial
NARMGVS





772
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





773
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





774
Flt3 VL-CDR1
artificial
RTSQGIRNDLV





775
Flt3 VL-CDR2
artificial
AASTLQS





776
Flt3 VL-CDR3
artificial
LQHYSYPLT





777
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKCLEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTMVTVSS





778
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRTSQGIRNDLVWYQQKPGKAPKRLIYA





ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYFCLQHYSYPLTFGC





GTKVEIK





779
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKCLEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRTSQGIRNDLVWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYFCLQHYSYPLTFGCGTKVEIK





780
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSFRNARMGVSWIRQPPGKCLEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRTSQGIRNDLVWYQQKPGKAPKRLIYAASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYFCLQHYSYPLTFGCGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





781
Flt3 VH-CDR1
artificial
NARMGVS





782
Flt3 VH-CDR2
artificial
HIFSNDEKSYRTSLKS





783
Flt3 VH-CDR3
artificial
IVGYGSGWYAYFDY





784
Flt3 VL-CDR1
artificial
RASQGIRNDLG





785
Flt3 VL-CDR2
artificial
AASSLQS





786
Flt3 VL-CDR3
artificial
LQHNSYPLT





787
Flt3 VH region
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKCLEWL





AHIFSNDEKSYRTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI





VGYGSGWYAYFDYWGQGTLVTVSS





788
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGC





GTKVEIK





789
second domain which
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKCLEWL



binds to FLT3

AHIFSNDEKSYRTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



comprises a

VGYGSGWYAYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIK





790
Antibody construct
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKCLEWL



binding to CD3 and

AHIFSNDEKSYRTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



FLT3

VGYGSGWYAYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





791
Flt3 VH-CDR1
artificial
NARMGVS





792
Flt3 VH-CDR2
artificial
LIYWNDDKRYSPSLKS





793
Flt3 VH-CDR3
artificial
MVGYGSGWYAYFDY





794
Flt3 VL-CDR1
artificial
RASQGIRNDLG





795
Flt3 VL-CDR2
artificial
AASSLQS





796
Flt3 VL-CDR3
artificial
LQHNSYPLT





797
Flt3 VH region
artificial
QVTLKESGPVLVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKCLEWL





ALIYWNDDKRYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCARM





VGYGSGWYAYFDYWGQGTLVTVSS





798
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGC





GTKVEIK





799
second domain which
artificial
QVTLKESGPVLVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKCLEWL



binds to FLT3

ALIYWNDDKRYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCARM



comprises a

VGYGSGWYAYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIK





800
Antibody construct
artificial
QVTLKESGPVLVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKCLEWL



binding to CD3 and

ALIYWNDDKRYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCARM



FLT3

VGYGSGWYAYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





801
Flt3 VH-CDR1
artificial
NARMGVS





802
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





803
Flt3 VH-CDR3
artificial
IVGYGTGWYGFFDY





804
Flt3 VL-CDR1
artificial
RTSQGIRNDLG





805
Flt3 VL-CDR2
artificial
AASSLQS





806
Flt3 VL-CDR3
artificial
LQHNSYPLT





807
Flt3 VH region
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKCLEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTDMDPEDTATYYCARI





VGYGTGWYGFFDYWGQGILVTVSS





808
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRTSQGIRNDLGWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGC





GTKVEIK





809
second domain which
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKCLEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTDMDPEDTATYYCARI



comprises a

VGYGTGWYGFFDYWGQGILVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRTSQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIK





810
Antibody construct
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKCLEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTDMDPEDTATYYCARI



FLT3

VGYGTGWYGFFDYWGQGILVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRTSQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





811
Flt3 VH-CDR1
artificial
NARMGVS





812
Flt3 VH-CDR2
artificial
HIFWNDEKSYSTSLKS





813
Flt3 VH-CDR3
artificial
IPYYGSGSYNYGMDV





814
Flt3 VL-CDR1
artificial
RASQGIRNDLG





815
Flt3 VL-CDR2
artificial
AASSLQS





816
Flt3 VL-CDR3
artificial
LQHNTYPLT





817
Flt3 VH region
artificial
QVTLKESGPMLVKPTETLTLTCTFSGFSLRNARMGVSWIRQPPGKCLEWL





AHIFWNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI





PYYGSGSYNYGMDVWGQGTTVTVSS





818
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNTYPLTFGC





GTKVDIK





819
second domain which
artificial
QVTLKESGPMLVKPTETLTLTCTFSGFSLRNARMGVSWIRQPPGKCLEWL



binds to FLT3

AHIFWNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



comprises a

PYYGSGSYNYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSS



polypeptide

LSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPS





RFSGSGSGTEFTLTISSLQPEDFATYYCLQHNTYPLTFGCGTKVDIK





820
Antibody construct
artificial
QVTLKESGPMLVKPTETLTLTCTFSGFSLRNARMGVSWIRQPPGKCLEWL



binding to CD3 and

AHIFWNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



FLT3

PYYGSGSYNYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSS





LSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPS





RFSGSGSGTEFTLTISSLQPEDFATYYCLQHNTYPLTFGCGTKVDIKSGG





GGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEW





VARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYY





CVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQE





PSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLA





PGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLT





VL





821
Flt3 VH-CDR1
artificial
NARMGVS





822
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKN





823
Flt3 VH-CDR3
artificial
IVGYGTGWFGYFDY





824
Flt3 VL-CDR1
artificial
RASQDIRTDLA





825
Flt3 VL-CDR2
artificial
AASSLQS





826
Flt3 VL-CDR3
artificial
LQHNRYPLT





827
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLNNARMGVSWIRQPPGKCLEWL





AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI





VGYGTGWFGYFDYWGQGTQVTVSS





828
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIRTDLAWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNRYPLTFGC





GTKVDIK





829
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLNNARMGVSWIRQPPGKCLEWL



binds to FLT3

AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI



comprises a

VGYGTGWFGYFDYWGQGTQVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIRTDLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNRYPLTFGCGTKVDIK





830
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLNNARMGVSWIRQPPGKCLEWL



binding to CD3 and

AHIFSNDEKSYSTSLKNRLTISKDSSKTQVVLTMTNVDPVDTATYYCARI



FLT3

VGYGTGWFGYFDYWGQGTQVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIRTDLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNRYPLTFGCGTKVDIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





831
Flt3 VH-CDR1
artificial
NARMGVS





832
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





833
Flt3 VH-CDR3
artificial
IPGYGGNFYYHYYGMDV





834
Flt3 VL-CDR1
artificial
RASQGIRNDLA





835
Flt3 VL-CDR2
artificial
AASTVQS





836
Flt3 VL-CDR3
artificial
LQHNSFPWT





837
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKCLEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI





PGYGGNFYYHYYGMDVWGQGTTVTVSS





838
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLAWYQQKPGKAPKRLIYA





ASTVQSGVPSRFSGSGSGTEFALTISSLQPEDFATYYCLQHNSFPWTFGC





GTKVDIK





839
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKCLEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



comprises a

PGYGGNFYYHYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSP



polypeptide

SSLSASVGDRVTITCRASQGIRNDLAWYQQKPGKAPKRLIYAASTVQSGV





PSRFSGSGSGTEFALTISSLQPEDFATYYCLQHNSFPWTFGCGTKVDIK





840
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKCLEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI



FLT3

PGYGGNFYYHYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSP





SSLSASVGDRVTITCRASQGIRNDLAWYQQKPGKAPKRLIYAASTVQSGV





PSRFSGSGSGTEFALTISSLQPEDFATYYCLQHNSFPWTFGCGTKVDIKS





GGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGL





EWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAV





YYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVT





QEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKF





LAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTK





LTVL





841
Flt3 VH-CDR1
artificial
NVRMGVS





842
Flt3 VH-CDR2
artificial
HISSNDEKSYSTSLRS





843
Flt3 VH-CDR3
artificial
MPGDSNTWRGFFDY





844
Flt3 VL-CDR1
artificial
RTSQSVNNNLA





845
Flt3 VL-CDR2
artificial
GASTRAT





846
Flt3 VL-CDR3
artificial
LQHNSYPLT





847
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKCLEWL





AHISSNDEKSYSTSLRSRLTISTDTSKSQVVLTMTNMDPVDTATYYCARM





PGDSNTWRGFFDYWGQGTLVTVSS





848
Flt3 VL region
artificial
EIVMTQSPATLSVSPGERATLSCRTSQSVNNNLAWYQQKPGQAPRLLIYG





ASTRATGIPARFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGC





GTKVEIK





849
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKCLEWL



binds to FLT3

AHISSNDEKSYSTSLRSRLTISTDTSKSQVVLTMTNMDPVDTATYYCARM



comprises a

PGDSNTWRGFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVMTQSPATL



polypeptide

SVSPGERATLSCRTSQSVNNNLAWYQQKPGQAPRLLIYGASTRATGIPAR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIK





850
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKCLEWL



binding to CD3 and

AHISSNDEKSYSTSLRSRLTISTDTSKSQVVLTMTNMDPVDTATYYCARM



FLT3

PGDSNTWRGFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVMTQSPATL





SVSPGERATLSCRTSQSVNNNLAWYQQKPGQAPRLLIYGASTRATGIPAR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





851
Flt3 VH-CDR1
artificial
YARMGVS





852
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





853
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





854
Flt3 VL-CDR1
artificial
RASQDIRNDLA





855
Flt3 VL-CDR2
artificial
AASSLQS





856
Flt3 VL-CDR3
artificial
LQHNSYPLT





857
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTFSGFSLRYARMGVSWIRQPPGKCLEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTMVTVSS





858
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIRNDLAWYQQKPGKAPKRLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGC





GTKLEIK





859
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTFSGFSLRYARMGVSWIRQPPGKCLEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIRNDLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKLEIK





860
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTFSGFSLRYARMGVSWIRQPPGKCLEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIRNDLAWYQQKPGKAPKRLIYAASSLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKLEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





861
Flt3 VH-CDR1
artificial
SYGMH





862
Flt3 VH-CDR2
artificial
VISYDGSNEFYADSVKG





863
Flt3 VH-CDR3
artificial
GGEITMVRGVIGYYYYGMDV





864
Flt3 VL-CDR1
artificial
RTSQSISSYLN





865
Flt3 VL-CDR2
artificial
AASSLQS





866
Flt3 VL-CDR3
artificial
LQHNSYPLT





867
Flt3 VH region
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKCLEWVAV





ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG





EITMVRGVIGYYYYGMDVWGQGTTVTVSS





868
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRTSQSISSYLNWYQQKPGKAPKLLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGC





GTKVDIK





869
second domain which
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKCLEWVAV



binds to FLT3

ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG



comprises a

EITMVRGVIGYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQ



polypeptide

SPSSLSASVGDRVTITCRTSQSISSYLNWYQQKPGKAPKLLIYAASSLQS





GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVDI





K





870
Antibody construct
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKCLEWVAV



binding to CD3 and

ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG



FLT3

EITMVRGVIGYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQ





SPSSLSASVGDRVTITCRTSQSISSYLNWYQQKPGKAPKLLIYAASSLQS





GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGCGTKVDI





KSGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGK





GLEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDT





AVYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTV





VTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGT





KFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGG





TKLTVL





871
Flt3 VH-CDR1
artificial
SYGMH





872
Flt3 VH-CDR2
artificial
VISYDGSNEFYADSVKG





873
Flt3 VH-CDR3
artificial
GGEITMVRGVIGYYYYGMDV





874
Flt3 VL-CDR1
artificial
RASQGVRNNLV





875
Flt3 VL-CDR2
artificial
GASTRAT





876
Flt3 VL-CDR3
artificial
LQHNSYPLT





877
Flt3 VH region
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKCLEWVAV





ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG





EITMVRGVIGYYYYGMDVWGQGTTVTVSS





878
Flt3 VL region
artificial
EIVMTQSPATLSVSPGERATLSCRASQGVRNNLVWYQQKPGQAPRLLIYG





ASTRATGIPARFSGSGSGTEFTLTISSLQSEDFATYYCLQHNSYPLTFGC





GTKVEIK





879
second domain which
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKCLEWVAV



binds to FLT3

ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG



comprises a

EITMVRGVIGYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSEIVMTQ



polypeptide

SPATLSVSPGERATLSCRASQGVRNNLVWYQQKPGQAPRLLIYGASTRAT





GIPARFSGSGSGTEFTLTISSLQSEDFATYYCLQHNSYPLTFGCGTKVEI





K





880
Antibody construct
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKCLEWVAV



binding to CD3 and

ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG



FLT3

EITMVRGVIGYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSEIVMTQ





SPATLSVSPGERATLSCRASQGVRNNLVWYQQKPGQAPRLLIYGASTRAT





GIPARFSGSGSGTEFTLTISSLQSEDFATYYCLQHNSYPLTFGCGTKVEI





KSGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGK





GLEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDT





AVYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTV





VTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGT





KFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGG





TKLTVL





881
Flt3 VH-CDR1
artificial
SYGMH





882
Flt3 VH-CDR2
artificial
VISYDGSNKYYADSVKG





883
Flt3 VH-CDR3
artificial
SYGMDV





884
Flt3 VL-CDR1
artificial
RASQGISSWLA





885
Flt3 VL-CDR2
artificial
AASSLQS





886
Flt3 VL-CDR3
artificial
QQANSFPWT





887
Flt3 VH region
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKCLEWVAV





ISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSY





GMDVWGQGTTVTVSS





888
Flt3 VL region
artificial
DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYA





ASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFPWTFGC





GTKLEIK





889
second domain which
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKCLEWVAV



binds to FLT3

ISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSY



comprises a

GMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSVSASVGDRVT



polypeptide

ITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTD





FTLTISSLQPEDFATYYCQQANSFPWTFGCGTKLEIK





890
Antibody construct
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKCLEWVAV



binding to CD3 and

ISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSY



FLT3

GMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSVSASVGDRVT





ITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTD





FTLTISSLQPEDFATYYCQQANSFPWTFGCGTKLEIKSGGGGSEVQLVES





GGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRSKYNN





YATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGNFGNS





YISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVSPGGT





VTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPARFSGS





LLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





891
Flt3 VH-CDR1
artificial
NVRMGVS





892
Flt3 VH-CDR2
artificial
HIFSNDEKLYTTSLKS





893
Flt3 VH-CDR3
artificial
IVGYGTGWYGYFDY





894
Flt3 VL-CDR1
artificial
RASQDIRDDLG





895
Flt3 VL-CDR2
artificial
ATSIRQS





896
Flt3 VL-CDR3
artificial
LQHHSFPLT





897
Flt3 VH region
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKALEWL





AHIFSNDEKLYTTSLKSRLTISKDTSKSQVVLTMTNMDPEDTATYYCARI





VGYGTGWYGYFDYWGQGTQVTVSS





898
Flt3 VL region
artificial
DIQMTQSPSSLSASIGDRVTITCRASQDIRDDLGWYQREPGKAPKRLIYA





TSIRQSGVPSRFSGSGSGTEFTLTISGLQPEDFATYFCLQHHSFPLTFGG





GTKVDIK





899
second domain which
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKLYTTSLKSRLTISKDTSKSQVVLTMTNMDPEDTATYYCARI



comprises a

VGYGTGWYGYFDYWGQGTQVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASIGDRVTITCRASQDIRDDLGWYQREPGKAPKRLIYATSIRQSGVPSR





FSGSGSGTEFTLTISGLQPEDFATYFCLQHHSFPLTFGGGTKVDIK





900
Antibody construct
artificial
QVTLKESGPVLVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKLYTTSLKSRLTISKDTSKSQVVLTMTNMDPEDTATYYCARI



FLT3

VGYGTGWYGYFDYWGQGTQVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASIGDRVTITCRASQDIRDDLGWYQREPGKAPKRLIYATSIRQSGVPSR





FSGSGSGTEFTLTISGLQPEDFATYFCLQHHSFPLTFGGGTKVDIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





901
Flt3 VH-CDR1
artificial
YARMGVS





902
Flt3 VH-CDR2
artificial
HISSNDEKSFSTALES





903
Flt3 VH-CDR3
artificial
MPGDSNTWRGFFDY





904
Flt3 VL-CDR1
artificial
RTSQTVTNSYIA





905
Flt3 VL-CDR2
artificial
GTSTRAT





906
Flt3 VL-CDR3
artificial
QKYGSSPLT





907
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTFSGFSLRYARMGVSWIRQPPGKALEWL





AHISSNDEKSFSTALESRLTISTDTSKSQMVLTMTNVDPVDTATYYCARM





PGDSNTWRGFFDYWGQGTLVTVSS





908
Flt3 VL region
artificial
EIVMTQSPGTLSLSPGERATLSCRTSQTVTNSYIAWYQQRPGQAPRLLIY





GTSTRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQKYGSSPLTFG





GGTKLEIK





909
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTFSGFSLRYARMGVSWIRQPPGKALEWL



binds to FLT3

AHISSNDEKSFSTALESRLTISTDTSKSQMVLTMTNVDPVDTATYYCARM



comprises a

PGDSNTWRGFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVMTQSPGTL



polypeptide

SLSPGERATLSCRTSQTVTNSYIAWYQQRPGQAPRLLIYGTSTRATGIPD





RFSGSGSGTDFTLTISRLEPEDFAVYYCQKYGSSPLTFGGGTKLEIK





910
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTFSGFSLRYARMGVSWIRQPPGKALEWL



binding to CD3 and

AHISSNDEKSFSTALESRLTISTDTSKSQMVLTMTNVDPVDTATYYCARM



FLT3

PGDSNTWRGFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVMTQSPGTL





SLSPGERATLSGRTSQTVTNSYIAWYQQRPGQAPRLLIYGTSTRATGIPD





RFSGSGSGTDFTLTISRLEPEDFAVYYCQKYGSSPLTFGGGTKLEIKSGG





GGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEW





VARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYY





CVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQE





PSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLA





PGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLT





VL





911
Flt3 VH-CDR1
artificial
NVRMGVS





912
Flt3 VH-CDR2
artificial
HISSNDEKSYSTSLRS





913
Flt3 VH-CDR3
artificial
MPGDSNTWRGFFDY





914
Flt3 VL-CDR1
artificial
RTSQSVNNNLA





915
Flt3 VL-CDR2
artificial
GASTRAT





916
Flt3 VL-CDR3
artificial
LQHNSYPLT





917
Flt3 VH region
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKALEWL





AHISSNDEKSYSTSLRSRLTISTDTSKSQVVLTMTNMDPVDTATYYCARM





PGDSNTWRGFFDYWGQGTLVTVSS





918
Flt3 VL region
artificial
EIVMTQSPATLSVSPGERATLSCRTSQSVNNNLAWYQQKPGQAPRLLIYG





ASTRATGIPARFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





919
second domain which
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKALEWL



binds to FLT3

AHISSNDEKSYSTSLRSRLTISTDTSKSQVVLTMTNMDPVDTATYYCARM



comprises a

PGDSNTWRGFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVMTQSPATL



polypeptide

SVSPGERATLSCRTSQSVNNNLAWYQQKPGQAPRLLIYGASTRATGIPAR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK





920
Antibody construct
artificial
QVTLKESGPTLVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKALEWL



binding to CD3 and

AHISSNDEKSYSTSLRSRLTISTDTSKSQVVLTMTNMDPVDTATYYCARM



FLT3

PGDSNTWRGFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVMTQSPATL





SVSPGERATLSCRTSQSVNNNLAWYQQKPGQAPRLLIYGASTRATGIPAR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





921
Flt3 VH-CDR1
artificial
NVRMGVS





922
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





923
Flt3 VH-CDR3
artificial
MPEYSSGWSGAFDI





924
Flt3 VL-CDR1
artificial
RASQDIRDDLG





925
Flt3 VL-CDR2
artificial
GASTLQS





926
Flt3 VL-CDR3
artificial
LQHNSYPLT





927
Flt3 VH region
artificial
QVTLKESGPMLVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM





PEYSSGWSGAFDIWGQGTMVTVSS





928
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQDIRDDLGWYQQKPGNAPKRLIYG





ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTRLEIK





929
second domain which
artificial
QVTLKESGPMLVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



comprises a

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL



polypeptide

SASVGDRVTITCRASQDIRDDLGWYQQKPGNAPKRLIYGASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTRLEIK





930
Antibody construct
artificial
QVTLKESGPMLVKPTETLTLTCTVSGFSLRNVRMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTLTNMDPVDTATYFCARM



FLT3

PEYSSGWSGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSL





SASVGDRVTITCRASQDIRDDLGWYQQKPGNAPKRLIYGASTLQSGVPSR





FSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTRLEIKSGGG





GSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWV





ARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYC





VRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEP





SLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAP





GTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTV





L





931
Flt3 VH-CDR1
artificial
NARMGVS





932
Flt3 VH-CDR2
artificial
HIFSNDEKSYSTSLKS





933
Flt3 VH-CDR3
artificial
MVGYGSGWYAYFDY





934
Flt3 VL-CDR1
artificial
RSSQSLLHSNGYNYLY





935
Flt3 VL-CDR2
artificial
EVSNRFS





936
Flt3 VL-CDR3
artificial
MQALQTPLT





937
Flt3 VH region
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL





AHIFSNDEKSYSTSLKSRLTISKDTSKRQVVLTMTNMDPVDTATYYCARM





VGYGSGWYAYFDYWGQGTLVTVSS





938
Flt3 VL region
artificial
DIVMTQTPLSLSVTPGQPASISCRSSQSLLHSNGYNYLYWYLQKPGQPPQ





LLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP





LTFGGGTKVEIK





939
second domain which
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL



binds to FLT3

AHIFSNDEKSYSTSLKSRLTISKDTSKRQVVLTMTNMDPVDTATYYCARM



comprises a

VGYGSGWYAYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIVMTQTPLSL



polypeptide

SVTPGQPASISCRSSQSLLHSNGYNYLYWYLQKPGQPPQLLIYEVSNRFS





GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTPLTFGGGTKVEI





K





940
Antibody construct
artificial
QVTLKESGPALVKPTQTLTLTCTFSGFSLSNARMGVSWIRQPPGKALEWL



binding to CD3 and

AHIFSNDEKSYSTSLKSRLTISKDTSKRQVVLTMTNMDPVDTATYYCARM



FLT3

VGYGSGWYAYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIVMTQTPLSL





SVTPGQPASISCRSSQSLLHSNGYNYLYWYLQKPGQPPQLLIYEVSNRFS





GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTPLTFGGGTKVEI





KSGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGK





GLEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDT





AVYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTV





VTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGT





KFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGG





TKLTVL





941
Flt3 VH-CDR1
artificial
SYGMH





942
Flt3 VH-CDR2
artificial
VISYDGSNEFYADSVKG





943
Flt3 VH-CDR3
artificial
GGEITMVRGVIGYYYYGMDV





944
Flt3 VL-CDR1
artificial
RASQSISSYLN





945
Flt3 VL-CDR2
artificial
AASSLQS





946
Flt3 VL-CDR3
artificial
LQHNSYPLT





947
Flt3 VH region
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAV





ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG





EITMVRGVIGYYYYGMDVWGQGTTVTVSS





948
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVEIK





949
second domain which
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAV



binds to FLT3

ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG



comprises a

EITMVRGVIGYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQ



polypeptide

SPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQS





GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEI





K





950
Antibody construct
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAV



binding to CD3 and

ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG



FLT3

EITMVRGVIGYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQ





SPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQS





GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEI





KSGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGK





GLEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDT





AVYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTV





VTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGT





KFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGG





TKLTVL





951
Flt3 VH-CDR1
artificial
SYGMH





952
Flt3 VH-CDR2
artificial
VISYDGSNEFYADSVKG





953
Flt3 VH-CDR3
artificial
GGEITMVRGVIGYYYYGMDV





954
Flt3 VL-CDR1
artificial
RASQGVRNNLV





955
Flt3 VL-CDR2
artificial
GASTRAT





956
Flt3 VL-CDR3
artificial
LQHNSYPLT





957
Flt3 VH region
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAV





ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG





EITMVRGVIGYYYYGMDVWGQGTTVTVSS





958
Flt3 VL region
artificial
EIVMTQSPATLSVSPGERATLSCRASQGVRNNLVWYQQKPGQAPRLLIYG





ASTRATGIPARFSGSGSGTEFTLTISSLQSEDFATYYCLQHNSYPLTFGG





GTKVEIK





959
second domain which
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAV



binds to FLT3

ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG



comprises a

EITMVRGVIGYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSEIVMTQ



polypeptide

SPATLSVSPGERATLSCRASQGVRNNLVWYQQKPGQAPRLLIYGASTRAT





GIPARFSGSGSGTEFTLTISSLQSEDFATYYCLQHNSYPLTFGGGTKVEI





K





960
Antibody construct
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAV



binding to CD3 and

ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG



FLT3

EITMVRGVIGYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSEIVMTQ





SPATLSVSPGERATLSCRASQGVRNNLVWYQQKPGQAPRLLIYGASTRAT





GIPARFSGSGSGTEFTLTISSLQSEDFATYYCLQHNSYPLTFGGGTKVEI





KSGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGK





GLEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDT





AVYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTV





VTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGT





KFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGG





TKLTVL





961
Flt3 VH-CDR1
artificial
SYGMH





962
Flt3 VH-CDR2
artificial
VISYDGSNEFYADSVKG





963
Flt3 VH-CDR3
artificial
GGEITMVRGVIGYYYYGMDV





964
Flt3 VL-CDR1
artificial
RTSQSISSYLN





965
Flt3 VL-CDR2
artificial
AASSLQS





966
Flt3 VL-CDR3
artificial
LQHNSYPLT





967
Flt3 VH region
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAV





ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG





EITMVRGVIGYYYYGMDVWGQGTTVTVSS





968
Flt3 VL region
artificial
DIQMTQSPSSLSASVGDRVTITCRTSQSISSYLNWYQQKPGKAPKLLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVDIK





969
second domain which
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAV



binds to FLT3

ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG



comprises a

EITMVRGVIGYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQ



polypeptide

SPSSLSASVGDRVTITCRTSQSISSYLNWYQQKPGKAPKLLIYAASSLQS





GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVDI





K





970
Antibody construct
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAV



binding to CD3 and

ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG



FLT3

EITMVRGVIGYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQ





SPSSLSASVGDRVTITCRTSQSISSYLNWYQQKPGKAPKLLIYAASSLQS





GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVDI





KSGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGK





GLEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDT





AVYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTV





VTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGT





KFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGG





TKLTVL





971
Flt3 VH-CDR1
artificial
SYGMH





972
Flt3 VH-CDR2
artificial
VISYDGSNEFYADSVKG





973
Flt3 VH-CDR3
artificial
GGEITMVRGVIGYYYYGMDV





974
Flt3 VL-CDR1
artificial
RASQSISSYLN





975
Flt3 VL-CDR2
artificial
AASSLQS





976
Flt3 VL-CDR3
artificial
LQHNSYPLT





977
Flt3 VH region
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAV





ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG





EITMVRGVIGYYYYGMDVWGQGTTVTVSS





978
Flt3 VL region
artificial
DIQMTQSPSSLSASVGNRVTITCRASQSISSYLNWYQQKPGKAPKLLIYA





ASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGG





GTKVDIK





979
second domain which
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAV



binds to FLT3

ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG



comprises a

EITMVRGVIGYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQ



polypeptide

SPSSLSASVGNRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQS





GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVDI





K





980
Antibody construct
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAV



binding to CD3 and

ISYDGSNEFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGG



FLT3

EITMVRGVIGYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQ





SPSSLSASVGNRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQS





GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVDI





KSGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGK





GLEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDT





AVYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTV





VTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGT





KFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGG





TKLTVL





981
Flt3 VH-CDR1
artificial
SYGMH





982
Flt3 VH-CDR2
artificial
VISYDGSNKYYADSVKG





983
Flt3 VH-CDR3
artificial
SYGMDV





984
Flt3 VL-CDR1
artificial
RASQGISSWLA





985
Flt3 VL-CDR2
artificial
AASSLQS





986
Flt3 VL-CDR3
artificial
QQANSFPWT





987
Flt3 VH region
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAV





ISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSY





GMDVWGQGTTVTVSS





988
Flt3 VL region
artificial
DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYA





ASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFPWTFGQ





GTKLEIK





989
scFv
artificial
qvqlvesgggvvqpgrslrlscaasgftfssygmhwvrqapgkglewvav





isydgsnkyyadsvkgrftisrdnskntlylqmnslraedtavyycarsy





gmdvwgqgttvtvssggggsggggsggggsdiqmtqspssvsasvgdrvt





itcrasqgisswlawyqqkpgkapklliyaasslqsgvpsrfsgsgsgtd





ftltisslqpedfatyycqqansfpwtfgqgtkleik





990
bispecific
artificial
qvqlvesgggvvqpgrslrlscaasgftfssygmhwvrqapgkglewvav



molecule

isydgsnkyyadsvkgrftisrdnskntlylqmnslraedtavyycarsy





gmdvwgqgttvtvssggggsggggsggggsdiqmtqspssvsasvgdrvt





itcrasqgisswlawyqqkpgkapklliyaasslqsgvpsrfsgsgsgtd





ftltisslqpedfatyycqqansfpwtfgqgtkleiksggggsevqlves





ggglvqpggslklscaasgftfnkyamnwvrqapgkglewvarirskynn





yatyyadsvkdrftisrddskntaylqmnnlktedtavyycvrhgnfgns





yisywaywgqgtlvtvssggggsggggsggggsqtvvtqepsltvspggt





vtitcgsstgavtsgnypnwvqqkpgqaprgliggtkflapgtparfsgs





llggkaaltlsgvqpedeaeyycvlwysnrwvfgggtkltvl





991
hu lsp V5xFlt3
artificial
NQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGCALRPQSSGTVY



E1muxEpC-pEF DHFR

EA





992
FLT3
human
MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKS





SSYPMVSESPEDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGN





ISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEAT





NYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVPEPIVEWVLCD





SQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRECTRLFTIDLN





QTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM





STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFI





NATNSSEDYEIDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNG





YSISKFCNHKHQPGEYIFHAENDDAQFTKMFTLNIRRKPQVLAEASASQA





SCFSDGYPLPSWTWKKCSDKSPNCTEEITEGVWNRKANRKVFGQWVSSST





LNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQDNISFYATIGV





CLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD





LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKA





DSSEREALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLL





NYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSD





QISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGME





FLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDSNYVVRGNARL





PVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK





LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADA





EEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS





993
PSMA-UniProt
human
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEAT



entry Q04609

NITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQW





KEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPG





YENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKI





VIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPG





GGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYY





DAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTN





EVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVR





SFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYI





NADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKK





SPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYP





LYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDY





AVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERL





QDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKY





AGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA





994
PM 76-B10.17 CC VH
artificial
DYYMY



CDR1







995
PM 76-B10.17 CC VH
artificial
IISDAGYYTYYSDIIKG



CDR2







996
PM 76-B10.17 CC VH
artificial
GFPLLRHGAMDY



CDR3







997
PM 76-B10.17 CC VL
artificial
KASQNVDANVA



CDR1







998
PM 76-B10.17 CC VL
artificial
SASYVYW



CDR2







999
PM 76-B10.17 CC VL
artificial
QQYDQQLIT



CDR3







1000
PM 76-B10.17 CC VH
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI





ISDAGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF





PLLRHGAMDYWGQGTLVTVSS





1001
PM 76-B10.17 CC VL
artificial
DIQMTQSPSSLSASVGDRVTITCKASQNVDANVAWYQQKPGQAPKSLIYS





ASYVYWDVPSRFSGSASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGC





GTKLEIK





1002
PM 76-B10.17 CC
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



SCEV

ISDAGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF





PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS





VGDRVTITCKASQNVDANVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGCGTKLEIK





1003
PM 76-B10.17 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



I2C0 bispecific

ISDAGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



molecule

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS





VGDRVTITCKASQNVDANVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGCGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1004
PM 76-B10.17 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



I2C0 scFc

ISDAGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



bispecific

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



HLE molecule

VGDRVTITCKASQNVDANVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGCGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGG





GGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH





EDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKE





YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL





VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ





QGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSG





GGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC





VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQ





DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN





QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT





VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1005
PM 76-B10.17 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



