METHOD

Information

  • Patent Application
  • 20240200128
  • Publication Number
    20240200128
  • Date Filed
    July 14, 2023
    2 years ago
  • Date Published
    June 20, 2024
    2 years ago
Abstract
The invention provides a method of detecting a target polynucleotide in a sample comprising: (a) contacting the sample with a guide polynucleotide that binds to a sequence in the target polynucleotide and a polynucleotide-guided effector protein, wherein the guide polynucleotide and polynucleotide-guided effector protein form a complex with any target polynucleotide present in the sample; (b) contacting the sample with a membrane comprising a transmembrane pore: (c) applying a potential to the membrane; and (d) monitoring for the presence or absence of an effect resulting from the interaction of the complex with the transmembrane pore to determine the presence or absence of the complex, thereby detecting the target polynucleotide in the sample.
Description
REFERENCE TO AN ELECTRONIC SEQUENCE LISTING

The contents of the electronic sequence listing (0036670075US02-SUBSEQ-KZM.xml: Size: 161,643 bytes; and Date of Creation: Aug. 10, 2023) is herein incorporated by reference in its entirety.


FIELD OF THE INVENTION

The invention relates generally to a method of detecting and/or analysing target polynucleotides using a transmembrane pore. The invention also relates to novel probes and panels of probes for use in the method and kits for carrying out the method. The method has many uses. In particular, the method may be used for diagnosis, detection of polymorphisms and V(D)J repertoire analysis.


BACKGROUND TO THE INVENTION

There is currently a need for rapid and cheap polynucleotide (e.g. DNA or RNA) sequencing and identification technologies across a wide range of applications. Existing technologies are slow and expensive mainly because they rely on amplification techniques to produce large volumes of polynucleotide and require a high quantity of specialist fluorescent chemicals for signal detection. Transmembrane pores (and other nanopores) have great potential as direct, electrical biosensors for polymers and a variety of small molecules. In particular, recent focus has been given to nanopores as a potential DNA sequencing technology. When a potential is applied across a nanopore, there is a change in the current flow when an analyte, such as a nucleotide, resides transiently in the barrel for a certain period of time. Nanopore detection of the nucleotide gives a current change of known signature and duration. In the strand sequencing method, a single polynucleotide strand is passed through the pore and the identities of the nucleotides are derived. Strand sequencing can involve the use of a molecular brake to control the movement of the polynucleotide through the pore.


SUMMARY OF THE INVENTION

The present inventors have identified a novel use for the guide RNAs and DNAs and RNA-guided and DNA-guided effector proteins that form part of the CRISPR gene editing machinery. The present inventors have designed modified guide RNA sequences that can be used in conjunction with associated RNA-guided effector proteins to test for the presence, absence or amount of one or more target polynucleotides in a sample. The present inventors have developed methods of detecting target polynucleotides using guide RNAs and RNA-guided effector proteins in conjunction with a transmembrane pore. The methods can be performed in a variety of ways, but have in common that they use guide RNAs and RNA-guided effector proteins to select the target polynucleotide(s) and involve the delivery of a complex comprising the target polynucleotide, guide RNA and RNA-guided effector protein to a transmembrane pore. The methods can be extended to other polynucleotide-guided protein effector systems, including the RNA editing system using C2c2. The guide polynucleotide, such as guide RNA, may be specially adapted for use in a nanopore-based detection method.


The methods developed by the present inventors are sensitive and can be used to detect trace amounts of polynucleotide in a sample without requiring a separate separation step to extract the target polynucleotide(s) from other components in the sample. Thus, the methods are simple and do not require complex steps, such as enrichment or purification steps. Accordingly, the methods are rapid and can be used to obtain quick results and results from crude and/or “dirty” samples. The methods are therefore particularly useful in diagnostic settings where rapid diagnosis is required. The methods are also particularly useful in targeting a particular fragment or region of a gene or genome. A key benefit of the methods is that the polynucleotide guided effector protein does not actively need to be removed from the target polynucleotide prior to measurement of the target or the adaptor. In some embodiments of the invention, the target polynucleotide may be detected or characterized whilst still attached to the polynucleotide guided effector protein. In other embodiments of the invention, the polynucleotide guided effector protein may be automatically removed by the transmembrane pore during measurement of the target. In some embodiments, the method uses specifically designed guide polynucleotides to facilitate separation of the target polynucleotide(s) from other components in the sample.


The methods enable the regions of interest of polynucleotide sequence to be characterized, for example sequenced, in a sample that contains many other polynucleotide sequences as it inherently includes a separation step. For example, only genes of interest present in a large genome may be sequenced. The sequencing can be limited to regions that contain SNPs, or to other regions of interest, such as V(D)J regions in T-cells. This improves sensitivity and efficiency, with the desired information being accessed without requiring complicated or time-consuming fragmentation or pull-down sample preparation methods. It also reduces the time taken perform the nanopore experiment as only the target polynucleotide fragments of interest are measured, or an increased proportion thereof are measured relative to the total polynucleotide fragments in the sample In cases where the amount of non-target polynucleotide is in excess to that of the target polynucleotide, the time taken to detect the target polynucleotide can be significantly reduced due to the removal of or a reduction in the need to measure non-target polynucleotides. The methods also benefit from not requiring PCR or other target enrichment approaches.


Accordingly, the present invention provides a method of detecting a target polynucleotide in a sample comprising:

    • (a) contacting the sample with a guide polynucleotide that binds to a sequence in the target polynucleotide and a polynucleotide-guided effector protein, wherein the guide polynucleotide and polynucleotide-guided effector protein form a complex with any target polynucleotide present in the sample;
    • (b) contacting the sample with a membrane comprising a transmembrane pore;
    • (c) applying a potential difference across the membrane; and
    • (d) monitoring for the presence or absence of an effect resulting from the interaction of the complex with the transmembrane pore to determine the presence or absence of the complex, thereby detecting the target polynucleotide in the sample.


Also provided is a method of detecting a target polynucleotide in a sample comprising:

    • (a) contacting the sample with a guide polynucleotide that binds to a sequence in the target polynucleotide and a polynucleotide-guided effector protein, wherein the guide polynucleotide and polynucleotide-guided effector protein form a complex with any target polynucleotide present in the sample;
    • (b) contacting the sample with a nanopore;
    • (c) applying a potential difference across the nanopore; and
    • (d) monitoring for the presence or absence of an effect resulting from the interaction of the complex with the nanopore to determine the presence or absence of the complex, thereby detecting the target polynucleotide in the sample.


The invention also provides:

    • a guide polynucleotide comprising a nucleotide sequence that binds to a sequence in the target polynucleotide, a nucleotide sequence that binds to a polynucleotide guided effector protein and an adaptor sequence and/or an anchor capable of coupling to a surface;
    • a panel of two or more guide polynucleotides of the invention;
    • a guide polynucleotide/polynucleotide-guided effector protein complex comprising a guide polynucleotide of the invention and a polynucleotide-guided effector protein;
    • a kit comprising: a polynucleotide-guided effector protein and an anchor capable of coupling to a surface; and
    • a method of detecting a target comprising a double stranded polynucleotide in a sample comprising:
      • (a) contacting the sample with a first probe and a second probe, wherein the first probe and the second probe form a complex with any target polynucleotide present in the sample, the first probe binds to a first sequence in the target double stranded polynucleotide and comprises an anchor capable of coupling to a surface, and the second probe binds to a second sequence in the target double stranded polynucleotide and comprises an adaptor sequence;
      • (b) contacting the sample with a transmembrane pore;
      • (c) applying a potential to the transmembrane pore; and
      • (d) monitoring for the presence or absence of an effect resulting from the interaction of the complex with the transmembrane pore to determine the presence or absence of the complex, thereby detecting the target double stranded polynucleotide in the sample.





DESCRIPTION OF THE FIGURES

It is to be understood that Figures are for the purpose of illustrating particular embodiments of the invention only, and are not intended to be limiting.



FIG. 1 shows an example of how an inactivated CRISPR-Cas9 complex bearing an extended CRISPR RNA (crDNA) may be used to contact specific genomic DNA sequence ‘a’. In this figure, a Cas9 protein A contacts a specific locus a in genomic DNA B. The CRISPR RNA C bears the sequence of a, which precedes a ‘PAM’ site D. Cas9 catalyses the melting of a and hybridises to non-target strand a′. The crRNA may also carries a sequence bearing partial complementarity to tracrRNA E and an extension F which enables the hybridisation of an anchoring polynucleotide or polynucleotide binding protein loaded polynucleotide. The tracrRNA may also carry an extension G which enables the hybridisation of an anchoring polynucleotide, or polynucleotide binding protein loaded polynucleotide. Alternatively, the Cas9 may carry a peptide tag, or polynucleotide affinity tag, or reactive moiety H, which enables the binding or pulldown of the protein to a surface for anchorage or purification. Also shown are the canonical cleavage sites I, J for the wild-type Cas9 nuclease, both of which are inactivated in the ‘dead’ Cas9 (dCas9), and one of which is inactivated in the ‘nickase’ mutants of Cas9, (mutations of residues H10 and D840 in the Streptococcus pyogenes protein).



FIG. 2 shows an alternative method to FIG. 1 in which a CRISPR-Cas9 with zero or one inactivated nuclease sites is bound to a specific locus (as per FIG. 1) and an adapter carrying an enzyme B and sequence complementary to sequence a is extended and ligated directly to the target DNA. Panel C shows the double-strand break in the target induced at one or both sites D and E by the active or partially active Cas9 nuclease. Panel F shows the dissociation of the CRISPR-Cas9 complex induced by binding of species B to the displaced strand of the CRISPR-Cas9 complex. Panel G shows the effect of extending the 3′ end of species B in the presence of a polymerase-exonuclease such as E. coli DNA polymerase I and ligase such as E. coli DNA ligase.



FIG. 3 shows how an enzyme-loaded adaptor (‘Y-adaptor’), species A, may be hybridised to a crRNA-tracrRNA hybrid, species B, bearing an appropriate 3′ extension. Species A comprises: an oligonucleotide C with partial complementarity a* to the 3′ extension of species B, and a 5′ extension for loading of an enzyme D; an oligonucleotide E bearing partial complementarity to species C. Oligonucleotide Species B comprises: an oligonucleotide F carrying: sequence S1, the protospacer sequence of the crRNA, partial complementarity to tracrRNA G, and a 3′ extension of sequence a, complementary to sequence a*.



FIG. 4 shows how an anchoring species A, such as an oligonucleotide carrying a cholesterol moiety, may be hybridised to a crRNA-tracrRNA hybrid, species B, bearing an appropriate 3′ extension. All parts are similar to FIG. 3 except: sequence S2 is a protospacer sequence unique to species B, and targeting a different sequence to the hybrid shown in FIG. 3; sequence b, a 3′ extension to the crRNA that is complementary to sequence b*, on the anchoring species A. Species A carries an anchoring moiety C, such as a cholesterol or biotin or desthiobiotin.



FIG. 5 shows how a double-stranded DNA target A may be differentiated from a non-specific DNA B by means of recognition by a CRISPR-Cas9 complex C.



FIG. 6 is identical to FIG. 5, except that the specific and non-specific DNA in a mixture may be derivatised with an adapter moiety A may be used for capture of target and non-target DNA by a nanopore.



FIG. 7 is identical to FIG. 6, except that the adapter moiety A may carry an polynucleotide binding protein B used to control the movement of target and non-target DNA through a nanopore.



FIG. 8 shows an example in which CRISPR-Cas9 complexes (A, B) directed against two adjacent loci on a target DNA C may be used to positively identify a sample. Complex A contains a crRNA bearing an enzyme-loaded extension, as per FIG. 3. Complex B contains a crRNA complex bearing an anchoring extension, as per FIG. 4. DNA bearing a locus that binds Complex B binds to surface D such as a tri-block polymer membrane. The enzyme bound to Complex A may control the movement of a barcoded DNA analyte E through a nanopore. Following the removal of non-specific analytes (including species with no target loci, F) from solution, via flushing the system, only entity G bearing the two loci will be detected, and not entities F, H or I.



FIG. 9 shows an example in which an inactive Cas9 (‘dCas9’) bearing an extension containing an anchoring moiety may be used to enrich and determine the sequence of a target analyte via polynucleotide binding protein controlled translocation through a nanopore. In this example, an enzyme-bound adapter moiety is ligated to one or both ends of all DNA in solution. Only DNA containing the target locus binds the anchoring dCas9 complex.



FIG. 10 shows a DNA analyte with a ligated, enzyme-bound adapter that may be used to control the movement of a DNA analyte through a nanopore.



FIG. 11 shows a DNA analyte with bound enzyme, similar to FIG. 10, in which the translocation of the enzyme may be temporarily stalled by a CRISPR-dCas9 complex bound to a specific locus.



FIG. 12 shows a method for detection of dCas9 bound to a target polynucleotide analyte in which both strands of the target analyte and the bound dCas9 are translocated through a nanopore, where the nanopore bears a constriction that permits passage of the target analyte and bound dCas9, and in which the dCas9 produces a characteristic deflection in the ionic current measured through the nanopore.



FIG. 13 shows a method for detection of dCas9 bound to a target polynucleotide analyte in which both strands of the target analyte are translocated through a nanopore, but the constriction of the nanopore prevents translocation of the bound dCas9 and produces a characteristic deflection or dwell-time in the ionic current measured through the nanopore.



FIG. 14 shows a method for the detection of dCas9 bound to a target polynucleotide analyte in which the target analyte is derivatised with an polynucleotide binding protein free adaptor, as per FIG. 6, and in which one of the two strands of the polynucleotide analyte is translocated through the nanopore, and in which the dCas9 bound to the target analyte produces a characteristic deflection or dwell-time in the ionic current measured through the nanopore.



FIG. 15 shows a method for the sequencing of a target analyte with bound dCas9 in which the target analyte is derivatised with a polynucleotide binding protein bound adaptor, as per FIG. 7, and in which translocation of one of the two strands of the polynucleotide analyte is controlled through the nanopore by the polynucleotide binding protein. In this example, the dCas9 bound to the target analyte may produce a characteristic stall in the translocation of the polynucleotide binding protein, and thus in the ionic current measured through the nanopore.



FIG. 16 shows a method for the identification of a target DNA anchored to a membrane, as per FIG. 8, via an extended CRISPR-dCas9 bearing a cholesterol moiety, as per FIG. 4, and identified by controlled movement of a barcoded, polynucleotide binding protein loaded oligonucleotide analyte hybridised to an extended CRISPR-dCas9 complex, as per FIG. 3, and which binds to a locus adjacent to the cholesterol-extended CRISPR-dCas9.



FIG. 17 shows a derivative of FIG. 16 in which the anchoring moiety may be, for example, biotin or desthiotin, and the anchoring moiety may bind to a streptavidin-derivatised bead or nanoparticle.



FIG. 18 shows an example of a target DNA that is anchored to a membrane via a cholesterol-extended CRISPR-dCas9 complex that binds to a known or common locus, and in which the same target DNA contains a number of unknown sequences whose presence or absence is determined by enzyme-extended CRISPR-dCas9 complexes. In this example, each enzyme-extended CRISPR-dCas9 complex carries a unique barcode that may be used to positively identify the presence or absence of the loci in combination, as per FIG. 16. The target DNA could also be directly coupled to the membrane rather than via the cholesterol-extended CRISPR-dCas9 complex.



FIG. 19 shows an example polynucleotide, lambda phage DNA, and the position of a specific target locus A that is 2,855 bp from the end of the genome.



FIG. 20 shows the target locus of FIG. 19, with bound CRISPR-dCas9 bearing a cholesterol extension, fragmented randomly into 1-3 kb segments, with each segment bearing an polynucleotide binding protein loaded Y-adaptor at either or both ends for determining the sequence of the target polynucleotide. The assembly is anchored to a membrane surface via the cholesterol moiety.



FIG. 21 shows a coverage plot of sequence data aligned against a phage lambda reference from an experiment in which phage lambda DNA was randomly fragmented into 1-3 kb segments; enzyme-Y-adaptor was ligated to the fragmented DNA: and a cholesterol-extended CRISPR-dCas9 was bound to the target shown in FIG. 19. The coverage plot shows enrichment of the specific locus A in the expected location (2,855 bp from the end of the lambda phage genome). The top panel shows the alignments accumulated from the forwards (B) and reverse (C) read directions, and the bottom panel shows the aggregate of the forwards and reverse orientations.



FIG. 22 shows an example trace of the nanopore current signature detected by polynucleotide binding protein controlled translocation of a target DNA bearing a bound, cholesterol-extended dCas9 at the locus shown in FIGS. 19 and 20. In this example, the dCas9 transiently stalls the translocation of the enzyme. The current traces comprises: open pore level A, leader signature B, target analyte signature C, and stall D.



FIG. 23 shows an example trace of the nanopore current signature detected by enzyme-controlled movement of a barcoded oligonucleotide on an enzyme-extended dCas9, as per FIG. 16. The current trace comprises: open pore level A, leader signature B, and barcode signature C.



FIG. 24 illustrates how guide polynucleotide/polynucleotide-guided effector proteins may be used to bring polynucleotide targets to a membrane comprising a transmembrane pore. The unbound polynucleotides may be flushed away prior to application of a transmembrane potential and detection of the polynucleotide/polynucleotide-guided effector protein/target polynucleotide complex using the transmembrane pore.



FIG. 25 shows examples of how an adaptors and leader sequence may be attached to guide RNA.



FIG. 26 shows how the method of the invention may be used to detect the presence or absence of SNPs using a guide polynucleotide/polynucleotide-guided effector protein comprising a membrane anchor to tether a polynucleotide to a membrane and guide polynucleotide/polynucleotide-guided effector proteins specific for different SNPs and comprising barcoded adaptors to distinguish between the SNPs.



FIG. 27 shows how a pair of guide polynucleotides/polynucleotide-guided effector proteins can be used to obtain a polynucleotide fragment comprising a region of interest (ROI). The first guide polynucleotide/polynucleotide-guided effector protein could have its nuclease activity disabled such that it acts to stall a polynucleotide binding protein as shown in FIG. 11, enabling the region of interest to be characterized using a transmembrane pore.



FIG. 28A shows the immobilisation of a target DNA analyte (A) comprising an enzyme-bound Y-adaptor (B) ligated to both ends, and tethered at both ends on a membrane (C) surface via oligonucleotides each bearing a cholesterol moiety (D). A bound CRISPR-dCas9 (E) bearing a cholesterol anchor (F), tethers the analyte to the membrane in a third position. This figure shows the system before the addition of MgATP to initiate enzyme translocation on DNA. FIG. 28B shows the immobilisation of a target DNA analyte (A) comprising an enzyme-bound Y-adaptor (B) ligated to both ends, each bearing a cholesterol moiety (D). A bound CRISPR-dCas9 (E) bearing an affinity tag such as a biotin moiety (F), tethers the analyte to a bead (C) such as streptavadin. This Figure shows the system before the addition of MgATP to initiate enzyme translocation on DNA. FIG. 28C shows the immobilisation of a target DNA analyte (A) comprising an enzyme-bound Y-adaptor (B) ligated to one end bearing a cholesterol moiety (D). The other end has a hairpin (G). A bound CRISPR-dCas9 (E) bearing an affinity tag such as a biotin moiety (F), tethers the analyte to a bead (C) such as streptavadin. This Figure shows the system before the addition of MgATP to initiate enzyme translocation on DNA.



FIG. 29 shows the system introduced by FIG. 28 upon the addition of MgATP. The translocation of enzyme towards the CRISPR-dCas9 complex is halted upon encounter of the CRISPR-dCas9 complex (A).



FIG. 30 shows the system introduced by FIG. 29 upon the application of a potential across the membrane, and capture of the end of the target analyte by a nanopore (A).



FIG. 31 shows the system introduced by FIG. 30 whereupon the potential applied to the analyte has released the enzyme bound to the CRISPR-dCas9 complex and the enzyme has resumed translocation (A).



FIG. 32 shows an example trace, ˜2350 secs after the addition of MgATP, comprising an initial, pre-dCas9 translocation event (B), stalling (C), and resumption of translocation (D). The resumption from the stall is highlighted and expanded (E).



FIG. 33 is a schematic of a double stranded DNA strand encountering a pore which is only big enough for a single strand of DNA to fit through. The complementary strand is stripped away by the pore as the first strand passes through.



FIG. 34 shows a current vs time plot of a DNA strand translocating through a Nanopore. The trace begins at the open pore level, A, when there is no DNA in the pore. A double stranded DNA strand with an adapter at each end then encounters the pore and begins to translocate. The pore is too small for double stranded DNA to pass through so only a single strand translocates as per FIG. 33. The translocation of the DNA produces a characteristic signal (region B) and then returns to the open pore level, A. The events typically last less than 0.5s. The lower panel is a zoomed in view of the upper panel.



FIG. 35 shows the same experiment as FIG. 34 except that the DNA strand has a dCas9 enzyme bound to it, as illustrated in FIG. 14. Long pauses lasting 10s of seconds are observed at a current level associated with DNA in the pore. Some of these events only return to the open pore level when the potential is reversed.



FIG. 36 shows the experiment as FIG. 34 except that the DNA strand has a dCas9 enzyme bound to it, as illustrated in FIG. 14. It shows an event in which the strand translocates and the signal returns to the open pore level, A. The second and third panels are zoomed in views of the first panel, with the second showing the beginning of the event and the third showing the end. It can be seen from this trace that the signal has the same characteristic pattern as in FIG. 34, but with a new long pause level in it, C. This demonstrates that the dCas9 bound to the DNA strand is causing a modification of the signal observed with DNA alone.



FIG. 37 shows an example current trace of a double stranded DNA strand passing intact through a pore large enough to accommodate it. From the open pore current, A, the current drops to a lower level as the DNA passes through it, B, and then returns to the open pore level.



FIG. 38 shows an example current trace of a double stranded DNA strand passing intact through a pore large enough to accommodate it. In this case, the DNA has a protein bound to it as shown in FIG. 12. Here there is an extra deflection in the current coming from the DNA level which represents the protein translocating (C).