I2C0-scFc_delGK

ISDAGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



bispecific

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



HLE molecule

VGDRVTITCKASQNVDANVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGCGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGG





GGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH





EDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKE





YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL





VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ





QGNVFSCSVMHEALHNHYTQKSLSLSPGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK








1006
PM 76-B10.17 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



I2C0 CC (103/43)-

ISDAGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



scFc bispecific

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



molecule

VGDRVTITCKASQNVDANVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGCGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYCGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQCPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1007
PM 76-B10.17 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



I2C0 CC (103/43)-

ISDAGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



SCFC bispecific

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



HLE molecule

VGDRVTITCKASQNVDANVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGCGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYCGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQCPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGG





GGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH





EDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKE





YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL





VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ





QGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSG





GGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC





VWDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQ





DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN





QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT





VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1008
PM 76-B10.17 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



I2C0 CC (103/43)-

ISDAGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



scFc delGK

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



bispecific

VGDRVTITCKASQNVDANVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG



HLE molecule

SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGCGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYCGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQCPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGG





GGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH





EDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKE





YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL





VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ





QGNVFSCSVMHEALHNHYTQKSLSLSPGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1009
PM 76-B10.11 CC VH
artificial
DYYMY



CDR1







1010
PM 76-B10.11 CC VH
artificial
IISDGGYYTYYSDIIKG



CDR2







1011
PM 76-B10.11 CC VH
artificial
GFPLLRHGAMDY



CDR3







1012
PM 76-B10.11 CC VL
artificial
KASQNVDTNVA



CDR1







1013
PM 76-B10.11 CC VL
artificial
SASYVYW



CDR2







1014
PM 76-B10.11 CC VL
artificial
QQYDQQLIT



CDR3







1015
PM 76-B10.11 CC VH
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKGLEWVAI





ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGE





PLLRHGAMDYWGQGTLVTVSS





1016
PM 76-B10.11 CC VL
artificial
DIQMTQSPSSLSASVGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYS





ASYVYWDVPSRFSGSASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGG





GTKLEIK





1017
PM 76-B10.11 CC
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKGLEWVAI



scFv

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF





PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS





VGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGGGTKLEIK





1018
PM 76-B10.11 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKGLEWVAI



I2C0 bispecific

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



molecule

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS





VGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGGGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1019
PM 76-B10.11 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKGLEWVAI



I2C0-scFc

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



bispecific

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



HLE molecule

VGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGGGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGG





GGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH





EDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKE





YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL





VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ





QGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSG





GGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC





VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQ





DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN





QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT





VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1020
PM 76-B10.11 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKGLEWVAI



I2C0-scFc_delGK

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



bispecific

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



HLE molecule

VGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGGGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGG





GGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH





EDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKE





YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL





VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ





QGNVFSCSVMHEALHNHYTQKSLSLSPGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1021
PM 76-B10.11 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKGLEWVAI



I2C0 CC (103/43)-

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



scFc bispecific

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



molecule

VGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGGGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYCGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQCPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1022
PM 76-B10.11 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKGLEWVAI



I2C0 CC (103/43)-

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



scFc bispecific

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



HLE molecule

VGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGGGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYCGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQCPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGG





GGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH





EDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKE





YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL





VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ





QGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSG





GGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC





VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQ





DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN





QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT





VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1023
PM 76-B10.11 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKGLEWVAI



I2C0 CC (103/43)-

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



scFc delGK

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



bispecific

VGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG



HLE molecule

SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGGGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYCGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQCPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGG





GGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH





EDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKE





YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL





VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ





QGNVFSCSVMHEALHNHYTQKSLSLSPGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1024
PM 76-B10.11 CC x
artificial
DYYMY



I2C0-scFc VH CDR1







1025
PM 76-B10.11 CC x
artificial
IISDGGYYTYYSDIIKG



I2C0-scFc VH CDR2







1026
PM 76-B10.11 CC x
artificial
GFPLLRHGAMDY



I2C0 scFc VH CDR3







1027
PM 76-B10.11 CC x
artificial
KASQNVDTNVA



I2C0-scFc VL CDR1







1028
PM 76-B10.11 CC x
artificial
SASYVYW



I2C0-scFc VL CDR2







1029
PM 76-B10.11 CC x
artificial
QQYDQQLIT



I2C0-scFc VL CDR3







1030
PM 76-B10.11 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



I2C0-scFc VH

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF





PLLRHGAMDYWGQGTLVTVSS





1031
PM 76-B10.11 CC x
artificial
DIQMTQSPSSLSASVGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYS



I2C0-scFc VL

ASYVYWDVPSRFSGSASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGC





GTKLEIK





1032
PM 76-B10.11 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



I2C0-scFc scFv

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF





PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS





VGDRVTITCKASQNVDTNVAWYOQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGCGTKLEIK





1033
PM 76-B10.11 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



I2C0-scFc

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



bispecific molecule

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS





VGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGCGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1034
PM 76-B10.11 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



I2C0-scFc

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



bispecific

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



HLE molecule

VGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGCGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGG





GGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH





EDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKE





YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL





VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ





QGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSG





GGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC





VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQ





DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN





QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT





VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1035
PM 76-B10.11 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



I2C0-scFc_delGK

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGE



bispecific

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



HLE molecule

VGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGCGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGG





GGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH





EDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKE





YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL





VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ





QGNVFSCSVMHEALHNHYTQKSLSLSPGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1036
PM 76-B10.11 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



I2C0 CC (103/43)-

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



scFc bispecific

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



molecule

VGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGCGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYCGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQCPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1037
PM 76-B10.11 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



I2C0 CC (103/43)-

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



SCFC bispecific

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



HLE molecule

VGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG





SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGCGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYCGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQCPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGG





GGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH





EDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKE





YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL





VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ





QGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSG





GGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC





VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQ





DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN





QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT





VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1038
PM 76-B10.11 CC x
artificial
QVQLVESGGGLVKPGESLRLSCAASGFTFSDYYMYWVRQAPGKCLEWVAI



I2C0 CC (103/43)-

ISDGGYYTYYSDIIKGRFTISRDNAKNSLYLQMNSLKAEDTAVYYCARGF



ScFc_delGK

PLLRHGAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS



bispecific

VGDRVTITCKASQNVDTNVAWYQQKPGQAPKSLIYSASYVYWDVPSRFSG



HLE molecule

SASGTDFTLTISSVQSEDFATYYCQQYDQQLITFGCGTKLEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYCGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQCPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGG





GGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH





EDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKE





YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL





VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ





QGNVFSCSVMHEALHNHYTQKSLSLSPGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1039
DLL3
human
MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC





SARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPD





LPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRR





RLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRC





GPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTV





PVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTC





PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNC





EKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRAC





ANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSG





LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL





VAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHALPDALNNLRTQ





EGSGDGPSSSVDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRA





GQRQHLLFPYPSSILSVK





1040
DLL3 CDR-H1
artificial
SYYWS





1041
DLL3 CDR-H2
artificial
YVYYSGTTNYNPSLKS





1042
DLL3 CDR-H3
artificial
IAVTGFYFDY





1043
DLL3 CDR-L1
artificial
RASQRVNNNYLA





1044
DLL3 CDR-L2
artificial
GASSRAT





1045
DLL3 CDR-L3
artificial
QQYDRSPLT





1046
DLL3 CDR-H1
artificial
SYYWS





1047
DLLS CDR-H2
artificial
YIYYSGRTNYYPSLKS





1048
DLL3 CDR-H3
artificial
IAVAGFFFDY





1049
DLL3 CDR-L1
artificial
RASQSVNKNYLA





1050
DLL3 CDR-L2
artificial
GASSRAT





1051
DLL3 CDR-L3
artificial
QQYDRSPLT





1052
DLL3 CDR-H1
artificial
SFYWS





1053
DLL3 CDR-H2
artificial
YIYYSGTTNYNPSLKS





1054
DLL3 CDR-H3
artificial
IAVAGFFFDY





1055
DLL3 CDR-L1
artificial
RASQSVNKNYLA





1056
DLL3 CDR-L2
artificial
GASSRAT





1057
DLL3 CDR-L3
artificial
QQYDRSPLT





1058
DLL3 CDR-H1
artificial
SFYWS





1059
DLL3 CDR-H2
artificial
YIYYSGTTNYNPSLKS





1060
DLL3 CDR-H3
artificial
IAVAGFFFDY





1061
DLL3 CDR-L1
artificial
RASQSVNKNYLA





1062
DLL3 CDR-L2
artificial
GASSRAT





1063
DLL3 CDR-L3
artificial
QQYDRSPLT





1064
DLL3 CDR-H1
artificial
SFYWS





1065
DLL3 CDR-H2
artificial
YIYYSGTTNYNPSLKS





1066
DLL3 CDR-H3
artificial
IAVAGFFFDY





1067
DLL3 CDR-L1
artificial
RASQSVNKNYLA





1068
DLL3 CDR-L2
artificial
GASSRAT





1069
DLL3 CDR-L3
artificial
QQYDRSPLT





1070
DLL3 CDR-H1
artificial
SFYWS





1071
DLL3 CDR-H2
artificial
YIYYSGTTNYNPSLKS





1072
DLL3 CDR-H3
artificial
IAVAGFFFDY





1073
DLL3 CDR-L1
artificial
RASQSVNKNYLA





1074
DLL3 CDR-L2
artificial
GASSRAT





1075
DLL3 CDR-L3
artificial
QQYDRSPLT





1076
DLL3 CDR-H1
artificial
SYYWS





1077
DLL3 CDR-H2
artificial
YIFYNGITNYNPSLKS





1078
DLL3 CDR-H3
artificial
IHSGSFSFDY





1079
DLL3 CDR-L1
artificial
RASQSVSRGYLA





1080
DLL3 CDR-L2
artificial
GASSRAT





1081
DLL3 CDR-L3
artificial
QQYDTSPIT





1082
DLL3 CDR-H1
artificial
NAGMS





1083
DLL3 CDR-H2
artificial
RIKNKIDGGTTDFAAPVKG





1084
DLL3 CDR-H3
artificial
RGWYGDYFDY





1085
DLL3 CDR-L1
artificial
RSSQSLLHSNGYNYLD





1086
DLL3 CDR-L2
artificial
LGSNRAS





1087
DLL3 CDR-L3
artificial
MQALQTPFT





1088
DLL3 CDR-H1
artificial
SYDIH





1089
DLL3 CDR-H2
artificial
VISSHGSNKNYARSVKG





1090
DLL3 CDR-H3
artificial
DGYSGNDPFYYYYHGMDV





1091
DLL3 CDR-L1
artificial
RASQSISSYLN





1092
DLL3 CDR-L2
artificial
AASSLQS





1093
DLL3 CDR-L3
artificial
QQSFTTPLT





1094
DLL VH region
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGY





VYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCASIAV





TGFYFDYWGQGTLVTVSS





1095
DLL VH region
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGY





IYYSGRTNYYPSLKSRVTISIDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSS





1096
DLL VH region
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSS





1097
DLL VH region
artificial
QVQLQESGPGLVKPSQTLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSS





1098
DLL VH region
artificial
QVQLQEWGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQLSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSK





1099
DLL VH region
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSS





1100
DLL VH region
artificial
QVQLQESGPGLVKPSQTLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGY





IFYNGITNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAKYYCARIHS





GSFSFDYWDQGTLVTVSS





1101
DLL VH region
artificial
EVQLVESGGGLVKPGGSLRLSCAASGFIFNNAGMSWVRQAPGKGLEWVGR





IKNKIDGGTTDFAAPVKGRFTISRDDSKNTLYLQMNSLKAEDTAVYYCTA





RGWYGDYFDYWGQGTLVTVSS





1102
DLL VH region
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFSFSSYDIHWVRQAPGKGLEWVAV





ISSHGSNKNYARSVKGRFTISRDNSKNTLYLQMNSLKAEDTAVYYCARDG





YSGNDPFYYYYHGMDVWGQGTTVTVSS





1103
DLL VH region
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKCLEWIGY





VYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCASIAV





TGFYFDYWGQGTLVTVSS529





1104
DLL VH region
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKCLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSS





1105
DLL VL REGION
artificial
EIVLTQSPGTLSLSPGERVTLSCRASQRVNNNYLAWYQQRPGQAPRLLIY





GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFG





GGTKLEIK





1106
DLL VL REGION
artificial
EIVLTQSPGTLSLSPGERATLSCRASQSVNKNYLAWYQQKPGQAPRLLIY





GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFG





GGTKLEIK





1107
DLL VL REGION
artificial
EIVLTQSPGTLSLSPGERATLSCRASQSVNKNYLAWYQQKPGQAPRLLIY





GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFG





GGTKVEIK





1108
DLL VL REGION
artificial
EIVLTQSPGTLSLSPGERATLSCRASQSVNKNYLAWYQQKPGQAPRLLIY





GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFG





GGTKVEIK





1109
DLL VL REGION
artificial
EIVLTQSPGTLSLSPGERATLSCRASQSVNKNYLAWYQQKPGQAPRLLIY





GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFG





GGTKVDIK88





1110
DLL VL REGION
artificial
EIVLTQSPGTLSLSPGESATLSCRASQSVNKNYLAWYQQKPGQAPRLLIY





GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFG





GGTRLEIK





1111
DLL VL REGION
artificial
EIVMTQSPGTLSLSPGERATLSCRASQSVSRGYLAWYQQKPGQAPRLLIY





GASSRATDIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYDTSPITFG





QGTKVEIK





1112
DLL VL REGION
artificial
DIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQ





LLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGIYYCMQALQTP





FTFGPGTKVEIK





1113
DLL VL REGION
artificial
DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYA





ASSLQSGVPSRFSGSGSGTDFSLTISSLQPEDFATYYCQQSFTTPLTFGG





GTKVEIK





1114
DLL VL REGION
artificial
EIVLTQSPGTLSLSPGERVTLSCRASQRVNNNYLAWYQQRPGQAPRLLIY





GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFG





CGTKLEIK





1115
DLL VL REGION
artificial
EIVLTQSPGTLSLSPGERATLSCRASQSVNKNYLAWYQQKPGQAPRLLIY





GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFG





CGTKVEIK





1116
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGY





VYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCASIAV





TGFYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RVTLSCRASQRVNNNYLAWYQQRPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKLEIK





1117
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGY





IYYSGRTNYYPSLKSRVTISIDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKLEIK59





1118
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKVEIK





1119
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSQTLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYOQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKVEIK





1120
DLL BINDING DOMAIN
artificial
QVQLQEWGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQLSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKVDIK





1121
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





SATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTRLEIK





1122
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSQTLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGY





IFYNGITNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAKYYCARIHS





GSFSFDYWDQGTLVTVSSGGGGSGGGGSGGGGSEIVMTQSPGTLSLSPGE





RATLSCRASQSVSRGYLAWYQQKPGQAPRLLIYGASSRATDIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDTSPITFGQGTKVEIK





1123
DLL BINDING DOMAIN
artificial
EVQLVESGGGLVKPGGSLRLSCAASGFIFNNAGMSWVRQAPGKGLEWVGR





IKNKIDGGTTDFAAPVKGRFTISRDDSKNTLYLQMNSLKAEDTAVYYCTA





RGWYGDYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIVMTQTPLSLPVT





PGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVP





DRFSGSGSGTDFTLKISRVEAEDVGIYYCMQALQTPFTFGPGTKVEIK





1124
DLL BINDING DOMAIN
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFSFSSYDIHWVRQAPGKGLEWVAV





ISSHGSNKNYARSVKGRFTISRDNSKNTLYLQMNSLKAEDTAVYYCARDG





YSGNDPFYYYYHGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSP





SSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGV





PSRFSGSGSGTDFSLTISSLQPEDFATYYCQQSFTTPLTFGGGTKVEIK





1125
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKCLEWIGY





VYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCASIAV





TGFYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RVTLSCRASQRVNNNYLAWYQQRPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGCGTKLEIK





1126
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKCLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGCGTKVEIK





1127
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGY





VYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCASIAV





TGFYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RVTLSCRASQRVNNNYLAWYQQRPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKLEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1128
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGY





IYYSGRTNYYPSLKSRVTISIDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKLEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1129
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKVEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1130
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSQTLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKVEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1131
DLL BINDING DOMAIN
artificial
QVQLQEWGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQLSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKVDIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1132
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





SATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTRLEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1133
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSQTLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGY





IFYNGITNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAKYYCARIHS





GSFSFDYWDQGTLVTVSSGGGGSGGGGSGGGGSEIVMTQSPGTLSLSPGE





RATLSCRASQSVSRGYLAWYQQKPGQAPRLLIYGASSRATDIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDTSPITFGQGTKVEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1134
DLL BINDING DOMAIN
artificial
EVQLVESGGGLVKPGGSLRLSCAASGFIFNNAGMSWVRQAPGKGLEWVGR





IKNKIDGGTTDFAAPVKGRFTISRDDSKNTLYLQMNSLKAEDTAVYYCTA





RGWYGDYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIVMTQTPLSLPVT





PGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVP





DRFSGSGSGTDFTLKISRVEAEDVGIYYCMQALQTPFTFGPGTKVEIKSG





GGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLE





WVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVY





YCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQ





EPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFL





APGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKL





TVL





1135
DLL BINDING DOMAIN
artificial
QVQLVESGGGVVQPGRSLRLSCAASGFSFSSYDIHWVRQAPGKGLEWVAV





ISSHGSNKNYARSVKGRFTISRDNSKNTLYLQMNSLKAEDTAVYYCARDG





YSGNDPFYYYYHGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSP





SSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGV





PSRFSGSGSGTDFSLTISSLQPEDFATYYCQQSFTTPLTFGGGTKVEIKS





GGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGL





EWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAV





YYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVT





QEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKF





LAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTK





LTVL





1136
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGY





VYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCASIAV





TGFYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RVTLSCRASQRVNNNYLAWYQQRPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKLEIKSGGGGSEVQ





LVESGGGLVQPGGSLRLSCAASGFTFNSYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCVRHGN





FGNSYVSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1137
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGY





IYYSGRTNYYPSLKSRVTISIDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKLEIKSGGGGSEVQ





LVESGGGLVQPGGSLRLSCAASGFTFNSYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCVRHGN





FGNSYVSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1138
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKVEIKSGGGGSEVQ





LVESGGGLVQPGGSLRLSCAASGFTFNSYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCVRHGN





FGNSYVSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1139
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSQTLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKVEIKSGGGGSEVQ





LVESGGGLVQPGGSLRLSCAASGFTFNSYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCVRHGN





FGNSYVSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1140
DLL BINDING DOMAIN
artificial
QVQLQEWGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQLSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKVDIKSGGGGSEVQ





LVESGGGLVQPGGSLRLSCAASGFTFNSYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCVRHGN





FGNSYVSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1141
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





SATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTRLEIKSGGGGSEVQ





LVESGGGLVQPGGSLRLSCAASGFTFNSYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCVRHGN





FGNSYVSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1142
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSQTLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGY





IFYNGITNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAKYYCARIHS





GSFSFDYWDQGTLVTVSSGGGGSGGGGSGGGGSEIVMTQSPGTLSLSPGE





RATLSCRASQSVSRGYLAWYQQKPGQAPRLLIYGASSRATDIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDTSPITFGQGTKVEIKSGGGGSEVQ





LVESGGGLVQPGGSLRLSCAASGFTFNSYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCVRHGN





FGNSYVSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1143
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKCLEWIGY





VYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCASIAV





TGFYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RVTLSCRASQRVNNNYLAWYQQRPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGCGTKLEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1144
DLL BINDING DOMAIN
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKCLEWIGY





IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV





AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGCGTKVEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVL





1145
DLL EPITOPE REGION
artificial
RVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCE





1146
DLL3 CDR-H1
artificial
SYYMH





1147
DLL3 CDR-H2
artificial
IINPSDGSTNYAQNFQG





1148
DLL3 CDR-H3
artificial
GGNSAFYSYYDMDV





1149
DLL3 CDR-L1
artificial
RSSQSLVYRDGNTYLS













1150
DLL3 CDR-L2
artificial
KVSNWQS





1151
DLL3 CDR-L3
artificial
MQGTHWPPT





1152
DLL3 CDR-H1
artificial
NYYMH





1153
DLL3 CDR-H2
artificial
IINPSDGSTSYAQKFQG





1154
DLL3 CDR-H3
artificial
GGNSAFYSYYDMDV





1155
DLL3 CDR-L1
artificial
RSSQSLVYRDGNTYLS





1156
DLL3 CDR-L2
artificial
KVSNWQS





1157
DLL3 CDR-L3
artificial
MQGTHWPPT





1158
DLL3 CDR-H1
artificial
GYYIH





1159
DLL3 CDR-H2
artificial
IINPSDGSTSYGQNFQG





1160
DLL3 CDR-H3
artificial
GGNSAFYSYYDMDV





1161
DLL3 CDR-L1
artificial
RSSQSLAYRDGNTYLS





1162
DLL3 CDR-L2
artificial
KVSNWQS





1163
DLL3 CDR-L3
artificial
MQGTHWPPT





1164
DLL3 CDR-H1
artificial
GHYMH





1165
DLL3 CDR-H2
artificial
IINPSDGSTNYAQKFQG





1166
DLL3 CDR-H3
artificial
GTTWHYSYYDMDV





1167
DLL3 CDR-L1
artificial
RSSQSLVYRDGNTYLT





1168
DLL3 CDR-L2
artificial
KVSNWQS













1169
DLL3 CDR-L3
artificial
MQGTHWPPT





1170
DLL3 CDR-H1
artificial
NYFMH





1171
DLL3 CDR-H2
artificial
IINPSDGSTSYAQNFQG





1172
DLL3 CDR-H3
artificial
GGNSAFYSYYDMDV





1173
DLL3 CDR-L1
artificial
RSSQSLVYRDGNTYLS





1174
DLL3 CDR-L2
artificial
RVSNWQS





1175
DLL3 CDR-L3
artificial
MQGTYWPPT





1176
DLL3 CDR-H2
artificial
IINPSEGSTSYAQKFQG





1177
DLL3 CDR-H2
artificial
IINPSDASTSYAQKFQG





1178
DLL CDR-L1
artificial
RSSQSLVYREGNTYLS





1179
DLL CDR-L1
artificial
RSSQSLVYRDANTYLS





1180
DLL CDR-L1
artificial
RSSQSLVYRDGQTYLS





1181
DLL CDR-L1
artificial
RSSQSLVYRDGNAYLS





1182
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGI





INPSDGSTNYAQNFQGRVTMTRDTSTNTVYMELSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVSS





1183
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI





INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVSS





1184
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYIHWVRQAPGQGLEWMGI





INPSDGSTSYGQNFQGRVTMTRDTSTNTVYMELSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVSS





1185
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGHYMHWVRQAPGQGLEWMGI





INPSDGSTNYAQKFQGRVTMTRDTSTSTVYMELRSLRSEDTAVYYCTRGT





TVVHYSYYDMDVWGQGTTVTVSS





1186
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYFMHWVRQAPGLGLEWMGI





INPSDGSTSYAQNFQGRVTMTRDTSTNTVYMELSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVSS





1187
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGI





INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVSS





1188
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI





INPSEGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVSS





1189
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI





INPSDASTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVSS





1190
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGI





INPSEGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVSS





1191
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGI





INPSDASTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVS





1192
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI





INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVSS





1193
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQCLEWMGI





INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVSS





1194
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI





INPSEGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVSS





1195
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI





INPSDASTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVSS





1196
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQCLEWMGI





INPSEGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVSS





1197
DLL3 VH REGION
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQCLEWMGI





INPSDASTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG





NSAFYSYYDMDVWGQGTTVTVSS





1198
DLL3 VL REGION
artificial
DVVMTQSPLSLPVTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCMQGTHWP





PTFGQGTKVEIK





1199
DLL3 VL REGION
artificial
DVVMTQTPLSLPVTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGQGTKVEIK





1200
DLL3 VL REGION
artificial
DVVMTQSPLSLPVTLGQPASISCRSSQSLAYRDGNTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCMQGTHWP





PTFGQGTKVEIK





1201
DLL3 VL REGION
artificial
DVVMTQTPLSLPVTLGQPASISCRSSQSLVYRDGNTYLTWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGGGTKVEIK





1202
DLL3 VL REGION
artificial
DVVMTQSPLSLPVTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPR





RLIYRVSNWQSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCMQGTYWP





PTFGQGTKVDIK





1203
DLL3 VL REGION
artificial
DVVMTQTPLSLPVTLGQPASISCRSSQSLVYREGNTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGQGTKVEIK





1204
DLL3 VL REGION
artificial
DWMTQTPLSLPVTLGQPASISCRSSQSLVYRDANTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGQGTKVEIK





1205
DLL3 VL REGION
artificial
DWMTQTPLSLPVTLGQPASISCRSSQSLVYRDGQTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGQGTKVEIK





1206
DLL3 VL REGION
artificial
DVVMTQTPLSLPVTLGQPASISCRSSQSLVYRDGNAYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGQGTKVEIK





1207
DLL3 VL REGION
artificial
DWMTQTPLSLPVTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGQGTKVEIK





1208
DLL3 VL REGION
artificial
DVVMTQTPLSLPVTLGQPASISCRSSQSLVYREGNTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGQGTKVEIK





1209
DLL3 VL REGION
artificial
DWMTQTPLSLPVTLGQPASISCRSSQSLVYRDANTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGQGTKVEIK





1210
DLL3 VL REGION
artificial
DVVMTQTPLSLPVTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGCGTKVEIK





1211
DLL3 VL REGION
artificial
DVVMTQTPLSLPVTLGQPASISCRSSQSLVYREGNTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGCGTKVEIK





1212
DLL3 VL REGION
artificial
DWMTQTPLSLPVTLGQPASISCRSSQSLVYRDANTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGCGTKVEIK





1213
DLL3 VL REGION
artificial
DWMTQTPLSLPVTLGQPASISCRSSQSLVYRDGQTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGCGTKVEIK





1214
DLL3 VL REGION
artificial
DWMTQTPLSLPVTLGQPASISCRSSQSLVYRDGNAYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGCGTKVEIK





1215
DLL3 VL REGION
artificial
DWMTQTPLSLPVTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGCGTKVEIK





1216
DLL3 VL REGION
artificial
DWMTQTPLSLPVTLGQPASISCRSSQSLVYREGNTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGCGTKVEIK





1217
DLL3 VL REGION
artificial
DVVMTQTPLSLPVTLGQPASISCRSSQSLVYRDANTYLSWFQQRPGQSPR





RLIYKVSNWQSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP





PTFGCGTKVEIK





1218
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSDGSTNYAQNFQGRVTMTRDTSTNTVYMELSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQSPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYFCMQGTHWPPTFGQGTKVEIK





1219
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





1220
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYIHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYGQNFQGRVTMTRDTSTNTVYMELSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQSPLSLP





VTLGQPASISCRSSQSLAYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYFCMQGTHWPPTFGQGTKVEIK





1221
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGHYMHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSDGSTNYAQKFQGRVTMTRDTSTSTVYMELRSLRSEDTAVYYCTRGT



DOMAIN

TVVHYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLTWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGGGTKVEIK





1222
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYFMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQNFQGRVTMTRDTSTNTVYMELSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQSPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYRVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYFCMQGTYWPPTFGQGTKVDIK





1223
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYREGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





1224
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDANTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





1225
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGQTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





1226
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNAYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





1227
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





1228
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





1229
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSEGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





1230
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDASTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





1231
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





1232
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSEGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYREGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





1233
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSDASTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDANTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





1234
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





1235
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYREGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





1236
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDANTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





1237
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGQTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





1238
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNAYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





1239
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





1240
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





1241
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSEGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





1242
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSDASTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





1243
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





1244
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQCLEWMGI



CONSTRUCT BINDING

INPSEGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYREGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





1245
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQCLEWMGI



CONSTRUCT BINDING

INPSDASTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDANTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





1246
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSDGSTNYAQNFQGRVTMTRDTSTNTVYMELSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQSPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYFCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1247
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1248
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYIHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYGQNFQGRVTMTRDTSTNTVYMELSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQSPLSLP





VTLGQPASISCRSSQSLAYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYFCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1249
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGHYMHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSDGSTNYAQKFQGRVTMTRDTSTSTVYMELRSLRSEDTAVYYCTRGT



DOMAIN

TVVHYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLTWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGGGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1250
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYFMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQNFQGRVTMTRDTSTNTVYMELSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQSPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYRVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYFCMQGTYWPPTFGQGTKVDIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1251
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSDGSTNYAQNFQGRVTMTRDTSTNTVYMELSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQSPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYFCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFTFNSYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNSLKTEDTA





VYYCVRHGNFGNSYVSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1252
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFTFNSYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNSLKTEDTA





VYYCVRHGNFGNSYVSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1253
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYIHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYGQNFQGRVTMTRDTSTNTVYMELSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQSPLSLP





VTLGQPASISCRSSQSLAYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYFCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFTFNSYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKGRFTISRDDSKNTAYLQMNSLKTEDTA





VYYCVRHGNFGNSYVSWWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1254
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYREGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1255
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDANTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1256
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGQTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1257
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNAYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1258
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1259
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1260
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSEGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1261
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLGLEWMGI



CONSTRUCT BINDING

INPSDASTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1262
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1263
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSEGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYREGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1264
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGI



CONSTRUCT BINDING

INPSDASTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDANTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1265
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1266
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYREGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1267
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDANTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1268
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGQTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1269
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNAYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1270
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1271
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1272
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSEGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1273
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGLCLEWMGI



CONSTRUCT BINDING

INPSDASTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1274
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQCLEWMGI



CONSTRUCT BINDING

INPSDGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1275
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQCLEWMGI



CONSTRUCT BINDING

INPSEGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYREGNTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1276
DLL3 ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQCLEWMGI



CONSTRUCT BINDING

INPSDASTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARGG



DOMAIN

NSAFYSYYDMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDVVMTQTPLSLP





VTLGQPASISCRSSQSLVYRDANTYLSWFQQRPGQSPRRLIYKVSNWQSG





VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGCGTKVEIK





SGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKG





LEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTA





VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVV





TQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTK





FLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGT





KLTVL





1277
DLL3 ANTIBODY
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGY



CONSTRUCT BINDING

VYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCASIAV



DOMAIN

TGFYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RVTLSCRASQRVNNNYLAWYQQRPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKLEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGGGG





DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1278
DLL3 ANTIBODY
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGY



CONSTRUCT BINDING

VYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCASIAV



DOMAIN

TGFYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RVTLSCRASQRVNNNYLAWYQQRPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKLEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGGGG





DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGGGGSGGGGSGGGGSGGGGSGGGGS





GGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD





VSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL





TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS





RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1279
DLL3 ANTIBODY
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKCLEWIGY



CONSTRUCT BINDING

VYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCASIAV



DOMAIN

TGFYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RVTLSCRASQRVNNNYLAWYQQRPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGCGTKLEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGGGG





DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1280
DLL3 ANTIBODY
artificial
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKCLEWIGY



CONSTRUCT BINDING

VYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCASIAV



DOMAIN

TGFYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RVTLSCRASQRVNNNYLAWYQQRPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGCGTKLEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGGGG





DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGGGGSGGGGSGGGGSGGGGSGGGGS





GGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD





VSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL





TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS





RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1281
DLL3 ANTIBODY
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY



CONSTRUCT BINDING

IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV



DOMAIN

AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKVEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGGGG





DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1282
DLL3 ANTIBODY
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKGLEWIGY



CONSTRUCT BINDING

IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV



DOMAIN

AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGGGTKVEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGGGG





DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGGGGSGGGGSGGGGSGGGGSGGGGS





GGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD





VSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL





TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS





RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1283
DLL3 ANTIBODY
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKCLEWIGY



CONSTRUCT BINDING

IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV



DOMAIN

AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGCGTKVEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGGGG





DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1284
DLL3 ANTIBODY
artificial
QVQLQESGPGLVKPSETLSLTCTVSGASISSFYWSWIRQPPGKCLEWIGY