FIG. 39 shows an example current trace of a double stranded DNA strand passing intact through a pore large enough to accommodate it, wherein multiple proteins are bound to the DNA. Each protein causes a separate deflection to the current.



FIG. 40 shows an example current trace of a double stranded DNA strand passing intact through a pore large enough to accommodate it, wherein multiple proteins are bound to the DNA (at different positions to those in FIG. 39) and the proteins have been modified or decorated so that they produce different signals when they pass through the pore.



FIG. 41 shows an example method for the enrichment and detection or sequencing of a dCas9-contacted target A to a bead surface B, with crRNA C and tracrRNA bearing a 5′ DNA extension D with sequence a. Target A may be any size, ranging from tens of nucleotides to greater than megabases in length. B may for instance be a bead surface (in bulk solution or in column format) or membrane. Attachment to B is mediated by oligonucleotide E, bearing sequence a′ complementary to the extension of D, which bears a chemical moiety such as biotin that enables attachment to bead B if B is coated with a protein such as streptavidin. Non-target DNA may subsequently be washed away from B. Enzymatic or click chemistry ligation of adapter F to blunt or complementary ends of target A may be achieved while the target is bound to the bead, with excess adapter washed away, to yield target-dCas9-bead assembly G. Sequencing or detection of the target A is then achieved by delivering assembly G to a flowcell containing membrane H. and cholesterol-modified oligonucleotide tether I, which hybridises to adaptor F via sequence t′, complementary to t. Assembly G may be delivered to the membrane by gravity, or by an applied magnetic field if for instance bead B is paramagnetic.



FIGS. 42A-42C show an example coverage plot showing the enrichment of all 6S (rrs) genes from a total E. coli genomic sample, using a crRNA probe directed against the rrsH gene (coordinates 223771-225312 of E. coli K-12, strain MG1655, peak i). FIG. 42A, left shows a plot of coverage versus position for forwards (positive numbers) and reverse (negative numbers) direction reads. Seven target peaks, i to vii, are identified, which are over-represented against background B. FIG. 42A, right shows the aggregation of forwards and reverse direction reads. FIG. 42B shows a histogram of the read length of all reads that successfully mapped to the reference, normalised to the number of bases mapped in each bin.



FIG. 42C shows the seven expected binding locations of the single probe used in the pulldown. Peak vii is located at a target sequence that is a canonical ‘off-target’ site, but bears but bears 19 out of 20 matches to the probe sequence.



FIG. 43 shows the effect of applying a heat stress, followed by subsequent SPRI-bead cleanup and bead-based dCas9 pulldown to a dCas9-contacted DNA sample on the proportion of target vs. non-target molecules bound, as determined by nanopore sequencing.



FIG. 44 shows an example of a sequential ‘pull-down’ and ‘toehold elution’ method that exploits two distinct oligonucleotide extensions, sequences [a-c] and d, from the tracrRNA and crRNA respectively of a dCas9-contacted target molecule A, and may be used to select for the presence of the tracrRNA and crRNA (or vice versa), sequentially. Oligonucleotide B, bearing sequence a′-b′, partly complementary to tracrRNA extension a, is first bound to purification surface C: A is incubated with [B+C] and any non-target DNA washed away. Oligonucleotide D, bearing sequence [a+b], fully complementary to oligonucleotide B, when incubated with [A+B+C], will displace oligonucleotide B from the tracrRNA extension of A by a phenomenon known as ‘toehold displacement’, releasing A from [B+C]. A may either be adapted and delivered to a flowcell for nanopore sequencing or detection, as outlined in FIG. 41, or may then be bound to a second type of surface E, bearing a duplex oligonucleotide F with overhang d′ that is complementary to the crRNA extension G (sequence d), to yield F. F may also be adapted and sequenced or detected as outlined in FIG. 41. Surfaces C and E may be a bead (whether in bulk or column format) or membrane.



FIGS. 45A-45H show the combinatorial effect of heat stress (55° C., 5 min), SPRI purification (performed after heat stress, where applicable; Ix), and the toehold displacement method (performed after bead capture), from a pulldown of the 16S rrs genes using a single crRNA probe, as described in Example 7. FIG. 45A, control with no heat stress, SRRI or toehold. FIG. 45B, SRRI only. FIG. 45C, heat stress only. FIG. 45D, heat stress and SPRI. FIG. 45E, toehold only. FIG. 45F, SPRI and toehold. FIG. 45G, heat stress and toehold. FIG. 45H, heat stress, SPRI and toehold. Each panel (FIGS. 45A through H) shows an example E. coli coverage plot, similar to that shown in FIG. 42.



FIG. 46 compares pulldowns performed with wild-type or ‘enhanced specificity’ mutant of dCas9, as described in Example 8. Panel A shows a control experiment in which the dCas9 mutant variant, in an otherwise wild-type background, was used to pull out the E. coli rrs 16S genes, as described in FIG. 42 and Example 6. Peaks are as identified in FIG. 42. Panel B shows an equivalent experiment in which the wild-type dCas9 mutant variant was replaced with the ‘enhanced specificity’ dCas9 mutant, D10A/H840A/K848A/K1003A/R1060A. Peaks C and D also corresponds to peak vii of FIG. 42, and correspond to the rrsD gene, which carries a mismatch at position −2 relative to the PAM.



FIG. 47 shows coverage plots from nanopore DNA sequencing runs of pulldowns performed with catalytically dead (dCas9, A) or live (B) Cas9, as described in Example 9.





Panel A shows a control experiment in which the dCas9 mutant variant, in an otherwise wild-type background, was used to pull out the E. coli rrs 16S genes, as described in FIG. 42 and Example 6. The incubation temperature in this experiment was 30° C. Panel B shows a similar pulldown experiment in which the dCas9 mutant was replaced with catalytically active Cas9. The incubation temperature in this experiment was 37° C. * denotes an additional peak attributable to the higher incubation temperatures used in this experiment compared with Example 6. Panels C and D show coverage plots for the dCas9 and live Cas9 pulldowns in which the coverage is grouped by the directionality of the read; positive numbers denote forwards reads, while negative numbers denote reverse reads.



FIG. 48, A shows a bead-target conjugate, similar to that shown in FIG. 41, but additionally containing a barcode adapter B between the enzyme-loaded adapter and the target molecule C. Other components are as described in FIG. 41. Panel D shows coverage plots from a single 6-hour sequencing run that contained seven individually-barcoded samples, NB01 through NB07. Each barcode is associated with a different set of crRNA probes, and therefore a different target region of the E. coli genome, as described in the text of Example 10. Probe combinations are listed in the text of Example 10.



FIG. 49 shows three example workflows involving the attachment of adapters to a captured target analyte, while the analyte is bound via dCas9 to beads. A, the enzyme-free detection of dCas9, via the ligation of an enzyme-free adapter to the ends of a captured target analyte bound to beads; B, the enrichment of target by the ligation of PCR adapters, followed by PCR amplification of the target, as described above, to release, amplify and sequence target from beads; and C, the sequential ligation of 1D2 barcode adapters, followed by sequencing adapters, for high-accuracy nanopore sequencing, while dCas9 is bound to the target, and the target bound to beads.



FIG. 50 shows an example workflow, described in Example 11, for the rapid enrichment of target from high-molecular weight DNA, by transposase-mediated shearing of the DNA, while concomitantly adding a sticky end for adapter ligation by click chemistry. dCas9 is then bound to the sheared DNA, as described in Example 11; off-target effects are minimised by a stress step, as previously described in Example 6, and sequencing adapters ligated via click chemistry. This workflow makes use of the Oxford Nanopore Technologies SQK-RAD003 kit, with the insertion of a Cas9 binding and bead capture step between the transposase fragmentation and adapter attachment steps, as described in Example 11.



FIG. 51 shows a hypothetical example method for the enrichment and detection or sequencing of a Cpf1 or dCpf1-contacted target A to a bead surface B, with crRNA bearing a 5′ DNA extension C with sequence a. Target A may be any size, ranging from tens of nucleotides to greater than megabases in length. B may for instance be a bead surface (in bulk solution or in column format) or membrane. Attachment to B is mediated by oligonucleotide E, bearing sequence a′ complementary to the extension of C, which bears a chemical moiety such as biotin that enables attachment to bead B if B is coated with a protein such as streptavidin. Non-target DNA may subsequently be washed away from B. Enzymatic or click chemistry ligation of adapter F to blunt or complementary ends of target A may be achieved while the target is bound to the bead, with excess adapter washed away, to yield target-Cpf1-bead assembly G. Sequencing or detection of the target A is then achieved by delivering assembly G to a flowcell containing membrane H. and cholesterol-modified oligonucleotide tether I, which hybridises to adaptor F via sequence t′, complementary to t. Assembly G may be delivered to the membrane by gravity, or by an applied magnetic field if for instance bead B is paramagnetic.



FIG. 52 shows a hypothetical example in which a ‘paired-adaptor’ pulldown is performed, such as that described in Example 13. A target DNA analyte A (bearing target sequences y and z) is mixed with a non-target DNA analyte B at varying concentrations of A ranging from zero to hundreds of nanograms. C as described in Example 8 is a dCas9-tracrRNA-crRNA complex bearing a DNA extension on the crRNA that carries a nanopore sequencing adapter and optional barcode sequence b. D is a dCas9-tracrRNA-crRNA complex bearing a DNA extension on the crRNA that carries a sequence t that enables the crRNA to be tethered to a surface. Addition of species C and D to the mixture of A and B allows detection of A in the background of B. Only target molecules bearing sequences y and z are both tethered via cholesterol modified oligonucleotide E (with sequence t′ complementary to the extension t of D) to membrane surface F and carry an enzyme adapter that permits detection of the target analyte. Nanopore capture of G is therefore enhanced over capture of H. Capture of G and H by nanopore J is measured electronically. K shows an example nanopore current trace punctuated by capture event L1 and open-pore current L2. The frequency of L1 is dependent on the concentration of species G on the membrane and the background level of H in solution. M shows a hypothetical plot of the frequency of event L1 against the concentration of target analyte A. N shows the level of background capture of species ‘G’ from solution and thus is the ‘false-positive’ rate.


DETAILED DESCRIPTION OF THE INVENTION

It is to be understood that different applications of the disclosed products and methods may be tailored to the specific needs in the art. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments of the invention only, and is not intended to be limiting.


In addition as used in this specification and the appended claims, the singular forms “a”, “an”, and “the” include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to “a polynucleotide” includes two or more polynucleotides, reference to “an anchor” refers to two or more anchors, reference to “a helicase” includes two or more helicases, and reference to “a transmembrane pore” includes two or more pores and the like.


All publications, patents and patent applications cited herein, whether supra or infra, are hereby incorporated by reference in their entirety.


Methods

The invention provides a method of detecting a target polynucleotide in a sample comprising: (a) contacting the sample with a guide polynucleotide that binds to a sequence in the target polynucleotide and a polynucleotide-guided effector protein, wherein the guide polynucleotide and polynucleotide-guided effector protein form a complex with any target polynucleotide present in the sample; (b) contacting the sample with a membrane comprising a transmembrane pore; (c) applying a potential difference across the membrane; and (d) monitoring for the presence or absence of an effect resulting from the interaction of the complex with the transmembrane pore to determine the presence or absence of the complex, thereby detecting the target polynucleotide in the sample. Step (a) and (b) may be carried out simultaneously or sequentially in either order.


The method may comprise (a) contacting the sample with a guide polynucleotide that binds to a sequence in the target polynucleotide and a polynucleotide-guided effector protein to form a complex, wherein the sample is in contact with a membrane comprising a transmembrane pore and wherein a potential is applied to the transmembrane pore; and (b) taking one or more measurements as at least a portion of the complex moves with respect to the transmembrane pore to detect the presence or absence of the complex, thereby detecting the target polynucleotide in the sample.


In some embodiments, the method comprises: (a) contacting the sample with a guide polynucleotide that binds to a sequence in the target polynucleotide, a polynucleotide-guided effector protein and a membrane comprising a transmembrane pore; (b) applying a potential difference across the membrane; and (c) measuring the ion flow passing through the transmembrane pore, or other signal resulting from the interaction of the sample, guide polynucleotides and polynucleotide-guided effector proteins with the transmembrane pore, to determine the presence or absence of a complex comprising the guide polynucleotide, polynucleotide-guided effector protein and the target polynucleotide, thereby detecting the target polynucleotide in the sample. Measurement of ion flow may comprise measurement of the current flow through the pore.


The methods can be carried out in a number of different ways. The methods can be used to perform a variety of different applications. The methods may be used, for example, to determine the presence or absence of a single target polynucleotide, or of a number of target polynucleotides. The methods may be quantitative. For example, the amount (such as the concentration) of the target polynucleotide present in a sample may be determined using a method of the invention and/or relative amounts of different polynucleotides present in a sample may be determined. The methods can provide further information about a target polynucleotide, such as the presence or absence of a polymorphism and/or the identity of a polymorphism.


The method may comprise determining whether an adaptor attached to the guide polynucleotide interacts with the transmembrane pore. The method may be carried out such that guide polynucleotides comprising adaptors that are not bound to the target polynucleotide do not interact with the transmembrane pore. Typically such unbound guide polynucleotides are washed away before a transmembrane potential is applied to the membrane. The target polynucleotide may be tethered to a surface, for example to the membrane, to prevent bound guide polynucleotides comprising adaptors from being washed away. The target polynucleotide may have a tether, such as a membrane anchor, attached to it directly, for example, to one of its ends. Alternatively, a second guide polynucleotide/polynucleotide-guided effector protein which comprises a tether, such as a membrane anchor, may be used to tether the target polynucleotide to the surface, for example to the membrane.


The surface to which the target polynucleotide is tethered may be a bead.


The adaptor is typically unique to the target polynucleotide and produces a distinct signal on interacting with a transmembrane pore. Multiple guide polynucleotides, each selective for a different target polynucleotide and having a different adaptor may be added to the sample to detect and/or quantify different target polynucleotides on the basis of the different signals caused by the different adaptors interacting with the transmembrane pore. In this embodiment, the adaptors may be considered to comprise barcodes.


The method may use multiple guide polynucleotides that bind to different polynucleotide sequences. The different polynucleotide sequences may, for example, be different sequences in the same target polynucleotide (e.g. different portions of the target polynucleotide), sequences of different target polynucleotides or alternative sequences within a target polynucleotide, such as sequences that encompass polymorphisms, for example single nucleotide polymorphisms (SNPs).


In some embodiments, the method may comprise further characterizing the target polynucleotide. For example, the method may comprise sequencing all or part of the target polynucleotide.


In some embodiments, the method may comprise detecting the presence, absence or amount of a target polynucleotide using two or more guide polynucleotides and/or two or more polynucleotide-guided effector proteins which bind to different regions of the target polynucleotide, wherein binding of two different guide polynucleotide/polynucleotide-guided effector proteins to the target polynucleotide results in a detectable signal, for example a detectable current change, through a transmembrane pore if the target polynucleotide is present in the sample. The signal may be characteristic of an adaptor in one of the guide polynucleotides/polynucleotide-guided effector complexes, with the signal only or primarily being observed when that guide polynucleotide is “linked” to a second guide polynucleotide/polynucleotide-guided effector protein comprising a membrane anchor, and this “linkage” occurs when both guide polynucleotides/polynucleotide-guided effector proteins are bound to the target polynucleotide. In other words, the target polynucleotide serves to “link” the guide polynucleotides/polynucleotide-guided effector complex comprising an adaptor to the guide polynucleotides/polynucleotide-guided effector complex comprising a membrane anchor. In the embodiment wherein the polynucleotide-guided effector protein comprises a membrane anchor, attachment may be via the protein itself, for example by use of a strep-tag/flag-tag/his-tag.


In some embodiments, the method may comprise selectively characterizing, for example sequencing, target polynucleotides using a transmembrane pore by marking each target polynucleotide with a guide polynucleotide/polynucleotide-guided effector protein complex specific for the target polynucleotide such that the target polynucleotide can be selectively sequenced without needing to separate the target polynucleotide from other polynucleotides in the sample prior to contacting the sample with the transmembrane pore.


For example, the guide polynucleotide/polynucleotide-guided effector protein complex may be tagged with a membrane anchor so that only target polynucleotides are tethered to the membrane. Other polynucleotides in the sample may be washed away. Alternatively, a polynucleotide binding protein capable of moving along a polynucleotide may be bound to the end of the polynucleotides in the sample, for example using techniques known in the art, and the polynucleotide binding protein may be caused to move along the polynucleotides after complex formation, for example by adding a cofactor necessary for movement of the polynucleotide binding protein. In this embodiment, the bound guide polynucleotide/polynucleotide-guided effector protein complex stalls the polynucleotide binding protein on the target polynucleotide, whilst the polynucleotide binding protein is processed off the ends of non-target polynucleotides. Then, when the transmembrane potential is applied, the force of the potential and the contact with the pore displaces the bound guide polynucleotide/polynucleotide-guided effector protein complex from the target polynucleotides so that the target polynucleotide translocates through the pore. The non-target polynucleotides to which no polynucleotide binding protein is bound pass through the pore so rapidly that no signal is detected, or so that any signal obtained can easily be discriminated from signals resulting from the interaction of the target polynucleotide with the pore. The 3′-terminated strands of the polynucleotides in the sample, including both target and non-target polynucleotides, may be degraded, for example using an exonuclease. In this way the target polynucleotide can be selectively characterized, for example sequenced. The polynucleotide binding protein may be caused to move along the polynucleotides by adding a cofactor, such as ATP or another nucleoside for example and γsGTP.


In another embodiment, the polynucleotide-guided effector protein can be used to cut the polynucleotide at a selected point. This may be used to limit the information, such as sequence information, obtained by the method about a region of interest. For example, two polynucleotide-guided effector proteins with nuclease activity may be used to obtain a polynucleotide fragment of interest as shown in FIG. 27. As an alternative, a modified polynucleotide-guided effector protein having inactivated or disabled nuclease activity may be used to stall a polynucleotide binding protein as described above and a second polynucleotide-guided effector protein may be used to truncate the fragment being characterized. This embodiment is, for example, particularly useful in V(D)J repertoire analysis applications.


Further, in some embodiments, the guide polynucleotide/polynucleotide-guided effector protein complex tags or labels the target polynucleotide such that the effect of the guide polynucleotide/polynucleotide-guided effector protein complex on the current passing through the pore can be used to determine the presence or absence of, quantify or identify the target polynucleotide.


For example, the guide polynucleotide or polynucleotide-guided effector protein may be attached to an adaptor that may be used to identify a target polynucleotide tagged with a membrane anchor because the adaptor will only interact with the transmembrane pore when it is bound to the target polynucleotide tethered to the membrane. Unbound guide polynucleotides and polynucleotide-guided effector proteins may be washed away. Multiple guide polynucleotides, each selective for a different target polynucleotide and having a different adaptor may be added to the sample to detect and/or quantify different target polynucleotides on the basis of the different signals caused by the different adaptors interacting with the transmembrane pore.


Alternatively, the guide polynucleotide/polynucleotide-guided effector protein complex bound to the target polynucleotide may produce a detectable signal when the target polynucleotide passes through a transmembrane pore. Where the transmembrane pore is too small to allow the passage of the guide polynucleotide/polynucleotide-guided effector protein, for example a pore that allows the passage of a single stranded but not a double-stranded polynucleotide, the movement of the polynucleotide through the pore is blocked when the guide polynucleotide/polynucleotide-guided effector protein reaches the pore. This affects the current passing through the pore and allows the presence of the guide polynucleotide/polynucleotide-guided effector protein/target polynucleotide complex to be detected. For example, the guide polynucleotide/polynucleotide-guided effector protein complex may be stripped off the target polynucleotide by the force of the pore and applied potential (as the target polynucleotide is pulled through the pore by the applied potential the guide polynucleotide/polynucleotide-guided effector protein complex is brought into contact with the pore and the continued pull on the target polynucleotide forces the guide polynucleotide/polynucleotide-guided effector protein complex against the pore such that the guide polynucleotide/polynucleotide-guided effector protein complex is forced off (i.e. is caused to unbind from) the target polynucleotide), causing a detectable stutter in the current. Two or more guide polynucleotide/polynucleotide-guided effector protein complexes binding to different parts of a target polynucleotide may be used in the method. When each of the bound polynucleotide/polynucleotide-guided effector protein complexes reaches the pore it will cause a stutter. Thus multiple guide polynucleotide/polynucleotide-guided effector protein complexes may be used to identify a target polynucleotide. For example, one or more guide polynucleotide may be designed to bind to the target polynucleotide only if a particular polymorphism is present in the target polynucleotide. The number of stutters observed as the polynucleotide passes through the pore, or the presence or absence of a particular stutter as the polynucleotide passes through the pore may indicate the presence or absence of the polymorphism.


When the transmembrane pore is sufficiently large to allow the passage of double stranded polynucleotides and bound guide polynucleotide/polynucleotide-guided effector protein complex, the passage of the double stranded polynucleotide/guide polynucleotide/polynucleotide-guided effector protein complex through the pore will produce a recognisable signal when the guide polynucleotide/polynucleotide-guided effector protein complex passes through the pore. Thus one or more guide polynucleotide/polynucleotide-guided effector protein complex may be used to identify a target polynucleotide. For example, a guide polynucleotide may be designed to bind only if a particular polymorphism is present in the target polynucleotide. The number of signals attributable to bound guide polynucleotide/polynucleotide-guided effector protein complexes observed as the target polynucleotide passes through the pore, or the presence or absence of a particular signal as the target polynucleotide passes through the pore may indicate the presence or absence of the polymorphism. Nanopores that allow the passage of double stranded polynucleotides and bound polynucleotides/polynucleotide-guided effector proteins include, for example, nanocapillaries. Hence, in this embodiment the pore may not be contained in a membrane. One or more of the guide polynucleotide, polynucleotide-guided effector protein and/or target polynucleotide are typically modified to enable the method to be carried out. Thus, the invention also provides modified guide polynucleotides, polynucleotide-guided effector proteins, guide polynucleotide/polynucleotide-guided effector protein complexes, and panels of such polynucleotide guides and effector molecules suitable for use in the invention.