CONSTRUCT BINDING

IYYSGTTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIAV



DOMAIN

AGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE





RATLSCRASQSVNKNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG





SGTDFTLTISRLEPEDFAVYYCQQYDRSPLTFGCGTKVEIKSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGGGG





DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGGGGSGGGGSGGGGSGGGGSGGGGS





GGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD





VSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLN





GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL





TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS





RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1285
BCMA ANTIBODY
artificial
GYYMH



CONSTRUCT HCDR1







1286
BCMA ANTIBODY
artificial
WINPNSGGTKYAQKFQG



CONSTRUCT HCDR2







1287
BCMA ANTIBODY
artificial
DRITVAGTYYYYGMDV



CONSTRUCT HCDR3







1288
BCMA ANTIBODY
artificial
RASQGVNNWLA



CONSTRUCT LCDR1







1289
BCMA ANTIBODY
artificial
TASSLQS



CONSTRUCT LCDR2







1290
BCMA ANTIBODY
artificial
QQANSFPIT



CONSTRUCT LCDR3







1291
BCMA ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQCLEWMGW



CONSTRUCT VH REGION

INPNSGGTKYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDR





ITVAGTYYYYGMDVWGQGTTVTVSS





1292
BCMA ANTIBODY
artificial
DIQMTQSPSSVSASVGDRVTITCRASQGVNNWLAWYQQKPGKAPKLLIYT



CONSTRUCT VL REGION

ASSLQSGVPSRFSGSGSGTDFTLTIRSLQPEDFATYYCQQANSFPITFGC





GTRLEIK





1293
BCMA ANTIBODY
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNHIIHWVRQAPGQCLEWMGY



CONSTRUCT BINDING

INPYPGYHAYNEKFQGRATMTSDTSTSTVYMELSSLRSEDTAVYYCARDG



DOMAIN

YYRDTDVLDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS





VGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYYTSRLHTGVPSRFSG





SGSGTDFTFTISSLEPEDIATYYCQQGNTLPWTFGCGTKVEIKSGGGGSE





VQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARI





RSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRH





GNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLT





VSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTP





ARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGG





GGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH





EDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKE





YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL





VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ





QGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSG





GGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC





VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQ





DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN





QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT





VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1294
CLAUDIN 18.2
artificial
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQCLEWMGW



ANTIBODY CONSTRUCT

INPNSGGTKYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDR



BINDING DOMAIN

ITVAGTYYYYGMDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIQMTQSPSS





VSASVGDRVTITCRASQGVNNWLAWYQQKPGKAPKLLIYTASSLQSGVPS





RFSGSGSGTDFTLTIRSLQPEDFATYYCQQANSFPITFGCGTRLEIKSGG





GGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEW





VARIRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYY





CVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQE





PSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLA





PGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLT





VLGGGGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV





DVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWL





NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS





LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK





SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGG





GGSGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP





EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLT





VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE





MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY





SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK





1295
MUCIN 17 ANTIBODY
artificial
QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKCLEWIGD



CONSTRUCT BINDING

IDASGSTKYNPSLKSRVTISLDTSKNQFSLKLNSVTAADTAVYFCARKKY



DOMAIN

STVWSYFDNWGQGTLVTVSSGGGGSGGGGSGGGGSSYELTQPSSVSVPPG





QTASITCSGDKLGDKYASWYQQKPGQSPVLVIYQDRKRPSGVPERFSGSN





SGNTATLTISGTQAMDEADYYCQAWGSSTAVFGCGTKLTVLSGGGGSEVQ





LVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRS





KYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGN





FGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGGGGSQTVVTQEPSLTVS





PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPAR





FSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLTVLGGGG





DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED





PEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYK





CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK





GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG





NVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSGGGGSGGG





GSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV





VDVSHEDPEVKFNWYVDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDW





LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV





SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD





KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK








Claims
  • 1. A method for the treatment of a disease, particularly cancer and/or for the prophylaxis, prevention, reduction, amelioration, and/or alleviation of adverse events associated with cancer immunotherapy, particularly with cancer immunotherapy engaging T cells via CD3 binding antibody constructs in a human patient, said method comprising (a) administering an antibody construct that binds selectively to a target antigen on a cancer cell and to human CD3 on the surface of a T cell,(b) administering an inhibitor/antagonist of TNF/TNFR reducing TNF/TNFR signaling, and/or administering an inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling,wherein a first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or a first dose of said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R according to (b) signaling is administered before administration of a first dose of said antibody construct (a) within a first period, said period ranging from 5 minutes to 7 days prior to administration of the antibody construct, particularly wherein said period is ranging from 15 minutes to 7 days prior to administration of the antibody construct.
  • 2. The method of claim 1, wherein the antibody construct binds selectively to a target antigen on a target cell selected from the group comprising CD19, CD33, FLT3, PSMA, BCMA, Claudin 6, Claudin 18.2, Mucin 17, and DLL3.
  • 3. The method of any one of claims 1 and 2, wherein said method comprises the prevention, prophylaxis, amelioration, reduction and/or alleviation of adverse events associated with cancer immunotherapy, particularly wherein these adverse events are selected from cytokine release syndrome (CRS) and tumor lysis syndrome (TLS), particularly in a patient at risk of developing CRS and/or TLS.
  • 4. The method of any one of claims 1 to 3, wherein at least one further dose, particularly a second dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered before administration of said antibody construct.
  • 5. The method of any one of claims 1 to 4, wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling (b) is administered following administration of said antibody construct.
  • 6. The method of any one of claims 1 to 5, wherein a first dose, and optionally also at least one further dose, of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered within a first period before administration of said antibody construct, and optionallywherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of said antibody construct, and optionallywherein at least one dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.
  • 7. The method of any one of claims 1 to 6, wherein said first dose, and optionally also at least one further dose of said inhibitor of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 7 days prior to administration of the antibody construct,wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionallywherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.
  • 8. The method of any one of claims 1 to 7, wherein said first dose, and optionally also at least one further dose of said inhibitor of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 6 days prior to administration of the antibody construct,wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionallywherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.
  • 9. The method of any one of claims 1 to 8, wherein said first dose, and optionally also at least one further dose of said inhibitor of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 5 days prior to administration of the antibody construct,wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionallywherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.
  • 10. The method of any one of claims 1 to 9, wherein said first dose, and optionally also at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 4 days prior to administration of the antibody construct,wherein also said at least one optional further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionallywherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.
  • 11. The method of any one of claims 1 to 10, wherein said first dose, and optionally also at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, said period ranging from 30 minutes to 3 days prior to administration of the antibody construct,wherein also said at least one optional further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionallywherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.
  • 12. The method of any one of claims 1 to 11, wherein said first dose, and optionally also at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is selected from etanercept and/or tocilicumab, said period ranging from 30 minutes to 2 days prior to administration of the antibody construct, particularly wherein the target antigen is Flt3 or CD33,wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionallywherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.
  • 13. The method of any one of claims 1 to 12, wherein said first dose, and optionally also at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab, said period ranging from 30 minutes to 1 day prior to administration of the antibody construct, particularly wherein the target antigen is Flt3 or CD33, more particularly wherein the target antigen is CD33,wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionallywherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.
  • 14. The method of any one of claims 1 to 13, wherein said first dose, and optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab,wherein also said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, wherein said period is shorter than the first period of administration of the inhibitor, and optionallywherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.
  • 15. The method of any one of claims 1 to 14, wherein said first dose, optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and wherein optionally the at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab,wherein also the further said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct,wherein said second period is shorter than the first period of administration of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b),wherein the further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a period ranging from 30 minutes to 5 days, 30 minutes to 4 days, 30 minutes to 3 days, 30 minutest to 2 days, particularly 30 minutes to 1 day prior to administration of the antibody construct, and optionallywherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct.
  • 16. The method of any one of claims 1 to 15, wherein said first dose, optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is selected from etanercept and/or tocilicumab,wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct,wherein said second period is shorter than the first period of administration of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b),wherein the further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a period ranging from 30 minutes to 5 days, 30 minutes to 4 days, 30 minutes to 3 days, 30 minutest to 2 days, particularly 30 minutes to 1 day prior to administration of the antibody construct, and optionallywherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct,wherein the first dose and at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) comprise different quantities of inhibitor and/or different quantities of the antibody construct.
  • 17. The method of any one of claims 1 to 16, wherein said first dose, optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab,wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionallywherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct,wherein the first dose and at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) comprise identical quantities of inhibitor and/or identical quantities of the antibody construct.
  • 18. The method of any one of claims 1 to 17, wherein said first dose, optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab,wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionallywherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct,wherein another dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct within a period from 1 day to 7 days following a first administration of a dose of said antibody construct.
  • 19. The method of any one of claims 1 to 18, wherein said first dose, optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab,wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionallywherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct,wherein another dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct within a period from 1 day to 6 days following a first administration of a dose of said antibody construct.
  • 20. The method of any one of claims 1 to 19, wherein said first dose, and optionally said also at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab,wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionallywherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct,wherein another dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct within a period from 1 hour to 5 days following a first administration of a dose of said antibody construct.
  • 21. The method of any one of claims 1 to 20, wherein said first dose, and optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab,wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionallywherein said at least one other dose said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct,wherein another dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct within a period from 1 hour to 4 days following a first administration of a dose of said antibody construct.
  • 22. The method of any one of claims 1 to 21, wherein said first dose, and optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab,wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionallywherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct,wherein another dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct within a period from 1 hour to 3 days following a first administration of a dose of said antibody construct.
  • 23. The method of any one of claims 1 to 22, wherein said first dose, and optionally also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is/are administered before administration of said antibody construct, and optionally wherein at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct, wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a first period before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab,wherein also said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a second period before administration of the antibody construct, and optionallywherein said at least one other dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered within a third period following administration of said antibody construct,wherein another dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered following administration of said antibody construct within a period from 1 hour to 2 days following a first administration of a dose of said antibody construct.
  • 24. The method of any one of claims 1 to 21, wherein said target antigen is CD33, particularly wherein the antibody construct comprises a first domain that comprises the CDR sequences as depicted in SEQ ID NOs: 317-319 and 323-325, andwherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered about 1 day before administration of the antibody construct, particularly wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is selected from etanercept and/or tocilicumab,wherein said at least one further dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b) is administered about 4 days following administration of said antibody construct.
  • 25. The method of any one of claims 1 to 21, wherein said target antigen is CD33, particularly wherein the antibody construct comprises a first domain that comprises the CDR sequences as depicted in SEQ ID NOs: 317-319 and 323-325, and wherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is administered about 1 day before administration of the antibody construct, particularly wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) is etanercept,wherein said at least one dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b), particularly etanercept, is administered about 4 days following administration of said antibody construct.
  • 26. The method of any one of claims 1 to 23, wherein said target antigen is CD33, particularly wherein the antibody construct comprises a first domain that comprises the CDR sequences as depicted in SEQ ID NOs: 317-319 and 323-325, andwherein a first dose of said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is administered before administration of the antibody construct, particularly wherein inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling (c) is tocilicumab,wherein said dose is administered about 1 hour before administration of the antibody construct, optionally before administration of every dose of antibody construct.
  • 27. The method of any one of claims 1 to 23, wherein said target antigen is Flt3, particularly wherein the antibody construct has a first domain comprising the CDR sequences depicted in SEQ ID NOs: 721 to 726, or wherein the first domain has VH and VL sequences as depicted in SEQ ID NOs: 727 and 728, andwherein the first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) is administered about 2 days before administration of the antibody construct, wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling (b) is etanercept.
  • 28. The method of any one of claims 1 to 23, wherein said target antigen is Flt3 particularly wherein the antibody construct has a first domain comprising the CDR sequences depicted in SEQ ID NOs: 721 to 726, or wherein the first domain has VH and VL sequences as depicted in SEQ ID NOs: 727 and 728, and wherein a first dose of said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is administered before administration of the antibody construct, particularly wherein inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling (c) is tocilicumab,wherein said dose is administered about 1 hour before administration of the antibody construct, optionally before administration of every dose of antibody construct.
  • 29. The method of any one of claims 1 to 23, wherein said target antigen is BCMA, particularly wherein the antibody construct has a first domain comprising the sequence depicted in SEQ ID NO: 1293 or a derivative thereof comprising at least the 6 CDR in SEQ ID NO: 1285 to 1290 or comprising the VL and/or VH regions depicted in SEQ ID NO: 1291 and 1292, and wherein a first dose of said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is administered before administration of the antibody construct, particularly wherein inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling (c) is tocilicumab,wherein said dose is administered about 1 hour before administration of the antibody construct, optionally before administration of every dose of antibody construct.
  • 30. The method of any one of claims 1 to 23, wherein said target antigen is Claudin 18.2 particularly wherein the antibody construct has a first domain comprising the sequence depicted in SEQ ID NO: 1294 or a derivative thereof comprising at least the 6 CDR comprised in SEQ ID NO: 1294 or comprising the VL and/or VH regions depicted in SEQ ID NO: 1294, and wherein a first dose of said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is administered before administration of the antibody construct, particularly wherein inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling (c) is tocilicumab,wherein said dose is administered about 1 hour before administration of the antibody construct, optionally before administration of every dose of antibody construct.
  • 31. The method of any one of claims 1 to 23, wherein said target antigen is Mucin 17 particularly wherein the antibody construct has a first domain comprising the sequence depicted in SEQ ID NO: 1295 or a derivative thereof comprising at least the 6 CDR comprised in SEQ ID NO: 1295 or comprising the VL and/or VH regions depicted in SEQ ID NO: 1295, and wherein a first dose of said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is administered before administration of the antibody construct, particularly wherein inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling (c) is tocilicumab,wherein said dose is administered about 1 hour before administration of the antibody construct, optionally before administration of every dose of antibody construct.
  • 32. The method of any one of the preceding claims, further comprising administering at least one corticosteroid and/or a non-glucocorticoidal compound.
  • 33. The method of any one of the preceding claims, wherein said corticostoid is dexamethasone, and/or said non-glucocorticoidal compound is selected from the group comprising natalizumab, PPS, and minocylin.
  • 34. The method of any one of claims 1 to 33, further comprising the administration of a corticoid compound, particularly dexamethasone, before administration of more that one dose of said antibody construct.
  • 35. The method of any one of claims 1 to 23 and 32 to 34, wherein the target antigen is BCMA and the disease selected from a B cell disorder correlating with BCMA expression, a plasma cell disorder, particularly multiple myeloma, or an autoimmune disease.
  • 36. The method of any one of claims 1 to 26 and 32 to 34, wherein the target antigen is Claudin 18.2 and the cancer is a gastrointestinal cancer selected from the group consisting of gastric cancer, esophageal cancer, gastroesophageal cancer, pancreatic cancer, and colorectal cancer.
  • 37. The method of any one of claims 1 to 23 and 32 to 34, wherein the target antigen is Mucin 17 and the cancer is a gastrointestinal cancer selected from the group consisting of gastric cancer, esophageal cancer, gastroesophageal cancer, pancreatic cancer, and colorectal cancer.
  • 38. The method of any one of claims 1 to 23 and 32 to 34, wherein the target antigen is PSMA and the cancer is a solid tumor, particularly prostate cancer or a cancer originating from a prostate cancer.
  • 39. The method of any one of claims 1 to 23 and 32 to 34, wherein the target antigen is DLL3 and the cancer is a solid tumor selected from the group consisting of lung cancer, preferably SCLC, breast, cervical, colon, colorectal, endometrial, head and neck, liver, ovarian, pancreatic, prostate, skin, gastric, testis, thyroid, adrenal, renal, bladder, uterine, esophageal, urothelial and brain tumor or cancer, or a lymphoma, carcinoma, and sarcoma, and a metastatic cancer disease derived from any of the foregoing.
  • 40. The method of any one of claims 1 to 25, 27, and 32 to 39, wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is etanercept, particularly wherein the dosage is administered subcutaneously.
  • 41. The method of any one of claims 1 to 25, 27, and 32 to 40, wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is etanercept and the dosage is administered subcutaneously at a dose of between 10 mg to 100 mg.
  • 42. The method of any one of claims 1 to 24, 26, and 32 to 39, wherein the inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is tocilizumab, particularly wherein the dosage is administered intravenously.
  • 43. The method of any one of claims 1 to 24, 26, 32 to 39, and 42, wherein the inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling is tocilizumab and the dosage is administered intravenously or at 1 mg/kg to 20 mg/kg.
  • 44. The method of any one of the preceding claims 1 to 43, wherein the adverse event associated with immunotherapy is associated with increased cytokine release of TNF, IL-1, MCP-1, and/or IL-6, and wherein the group of adverse events optionally further comprises a neurological reaction, particularly one or more selected from the group consisting of: confusion, ataxia, disorientation, dysphasia, aphasia, speech impairment, cerebellar symptoms, tremor, apraxia, seizure, grand mal convulsion, palsy, and balance disorder.
  • 45. The method of any one of the preceding claims 1-44, wherein the domain of said antibody construct that binds to CD3, binds to human CD3 epsilon and to Callithrix jacchus or Saimiri sciureus CD3 epsilon.
  • 46. The method of any one of the preceding claims 1 to 45, wherein a) the antibody construct is a single chain antibody construct,b) the first domain is in the format of an scFv,c) the second domain is in the format of an scFv,d) the first and the second domain are connected via a linker, and/ore) the antibody construct comprises a domain providing an extended serum half-life.
  • 47. The method of any one of the preceding claims 1 to 46, wherein said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling and/or said inhibitor/antagonist of IL6/IL6R that reduces IL6/IL6R signaling according to (b), is selected from the group comprising small molecules, biological molecules, antibodies and derivatives thereof, and aptamers.
  • 48. The method of any one of the preceding claims 1 to 25, 27, 32 to 41, 44 to 47, wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is selected from the group of TNF inhibitors/antagonists comprising etanercept, infliximab, adalimumab, certolizumab Pergol, and golimumab, particularly etanercept.
  • 49. The method of any one of the preceding claims, wherein said patient is selected from the group of patients at risk of developing adverse events or having an intolerance to at least one of a group comprising corticosteroids, non-glucocorticoidal compounds, IL-6-inhibitors, IL-6R-inhibitors, and/or TNF/TNFR inhibitors different from an inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling according to claim 48.
  • 50. The method of any one of the preceding claims, wherein said patient is selected from the group of patients at risk of developing adverse events or having an intolerance to corticosteroids, optionally also wherein the corticosteroid is dexamethasone.
  • 51. The method of any one of the preceding claims, wherein the step of administering an antibody construct that binds selectively to a target antigen on a cancer cell and to human CD3 on the surface of a T cell is the first exposure of said antibody construct.
  • 52. The method of any one of the preceding claims 1 to 50, wherein the step of administering an antibody construct that binds selectively to a target antigen on a cancer cell and to human CD3 on the surface of a T cell is a re-exposure of the patient to said antibody construct.
  • 53. The method of any one of claims 1 to 34, comprising the administration of a corticoid compound, particularly dexamethasone, before administration of more than one dose of said antibody construct, wherein said antibody construct is selected from CD19, CD33, FLT3, PSMA, BCMA, Claudin 6, Claudin 18.2, Mucin 17, and DLL3, particularly CD33, PSMA or FLT3, and wherein the wherein a first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is administered before administration of a first dose of said antibody construct (a) within a first period, said period ranging from 5 minutes to 7 days prior to administration of the antibody construct, particularly wherein said period is ranging from 15 minutes to 7 days prior to administration of the antibody construct, and wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is etanercept.
  • 54. The method of any one of claims 1 to 34 and 53, comprising the administration of a corticoid compound, particularly dexamethasone, before administration of more than one dose of said antibody construct, wherein said antibody construct is CD33, PSMA or FLT3, and wherein the wherein a first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is administered before administration of a first dose of said antibody construct (a) within a first period, said period ranging from 5 minutes to 7 days prior to administration of the antibody construct, particularly wherein said period is ranging from 15 minutes to 7 days prior to administration of the antibody construct, and wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is etanercept.
  • 55. The method of any one of claims 1 to 34, comprising the administration of dexamethasone before administration of one dose of said antibody construct, wherein said antibody construct is CD33, and wherein the wherein a first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is administered before administration of a first dose of said antibody construct (a) within a first period, said period ranging from 5 minutes to 7 days prior to administration of the antibody construct, particularly wherein said period is ranging from 15 minutes to 7 days prior to administration of the antibody construct, and wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is etanercept.
  • 56. The method of any one of claims 1 to 34, comprising the administration of dexamethasone before administration of one dose of said antibody construct, wherein said antibody construct is Flt3, and wherein the wherein a first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is administered before administration of a first dose of said antibody construct (a) within a first period, said period ranging from 5 minutes to 7 days prior to administration of the antibody construct, particularly wherein said period is ranging from 15 minutes to 7 days prior to administration of the antibody construct, and wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is etanercept.
  • 57. The method of any one of claims 1 to 34, comprising the administration of dexamethasone before administration of one dose of said antibody construct, wherein said antibody construct is PSMA, and wherein the wherein a first dose of said inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is administered before administration of a first dose of said antibody construct (a) within a first period, said period ranging from 5 minutes to 7 days prior to administration of the antibody construct, particularly wherein said period is ranging from 15 minutes to 7 days prior to administration of the antibody construct, and wherein the inhibitor/antagonist of TNF/TNFR that reduces TNF/TNFR signaling is etanercept.
PCT Information
Filing Document Filing Date Country Kind
PCT/US21/22073 3/12/2021 WO
Provisional Applications (1)
Number Date Country
62988489 Mar 2020 US