The method may further comprise determining the amount of the target polypeptide or one or more characteristics of the target polynucleotide. The one or more characteristics are typically selected from (i) the length of the target polynucleotide, (ii) the identity of the target polynucleotide, (iii) the sequence of the target polynucleotide, (iv) the secondary structure of the target polynucleotide and (v) whether or not the target polynucleotide is modified.


Step (a) may further comprise contacting the sample with beads (e.g. microparticles) to which one or more components of the complex can bind. Alternatively, one or more of the components used in (a), e.g. the target polynucleotide, the guide polynucleotide or the polynucleotide-guided effector protein may be prebound to beads (e.g. microparticles).


The sample may be provided in an aqueous medium or alternatively the sample may be added to an aqueous medium containing the polynucleotide-guided effector protein and the guide polynucleotide. The aqueous medium will typically comprise ions to provide ion flow through the transmembrane pore upon application of a potential difference across the membrane. The aqueous medium will also typically comprise a buffer. The aqueous medium typically has a pH in the range of 6 to 9 and/or an ion concentration in the rage of from 100 to 200 mM salt, such as NaCl.


The bead is typically denser than the aqueous medium and sink through the medium to contact the membrane, thus effectively enhancing the concentration of the species attached to the anchor at the membrane surface.


In the method, the applied potential may be a voltage potential. Alternatively, the applied potential may be a chemical potential. An example of this is using a salt gradient across an amphiphilic layer. A salt gradient is disclosed, for example, in Holden et al., J Am Chem Soc. 2007 Jul. 11:129(27):8650-5.


In embodiments where displacement of the bound guide polynucleotide/polynucleotide-guided effector protein complex is not required, the guide polynucleotide and/or effector protein may be cross-linked to the target polynucleotide.


In the methods of the invention, the guide polynucleotide/polynucleotide-guided effector protein may be replaced by a probe that binds to a double-stranded polynucleotide. The probe may or may not be associated with an enzyme. For example, the probe may be a RecA-coated probe, a peptide nucleic acid (PNA), a bridged nucleic acid (BNA), a locked nucleic acid (LNA), gamma PNA, triplex DNA or a morpholino probe. The probe typically comprises a single stranded region complementary to a sequence in the target polynucleotide. The probe may comprise a double stranded region and/or secondary structures, such as loops, e.g. a hairpin loop, or a triplex. The probes typically has a length of from about 8 to about 50, about 10 to about 40, such as about 15 to about 30, preferably from about 18 to about 25, such as 19, 20, 21, 22, 23 or 24 nucleotides. The probe may have an anchor sequence capable of coupling to a membrane or an adaptor attached thereto. For example, the probe may be a guide polynucleotide/polynucleotide-guided effector protein complex, or a RecA coated probe. The probe may be a PNA, BNA, LNA, gamma PNA, triplex DNA or a morpholino probe. The probe may have a polynucleotide binding protein capable of moving along a polynucleotide attached thereto. The polynucleotide binding protein may be bound to a leader sequence comprised in the adaptor.


In the method, the guide polynucleotide/polynucleotide-guided effector protein may be replaced by a protein that binds to a polynucleotide having a specific nucleotide sequence. Proteins that bind to a polynucleotide having a specific nucleotide sequence include, for example, transcription activator-like effector nucleases and zinc finger nucleases. Such nucleases can be engineered to bind to particular sites within target polynucleotides.


In a particular embodiment, the method may be a method of detecting a target polynucleotide comprising a double stranded polynucleotide in a sample, the method comprising: (a) contacting the sample with a first probe and a second probe, wherein the first probe and the second probe form a complex with any target polynucleotide present in the sample, the first probe binds to a first sequence in the target double stranded polynucleotide and comprises an anchor capable of coupling to a membrane, and the second probe binds to a second sequence in the target double stranded polynucleotide and comprises an adaptor sequence; (b) contacting the sample with a transmembrane pore; (c) applying a potential to the transmembrane pore; and (d) monitoring for the presence or absence of an effect resulting from the interaction of the complex with the transmembrane pore to determine the presence or absence of the complex, thereby detecting the target double stranded polynucleotide in the sample. Any unbound probes may be washed away prior to step (c). Step (d) typically comprises monitoring for the interaction of the adaptor with the transmembrane pore. The first sequence and second sequence in the target polynucleotide are typically each a portion of the double stranded polynucleotide.


The second probe may further comprise a polynucleotide binding protein capable of moving along a polynucleotide. The adaptor in the second probe may comprise a leader sequence and the polynucleotide binding protein may be bound to the leader sequence, and/or the adaptor may comprise a barcode.


Step (a) of the method may comprise contacting the sample with two or more first probes, wherein the two or more probes bind to different sequences. Step (a) of the method may comprise contacting the sample and transmembrane pore with two or more second probes. Typically, the two or more second probes comprise different barcodes.


In methods using guide polynucleotides or probes binding to different sequences, those sequences may be present in different target polynucleotides, within the same target polynucleotide or may be alternative sequences, such as SNPs, that may be present in the target polynucleotide.


In one embodiment, the method uses multiple pairs, such as from 2 to 50, 3 to 40, 4 to 30, 5 to 25, 6 to 15 or 8 to 10 pairs, of first and second probes, wherein each pair binds to a different target polynucleotide. In an alternate embodiment, the method may use a single first probe and multiple second probes, which can be used to identify different or alternative sequences within a target polynucleotide.


The method may be used to detect one or more, such as 2, 3, 4, 5, 6, 7 8, 9, 10, 20, 30 or more, target polynucleotides in a complex background following enrichment of the target molecule. In one embodiment sequencing, e.g. nanopore sequencing, is used for the detection. Hence in this embodiment, the target DNA molecule may be identified primarily by its sequence.


The method may be carried out as a multiplex assay. The multiplex assay may utilize different barcodes. The barcodes may, for example, each have a distinct nucleotide sequence enabling the barcodes to be identified by a nanopore. In one embodiment a barcode sequence may be ligated to all polynucleotides in a sample, prior to contacting the sample with the guide polynucleotide and polynucleotide-guided binding protein. A second barcode can be added to a second sample, prior to contacting the sample with the guide polynucleotide and polynucleotide-guided binding protein. The first and second samples can be combined prior to or after addition of the guide polynucleotide and polynucleotide-guided binding protein, preferably after the guide polynucleotide and polynucleotide-guided binding protein have bound to the target polynucleotides. Where pooling of the samples occurs after the guide polynucleotide and polynucleotide-guided binding protein have bound to the target polynucleotides, purification steps (including stress, removal of non-target bound protein, and/or removal of non-target polynucleotides) may be carried out prior to or after pooling. Multiple sample, such as 2, 3, 4, 5, 6, 7 8, 9, 10, 20, 30 samples, can be labelled with barcodes and then combined in this way. In this embodiment all the samples can be sequenced simultaneously, e.g. using the same flowcell, and identified using their barcode adapter.


In another embodiment, barcodes and sequencing adapters may be added after the guide polynucleotide and polynucleotide-guided binding protein have bound to the target polynucleotides. For example, the barcodes and sequencing adaptors may be ligated on beads. The target-loaded, barcoded, adapted beads may be added to the sample after the guide polynucleotide and polynucleotide-guided binding protein have bound to the target polynucleotides and optionally after one or more purification staps (such as stress, removal of non-target bound protein, and/or removal of non-target polynucleotides) have been carried out.


The method may comprise removing any polynucleotide-guided effector protein and/or guide polynucleotide, e.g. guide polynucleotide/polynucleotide guided effector protein complex, that is not specifically bound to the target polynucleotide. The excess polynucleotide-guided effector protein and/or guide polynucleotide, e.g. guide polynucleotide/polynucleotide guided effector protein complex, present in the sample, which is not bound to target polynucleotide can produce background when monitoring the interaction of the target polynucleotide/guide polynucleotide/polynucleotide guided effector protein complex with the pore. Guide polynucleotide, polynucleotide-guided effector protein and/or polynucleotide-guided effector protein/guide polynucleotide complex that is not specifically bound to the target polynucleotide may be separated from the complex comprising the guide polynucleotide, polynucleotide-guided effector protein and target polynucleotide by binding the polynucleotides in the sample a surface, e.g. beads or a column. The target polynucleotides may also be separated from non-target polynucleotides in the sample by binding the guide polynucleotide, polynucleotide-guided effector protein and/or polynucleotide-guided effector protein/guide polynucleotide complex in the sample to a surface, e.g. beads or a column. The target polynucleotide(s) may, for example, be separated from the background by means of a ‘pulldown’ via a capture moiety on the guide polynucleotide/polynucleotide-guided effector protein complex.


The method may comprise selectively denaturing any polynucleotide-guided effector protein that is not specifically bound to the target polynucleotide prior to step (b). ‘Off-target’ effects of guide polynucleotide/polynucleotide-guided effector protein complex binding may be reduced by applying a thermal and/or chemical stress to the bound guide polynucleotide/polynucleotide-guided effector protein complex. Typically, in this embodiment, non-target bound polynucleotide-guided effector protein is selectively denatured by the heat stress or chemical stress applied. The applied heat or chemical treatment can be selected such that only free polynucleotide-guided effector protein (i.e. polynucleotide-guided effector protein that is not bound to polynucleotides in the sample, but which may be bound to guide polynucleotide) and non-target bound polynucleotide-guided effector protein (i.e. polynucleotide-guided effector protein that is bound non-specifically to polynucleotides in the sample, or “off target” polynucleotide-guided effector protein) is denatured. Target-bound polynucleotide-guided effector protein remains bound to the target polynucleotide during the heat stress or chemical stress. Any off-target polynucleotide-guided effector protein is released from its non-specific binding to the polynucleotides in the sample. In one embodiment, only polynucleotide-guided effector protein bound to a target sequence that is exactly complementary to the corresponding sequence in the guide polynucleotide remains bound to a polynucleotide during the stress.


Any suitable chemical stress can be used, such as urea (e.g. up to 6M, 5M or 4M), guanidinium hydrochloride, extreme pH (acidic or alkaline, such as below pH6, pH5 or pH4 or above pH8, pH9 or pH10) or high salt concentrations. Suitable conditions may readily be determined by the skilled person.


The chemical stress may be carried out for any time period that results in the selective disruption of non-specific binding of polynucleotide-guided effector protein to polynucleotides, without disrupting specific binding of polynucleotide-guided effector protein to target polynucleotide. The chemical stress may be carried out for from about 30 seconds to about 10 minutes, such as for about 1 minute, about 2 minutes, about 3 minutes, about 5 minutes, about 6 minutes, about 7 minutes, about 8 minutes or about 9 minutes.


The heat stress may be carried out at any suitable temperature. Typically the temperature is high enough to disrupt non-specific binding of polynucleotide-guided effector protein to polynucleotides, but is low enough that specific binding of polynucleotide-guided effector protein to target polynucleotide is not disrupted. For example, the sample may be heated to a temperature of from about 40° C. to about 65° C., about 45° C. to about 65° C., about 50° C. to about 60° C., such as about 55° C.


The heat stress may be carried out for any time period that results in the selective disruption of non-specific binding of polynucleotide-guided effector protein to polynucleotides, without disrupting specific binding of polynucleotide-guided effector protein to target polynucleotide. The heat stress may be carried out for from about 30 seconds to about 10 minutes, such as for about 1 minute, about 2 minutes, about 3 minutes, about 5 minutes, about 6 minutes, about 7 minutes, about 8 minutes or about 9 minutes.


A purification step may be used to remove excess, unbound polynucleotide-guided effector protein and/or guide polynucleotide. This may be achieved, for example, by adding polyethylene glycol (PEG) and sodium chloride to the sample and contacting the sample with paramagnetic beads coated with carboxyl groups such that the polynucleotides present in the sample bind to the beads. Suitable beads include commercially available SPRI beads and standard protocols known in the art may be used. In one embodiment, the target polynucleotide/guide polynucleotide/polynucleotide-guided effector protein complex may subsequently be separated from non-target polynucleotides using a surface, e.g. a different capture bead. Typically, here the guide polynucleotide/polynucleotide-guided effector protein may contain a binding moiety that is used to specifically bind the target polynucleotide/guide polynucleotide/polynucleotide-guided effector protein complex to the surface. Any non-bound polynucleotides may be washed away. The target polynucleotide/guide polynucleotide/polynucleotide-guided effector protein complex may be eluted from the surface by any suitable means, or the surface may be used to deliver the complex to a pore, e.g. where the surface is beads.


‘Off-target’ effects may be minimised further by purification the target polynucleotide/guide polynucleotide/polynucleotide-guided effector protein complexes on a capture surface using a first binding moiety on the guide polynucleotide/polynucleotide-guided effector protein, e.g. on the guide polynucleotide, eluting the target polynucleotide/guide polynucleotide/polynucleotide-guided effector protein complexes and transferring the target polynucleotide/guide polynucleotide/polynucleotide-guided effector protein complexes to a second specific capture surface using a second binding moiety on the guide polynucleotide/polynucleotide-guided effector protein, e.g. on the guide polynucleotide. This can be achieved, for example, where the first binding moiety and the second binding moiety are both end extensions, or other single stranded polynucleotide sequences capable of binding to an oligonucleotide, on the guide polynucleotide. The first end extension on the guide polynucleotide has a sequence complementary to a first capture oligonucleotide on a first capture surface, e.g. a bead, and the second end extension on the guide polynucleotide has a sequence complementary to a second capture oligonucleotide on a second capture surface, e.g. a bead. One way of configuring this is depicted in FIG. 44. In FIG. 44, the crRNA comprises a 3′ DNA extension used for capture of the target molecule on a bead, column or surface (sequence d of FIG. 44) and the tracrRNA comprises a 5′ DNA extension (sequence a⋅c of FIG. 44). The release of the target from the first capture surface, e.g. a bead, may be effected by the phenomenon known as toehold displacement.


The target polynucleotide/guide polynucleotide/polynucleotide-guided effector protein complex is first separated from non-target polynucleotides by capture on beads bearing a first capture oligonucleotide complementary to the first end extension. Non-target polynucleotides are washed away. The target polynucleotide/guide polynucleotide/polynucleotide-guided effector protein complex may be eluted from the bead by toehold displacement, via the addition of a competitor oligonucleotide that competes for the binding to the bead with the first end extension on the guide polynucleotide. In this embodiment, the first capture oligonucleotide is longer than the first end extension and comprises a first sequence and a second sequence, wherein the first sequence is complementary to a sequence in the first end extension and the first and second sequences are both complementary to the sequence of the competitor oligonucleotide. Typically the first sequence has a length of from 5 to 40, such as 10 to 30 or 15 to 25 nucleotides, for example 20 nucleotides and the second sequence has a length of from 5 to 40, such as 10 to 30 or 15 to 25 nucleotides, for example 20 nucleotides. The competitor oligonucleotide may have a length of from 10 to 80, such as 20 to 60 or 30 to 50 nucleotides, for example 40 nucleotides. The first capture oligonucleotide may have a length of from 10 to 80, such as 20 to 60 or 30 to 50 nucleotides, for example 40 nucleotides. The capture oligonucleotide may have the same length as the competitor oligonucleotide, or the capture oligonucleotide may be longer or shorter than the competitor oligonucleotide, provided that capture oligonucleotide and competitor oligonucleotide have sequences that are complementary over both the first and second sequences. In this embodiment, the first end extension comprises an end portion, which is at the 5′ end in a 5′ end extension or at the 3′ end in a 3′ end extension, which has a sequence that is not complementary to a sequence in the first capture oligonucleotide, and a portion that has a sequence that is complementary to the first sequence in the first capture oligonucleotide. The end portion of the first end extension may typically have a length of from 2 to 10 nucleotides, such as 3, 4, 5 or 6 nucleotides. The portion of the first end extension that is complementary to the first capture oligonucleotide may typically have a length of from 5 to 40, such as 10 to 30 or 15 to 25 nucleotides, for example 20 nucleotides.


Following elution of the target polynucleotide/guide polynucleotide/polynucleotide-guided effector protein complex, the complex is bound to a second ‘delivery’ bead via second end extension on the guide polynucleotide. The second ‘delivery’ bead comprises a second capture oligonucleotide that is complementary to the second end extension. The second capture oligonucleotide may have a length of from 5 to 40, such as 10 to 30 or 15 to 25 nucleotides, for example 20 nucleotides or a length of from 10 to 80, such as 20 to 60 or 30 to 50 nucleotides, for example 40 nucleotides. The second end extension may have a length of from 5 to 40, such as 10 to 30 or 15 to 25 nucleotides, for example 20 nucleotides. The second capture oligonucleotide may have the same length as the second end extension, or the second capture oligonucleotide may be longer or shorter than the end extension, provided that second capture oligonucleotide and second end extension have sequences that are complementary over a length of from 5 to 40, such as 10 to 30 or 15 to 25 nucleotides, for example 20 nucleotides. The second end extension has a sequence that does hybridise to the first capture nucleotide, the first end extension or the competitor oligonucleotide. The second capture oligonucleotide also has a sequence that does hybridise to the first capture nucleotide, the first end extension or the competitor oligonucleotide.


Accordingly, where the guide polynucleotide comprises a first end extension and a second end extension, and the method may comprise prior to step (b):

    • (i) contacting the sample with a surface having bound thereto a first capture oligonucleotide comprising a sequence complementary to the first end extension, such that the guide polynucleotide/polynucleotide-guided effector protein/target polynucleotide complex is bound to the surface;
    • (ii) contacting the guide polynucleotide/polynucleotide-guided effector protein/target polynucleotide complex bound to the surface with a competitor oligonucleotide, such that the guide polynucleotide/polynucleotide-guided effector protein/target polynucleotide complex is released from the surface;
    • (iii) contacting the guide polynucleotide/polynucleotide-guided effector protein/target polynucleotide complex with beads having bound thereto a second capture oligonucleotide comprising a sequence complementary to the second end extension, such that the guide polynucleotide/polynucleotide-guided effector protein/target polynucleotide complex is bound to the beads; and optionally
    • (iv) delivering the beads to the transmembrane pore.


In different embodiments of the invention, there may be: (i) no heat or chemical stress, purification to remove excess, unbound and/or non-target bound polynucleotide-guided effector protein or toehold purification; (ii) only heat or chemical stress; (iii) only purification to remove excess, unbound and/or non-target-bound polynucleotide-guided effector protein; (iv) only toehold purification; (v) heat or chemical stress and purification to remove excess, unbound and/or non-target-bound polynucleotide-guided effector protein; (vi) heat or chemical stress and toehold purification; (vii) purification to remove excess, unbound and/or non-target-bound polynucleotide-guided effector protein and toehold purification; or (viii) heat or chemical stress, purification to remove excess, unbound and/or non-target-bound polynucleotide-guided effector protein and toehold purification.


The beads to which the target polynucleotide/guide polynucleotide/polynucleotide-guided effector protein complex is bound may be used to deliver the complex to a pore. For example, the beads may be magnetic and the target polynucleotide bound to the beads may be drawn into the wells of a flowcell comprising the pore by the application of a magnetic field placed underneath the flowcell, or can be allowed to settle by gravity. Sequencing can be initiated by flowing tether, such as an oligonucleotide-cholesterol tether which hybridizes to the adaptor ends, over the beads, which tethers the beads to the membrane. Alternatively, the tether can be introduced into the membrane before the bead-target polynucleotide conjugate is added. For example, an oligonucleotide-cholesterol tether which hybridizes to the adaptor ends may be integrated into the membrane in the flowcell by flowing running buffer and the tether through the flowcell before the beads-target polynucleotide(s) are added. In this situation, when the beads-target polynucleotide(s) are added to the flowcell, they become tethered to the membrane when they encounter the oligonucleotide that is anchored in the membrane by the cholesterol.


In some embodiments, the target polynucleotides may be adapted for nanopore sequencing. For example, all of the polynucleotides in the sample may have sequencing adaptors added to one or both ends prior to step (a) of the method. The polynucleotides in the sample may be fragmented prior to addition of the sequencing adaptors. Alternatively, the target polynucleotides may have sequencing adaptors added to one or both ends after step (a). In this embodiment, the sequencing adaptors may be added before or after separation of the target from non-target polynucleotides. The sequencing adaptor typically comprises a polynucleotide binding protein that is capable of moving along the polynucleotide. When the sequencing adaptor is added after step (a) the polynucleotide-guided effector protein/guide polynucleotide complex remains bound to the target polynucleotide. After binding of the adaptor, in some embodiments, generally where the target polynucleotide has been separated from non-target polynucleotides prior to adaptor addition, the polynucleotide-guided effector protein/guide polynucleotide complex may be displaced by the polynucleotide binding protein that is capable of moving along the polynucleotide loaded on the adaptor. Displacement of the polynucleotide-guided effector protein/guide polynucleotide complex by the polynucleotide binding protein that is capable of moving along the polynucleotide can be controlled by the addition of one or more cofactor needed for the polynucleotide binding protein to moving along a polynucleotide.


The target polynucleotide may be adapted for nanopore sequencing by ligation of adaptors to either or both of its free ends whilst bound to the surface, e.g. column or beads, via the guide polynucleotide/polynucleotide-guided effector protein. The ends may be dA-tailed to facilitate adaptor binding.


Target Polynucleotide

The polynucleotide can be a nucleic acid, such as deoxyribonucleic acid (DNA) or ribonucleic acid (RNA). The polynucleotide can comprise one strand of RNA hybridised to one strand of DNA. The polynucleotide may be any synthetic nucleic acid known in the art, such as peptide nucleic acid (PNA), glycerol nucleic acid (GNA), threose nucleic acid (TNA), locked nucleic acid (LNA) or other synthetic polymers with nucleotide side chains. The PNA backbone is composed of repeating N-(2-aminoethyl)-glycine units linked by peptide bonds. The GNA backbone is composed of repeating glycol units linked by phosphodiester bonds. The TNA backbone is composed of repeating threose sugars linked together by phosphodiester bonds. LNA is formed from ribonucleotides as discussed above having an extra bridge connecting the 2′ oxygen and 4′ carbon in the ribose moiety.


The polynucleotide is preferably DNA, RNA or a DNA or RNA hybrid, most preferably DNA. The target polynucleotide comprises a double stranded region to which the guide-polynucleotide and polynucleotide-guided effector protein bind. The target polypeptide may be double stranded. The target polypeptide may comprise single stranded regions and regions with other structures, such as hairpin loops, triplexes and/or quadruplexes. The DNA/RNA hybrid may comprise DNA and RNA on the same strand. Preferably, the DNA/RNA hybrid comprises one DNA strand hybridized to a RNA strand.


The target polynucleotide can be any length. For example, the polynucleotides can be at least 10, at least 50, at least 100, at least 150, at least 200, at least 250, at least 300, at least 400 or at least 500 nucleotides or nucleotide pairs in length. The target polynucleotide can be 1000 or more nucleotides or nucleotide pairs, 5000 or more nucleotides or nucleotide pairs in length or 100000 or more nucleotides or nucleotide pairs in length. The target polynucleotide may be an oligonucleotide. Oligonucleotides are short nucleotide polymers which typically have 50 or fewer nucleotides, such 40 or fewer, 30 or fewer, 20 or fewer, 10 or fewer or 5 or fewer nucleotides. The target oligonucleotide is preferably from about 15 to about 30 nucleotides in length, such as from about 20 to about 25 nucleotides in length. For example, the oligonucleotide can be about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 26, about 27, about 28, about 29 or about 30 nucleotides in length.


The target polynucleotide may be a polynucleotide associated with a disease and/or a microorganism.


The method may detect multiple, such as from 2 to 50, 3 to 40, 4 to 30, 5 to 25, 6 to 15 or 8 to 10, target polynucleotides. The target polynucleotides may be a group of polynucleotides. For instance, the group may be associated with a particular phenotype. The group may be associated with a particular type of cell. For instance, the group may be indicative of a bacterial cell. The group may be indicative of a virus, a fungus, a bacterium, a mycobacterium or a parasite.


The target polynucleotides may be a group of two or more polynucleotides that are, or comprise, biomarkers associated with a particular disease or condition. The biomarkers can be used to diagnose or prognose the disease or condition. Suitable panels of biomarkers are known in the art, for example as described in Edwards, A. V. G. et al. (2008) Mol. Cell. Proteomics 7, p 1824-1837: Jacquet, S. et al. (2009), Mol. Cell. Proteomics 8, p 2687-2699; Anderson N. L. et al (2010) Clin. Chem. 56, 177-185. The disease or condition is preferably cancer, heart disease, including coronary heart disease and cardiovascular disease, or an infectious disease, such as tuberculosis or sepsis.


The target oligonucleotide or polynucleotide is preferably a microRNA (or miRNA) or a small interfering RNA (siRNA). The group of two or more target polynucleotides may be a group of two or more miRNAs. Suitable miRNAs for use in the invention are well known in the art. For instance, suitable miRNAs are stored on publically available databases (Jiang Q., Wang Y., Hao Y., Juan L., Teng M., Zhang X., Li M., Wang G., Liu Y., (2009) miR2Disease: a manually curated database for microRNA deregulation in human disease. Nucleic Acids Res.).


Polynucleotide-Guided Effector Protein

The polynucleotide-guided effector protein may be any protein that binds to a guide-polynucleotide and which binds to the polynucleotide to which the guide polynucleotide binds. The polynucleotide-guided effector protein may, by way of non-limiting example, comprise a target polynucleotide recognition domain and at least one nuclease domain. The recognition domain binds a guide polynucleotide (e.g. RNA) and a target polynucleotide (e.g. DNA). The polynucleotide-guided effector protein may contain one nuclease domain that cuts one or both strands of a double stranded polynucleotide, or may contain two nuclease domains wherein a first nuclease domain is positioned for cleavage of one strand of the target polynucleotide and a second nuclease domains is positioned for cleavage of the complementary strand of the target polynucleotide. The nuclease domains may be active or inactive. For example, the nuclease domain or one or both of the two nuclease domains may be inactivated by mutation.


The guide polynucleotide may be a guide RNA, a guide DNA, or a guide containing both DNA and RNA. The guide polynucleotide is preferably a guide RNA. Therefore the polynucleotide-guided effector protein is preferably a RNA-guided effector protein.


The RNA-guided effector protein may be any protein that binds to the guide-RNA. The RNA-guided effector protein typically binds to a region of guide RNA that is not the region of guide RNA which binds to the target polynucleotide. For example, where the guide RNA comprises crRNA and tracrRNA, the RNA-guided effector protein typically binds to the tracrRNA and the crRNA typically binds to the target polynucleotide. The RNA-guided effector protein preferably also binds to a target polynucleotide. The region of the guide RNA that binds to the target polynucleotide may also bind to the RNA-guided effector protein. The RNA-guided effector protein typically binds to a double stranded region of the target polynucleotide. The region of the target polynucleotide to which the RNA-guided effector protein binds is typically located close to the sequence to which the guide RNA hybridizes. The guide RNA and RNA-guided effector protein typically form a complex, which complex then binds to the target polynucleotide at a site determined by the sequence of the guide RNA.


The RNA-guided effector protein may bind upstream or downstream of the sequence to which the guide RNA binds. For example, the RNA-guided effector protein may bind to a protospacer adjacent motif (PAM) in DNA located next to the sequence to which the guide RNA binds. A PAM is a short (less than 10, typically a 2 to 6 base pair) sequence, such as 5′-NGG-3′ (wherein N is any base), 5′-NGA-3′, 5′-YG-3′ (wherein Y is a pyrimidine), 5′TTN-3′ or 5′-YTN-3′. Different RNA-guided effector proteins bind to different PAMs. RNA-guided effector proteins may bind to a target polynucleotide which does not comprise a PAM, in particular, where the target is RNA or a DNA/RNA hybrid.


The RNA-guided effector protein is typically a nuclease, such as a RNA-guided endonuclease. The RNA-guided effector protein is typically a Cas protein. The RNA-guided effector protein may be Cas, Csn2, Cpf1, Csf1, Cmr5, Csm2, Csy1, Cse1 or C2c2. The Cas protein may Cas3, Cas 4, Cas8a, Cas8b, Cas8c, Cas9, Cas10 or Cas10d. Preferably, the Cas protein is Cas9. Cas, Csn2, Cpf1, Csf1, Cmr5, Csm2, Csy1 or Cse1 is preferably used where the target polynucleotide comprises a double stranded DNA region. C2c2 is preferably used where the target polynucleotide comprises a double stranded RNA region.


A DNA-guided effector protein, such as proteins from the RecA family may be used to target DNA. Examples of proteins from the RecA family that may be used are RecA, RadA and Rad51. The nuclease activity of the RNA-guided endonuclease may be disabled. One or more of the catalytic nuclease sites of the RNA-guided endonuclease may be inactivated. For example, where the RNA-guided endonuclease comprises two catalytic nuclease sites, one or both of the catalytic sites may be inactivated. Typically one of the catalytic sites will cut one strand of the polynucleotide to which it specifically binds and the other catalytic site will cut the opposite strand of the polynucleotide. Therefore, the RNA-guided endonuclease may cut both strands, one strand or neither strand of a double stranded region of a target polynucleotide.


The polynucleotide-guided effector protein may, by way of non-limiting example, be Cas9. Cas9 has a bi-lobed, multi-domain protein structure comprising target recognition and nuclease lobes. The recognition lobe binds guide RNA and DNA. The nuclease lobe contains the HNH and RuvC nuclease domains which are positioned for cleavage of the complementary and non-complementary strands of the target DNA. The structure of Cas 9 is detailed in Nishimasu, H., et al., (2014) Crystal Structure of Cas9 in Complex with Guide RNA and Target DNA. Cell 156, 935-949. The relevant PDB reference for Cas9 is 5F9R (Crystal structure of catalytically-active Streptococcus pyogenes CRISPR-Cas9 in complex with single-guided RNA and double-stranded DNA primed for target DNA cleavage).


The Cas9 may be an ‘enhanced specificity’ Cas9 that shows reduced off-target binding compared to wild-type Cas9. An example of such an ‘enhanced specificity’ Cas9 is S. pyogenes Cas9 D10A/H840A/K848A/K1003A/R1060A ONLP12296 is the amino acid sequence of S. pyogenes Cas9 D10A/H840A/K848A/K1003A/R1060A having a C-terminal Twin-Strep-tag with TEV-cleavable linker.


Catalytic sites of a RNA-guided endonuclease may be inactivated by mutation. The mutation may be a substitution, insertion or deletion mutation. For example, one or more, such as 2, 3, 4, 5, or 6 amino acids may be substituted or inserted into or deleted from the catalytic site. The mutation is preferably a substitution insertion, more preferably substitution if a single amino acid at the catalytic site. The skilled person will be readily able to identify the catalytic sites of a RNA-guided endonuclease and mutations that inactivate them. For example, where the RNA-guided endonuclease is Cas9, one catalytic site may be inactivated by a mutation at D10 and the other by a mutation at H640.


An inactivated (‘dead’) polynucleotide-guided effector protein that does not cut the target polynucleotide and so shows no directionality bias. An active (‘live’) polynucleotide-guided effector protein that cuts the target polynucleotide may remain bound to just one of the two ends of the cut site and so may show some directionality bias.


The polynucleotide-guided effector protein typically remains bound to the target polynucleotide for a prolonged period. The polynucleotide-guided effector protein preferably remains bound to the target polynucleotide for from at least about 1 to at least about 10, such as about 2 to about 8 hours or about 4 to about 6 hours in the absence of a transmembrane pore and a transmembrane potential. The polynucleotide-guided effector protein may be displaced from the target polynucleotide by the interaction with a transmembrane pore under an applied potential.


In one embodiment, the polynucleotide-guided effector protein may hold the target polypeptide in the transmembrane pore for a short period whilst it is being displaced. This results in a detectable signal, that may be seen as a stutter in a trace of the current passing through the pore, but can also be detected by other means, for example by optical measurements or tunneling.


The polynucleotide-guided effector protein may have the ability to move along and slow the polynucleotide. For example, the RNA-guided effector protein may act as a sliding molecular brake. In this embodiment, the RNA-guided effector protein may be used as a motor protein to control the movement of the target polynucleotide, or the guide RNA, through the transmembrane pore.


Guide Polynucleotide

The guide polynucleotide comprises a sequence that is capable of hybridising to a target polynucleotide and is also capable of binding to a polynucleotide-guided effector protein. The guide polynucleotide may have any structure that enables it to bind to the target polynucleotide and to a polynucleotide-guided effector protein.


The guide polynucleotide typically hybridizes to a sequence of about 20 nucleotides in the target polynucleotide. The sequence to which the guide RNA binds may be from about 10 to about 40, such as about 15 to about 30, preferably from about 18 to about 25, such as 19, 20, 21, 22, 23 or 24 nucleotides. The guide polynucleotide is typically complementary to one strand of a double stranded region of the target polynucleotide. The guide polynucleotide comprises a nucleotide sequence of from about 10 to about 40, such as about 15 to about 30, preferably from about 18 to about 25, such as 19, 20, 21, 22, 23 or 24, nucleotides that is complementary to the sequence of, or to a sequence in, the target polynucleotide. The degree of complementarity is preferably exact.


The guide RNA may be complementary to a region in the target polynucleotide that is 5′ to a PAM. This is preferred where the target polynucleotide comprises DNA, particularly where the RNA effector protein is Cas9 or Cpf1. The guide RNA may be complementary to a region in the target polynucleotide that is flanked by a guanine. This is preferred where the target polynucleotide comprises RNA, particularly where the RNA effector protein is C2c2.


The guide RNA may have any structure that enables it to bind to the target polynucleotide and to a RNA-guided effector protein. The guide RNA may comprise a crRNA that binds to a sequence in the target polynucleotide and a tracrRNA. The tracrRNA typically binds to the RNA-guided effector protein. Typical structures of guide RNAs are known in the art. For example, the crRNA is typically a single stranded RNA and the tracrRNA typically has a double stranded region of which one strand is attached to the 3′ end of the crRNA and a part that forms a hairpin loop at the 3′ end of the strand that is not attached to the crRNA. The crRNA and tracrRNA may be transcribed in vitro as a single piece sgRNA.


The guide RNA may comprise other components, such as additional RNA bases or DNA bases or other nucleobases. The RNA and DNA bases in the guide RNA may be natural bases or modified bases. A guide DNA may be used in place of a guide RNA, and a DNA-guided effector protein used instead of a RNA-guided effector protein. The used of a guide DNA and a DNA-guided effector protein may be preferred where the target polynucleotide is RNA.


The guide polynucleotide may be specifically modified for use in a method of the invention. The invention provides a guide polynucleotide, particularly a guide RNA, that comprises (i) an adaptor sequence, optionally including a leader sequence or (ii) an anchor capable of coupling to a membrane.


The guide polynucleotide of the invention may be any of the guide polynucleotides discussed herein to which (i) an adaptor and/or (ii) an anchor capable of coupling to a membrane is attached.


The (i) the anchor or (ii) the adaptor may be present at the 5′ end of the tracrRNA, the 3′ end of the tracrRNA, the 3′ end of the crRNA, or internally, for example, wherein the tracrRNA and crRNA are comprised in a sgRNA. See FIGS. 2-4 and 25, for examples. The (i) the anchor or (ii) the adaptor may be added to the 5′ end of the crRNA, e.g. via a chemical group or spacer. The (i) the anchor or (ii) the adaptor may be added to the guide polynucleotide via a chemical group or spacer. The (i) the anchor or (ii) the adaptor may be attached to the 5′ or 3′ end of the guide polynucleotide, such as to the 5′ or 3′ end of a tracrRNA or the 5′ or 3′ end of a crRNA by any suitable means, e.g. ligation, via a chemical group, e.g. thiols, click groups, biotin etc., or via a DNA, RNA, PNA, BNA. LNA. TNA spacer. Where the spacer is a polynucleotide, the spacer may have a length of from 1 to 30, such as from 2 to 20, 3 to 15, 4 to 10, such as 5, 6, 7 8 or 9, nucleotides.


The anchor may be attached to an oligonucleotide (anchor oligonucleotide) that is complementary to an end extension, or an internal loop sequence, in the guide polynucleotide. The 5′ end of the tracrRNA, the 3′ end of the tracrRNA, the 3′ end of the crRNA or the 5′ end of the crRNA may have an end extension having a length of, for example, from 5 to 40, such as 10 to 30 or 15 to 25 nucleotides, for example 20 nucleotides. The anchor oligonucleotide may have the same length as the end extension, or the anchor oligonucleotide may be longer or shorter than the end extension, provided that anchor oligonucleotide and end extension have sequences that are complementary over a length of from 5 to 40, such as 10 to 30 or 15 to 25 nucleotides, for example 20 nucleotides. The anchor oligonucleotide may have a length of, for example, from 5 to 40, such as 10 to 30 or 15 to 25 nucleotides, for example 20 nucleotides. The internal loop sequence may have any of the lengths specified above.


The guide polynucleotide may be synthetically modified. Both the 5′ and 3′ ends of crRNA and tracrRNA can be modified. See Lee et al., (2017) Synthetically modified guide RNA and donor DNA are a versatile platform for CRISPR-Cas9 engineering. eLIFE;6:e25312, incorporated by reference herein. Synthetic modification may comprise incorporation of modified or artificial bases into guide RNA (or guide DNA), including DNA, RNA, PNA, LNA, BNA, DNA spacers, RNA spacers and abasic spacers e.g., Sp18. Alternatively modification may comprise modification with chemical moieties that are structurally unrelated to nucleotide bases such as planar hydrophobic molecules, chemical tags, fluorescent molecules, aptamer sequences, amines, azides, alkynes, thiols, click groups, biotins.


The guide polynucleotide of the invention may have a polynucleotide binding protein capable of moving along a polynucleotide attached thereto. The polynucleotide binding protein may be bound close to one end of a strand of the guide RNA, typically close to the 5′ end. The end to which the polynucleotide binding protein is bound is typically modified by the addition of an adaptor, preferably an adaptor comprising a leader sequence. Where the guide RNA comprises a leader sequence the polynucleotide binding protein is typically bound to the leader sequence.


Where the guide RNA comprises a crRNA, the polynucleotide binding protein may be positioned such that it is capable of moving along the crRNA. Such a guide RNA is useful in a method in which the crRNA translocates through the transmembrane pore in order to detect the presence or absence of the complex.


The guide polynucleotide may be specifically adapted to enable capture of the target polynucleotide on a surface, such as a bead or column. This allows target polynucleotides to which a guide polynucleotide/polynucleotide-guided effector protein complex is bound to be captured and separated from non-target polynucleotides in a sample, which can then be washed away. The guide polynucleotide may comprise an end extension at the 3′ or 5′ end, which has a sequence that is complementary to the sequence of a capture oligonucleotide that is bound to a surface, such as to a bead or column. For example, the capture oligonucleotide may be bound to the surface by an affinity tag. Any suitable affinity tag may be used. One example is a biotin-streptavidin affinity tag. The capture oligonucleotide may have a length of from 5 to 40, such as 10 to 30 or 15 to 25 nucleotides, for example 20 nucleotides or a length of from 10 to 80, such as 20 to 60 or 30 to 50 nucleotides, for example 40 nucleotides. The end extension may have a length of from 5 to 40, such as 10 to 30 or 15 to 25 nucleotides, for example 20 nucleotides. The capture oligonucleotide may have the same length as the end extension, or the capture oligonucleotide may be longer or shorter than the end extension, provided that capture oligonucleotide and end extension have sequences that are complementary over a length of from 5 to 40, such as 10 to 30 or 15 to 25 nucleotides, for example 20 nucleotides.


The guide polynucleotide may comprise a first binding moiety and a second binding moiety. The first binding moiety and the second binding moiety may both be end extensions, or other single stranded polynucleotide sequences capable of binding to an oligonucleotide, on the guide polynucleotide. The first end extension on the guide polynucleotide may have a sequence complementary to a first capture oligonucleotide on a first capture surface, e.g. a bead, and the second end extension on the guide polynucleotide may have a sequence complementary to a second capture oligonucleotide on a second capture surface, e.g. a bead. One way of configuring this is depicted in FIG. 44. In FIG. 44, the crRNA comprises a 3′ DNA extension used for capture of the target molecule on a bead, column or surface (sequence d of FIG. 44) and the tracrRNA comprises a 5′ DNA extension (sequence a⋅c of FIG. 44). In one embodiment, the first end extension comprises an end portion, which is at the 5′ end in a 5′ end extension or at the 3′ end in a 3′ end extension, which has a sequence that is not complementary to a sequence in the first capture oligonucleotide, and a portion that has a sequence that is complementary to the first sequence in the first capture oligonucleotide. The end portion of the first end extension may typically have a length of from 2 to 10 nucleotides, such as 3, 4, 5 or 6 nucleotides. The portion of the first end extension that is complementary to the first capture oligonucleotide may typically have a length of from 5 to 40, such as 10 to 30 or 15 to 25 nucleotides, for example 20 nucleotides.


The second end extension has a sequence that does hybridise to the first capture nucleotide, the first end extension or the competitor oligonucleotide. The second capture oligonucleotide also has a sequence that does hybridise to the first capture nucleotide, the first end extension or the competitor oligonucleotide. The end extension may be attached to the 5′ or 3′ end of the guide polynucleotide, such as to the 5′ or 3′ end of a tracrRNA or the 5′ or 3′ end of a crRNA. The end extension may be attached to the guide polynucleotide by any suitable means. The end extension may, for example, be may be added via a chemical group or spacer, e.g. ligation, via a chemical group, e.g. thiols, click groups, biotin etc., or via a DNA, RNA, PNA, BNA, LNA, TNA spacer. Where the spacer is a polynucleotide, the spacer may have a length of from 1 to 30, such as from 2 to 20, 3 to 15, 4 to 10, such as 5, 6, 7 8 or 9, nucleotides. The end extension may be present at the 5′ end of the tracrRNA, the 3′ end of the tracrRNA, the 3′ end of the crRNA, the 5′ end of the crRNA or may be substituted by a sequence added internally to the guide RNA, for example, wherein the tracrRNA and crRNA are comprised in a sgRNA. See FIGS. 41 and 44 for examples. Where an internal sequence is used to perform the function described herein for the end extension, it is typically present in a loop structure within the guide polynucleotide, or is otherwise accessible for hybridization to the capture oligonucleotide.


The present invention also provides a guide polynucleotide of the invention bound to a polynucleotide-guided effector protein as defined herein.


Also provided by the invention are a panel of guide polynucleotides, preferably guide RNAs of the invention, and a panel of guide polynucleotide/polynucleotide-guided effector protein complexes, preferably guide RNA/RNA-guided effector protein complexes, of the invention. The panel of guide polynucleotides or guide polynucleotide/polynucleotide-guided effector protein complexes may be comprised in a kit.


A panel of the invention may comprise guide polynucleotides of the invention and a panel of guide polynucleotides and polynucleotide-guided effector proteins that may be used together in a method of the invention. The guide polynucleotides and polynucleotide-guided effector proteins may be present in guide polynucleotide/polynucleotide-guided effector protein complexes.


A panel may comprise a first guide polynucleotide or guide polynucleotide/polynucleotide-guided effector protein complex that comprises an anchor capable of coupling to a membrane and a second guide polynucleotide or guide polynucleotide/polynucleotide-guided effector protein complex that comprises an adaptor, wherein the first guide polynucleotide or guide polynucleotide/polynucleotide-guided effector protein complex and the second guide polynucleotide or guide polynucleotide/polynucleotide-guided effector protein complex bind to different sequences in the same target polynucleotide. The panel may comprise multiple, such as from 2 to 50, 3 to 40, 4 to 30, 5 to 25, 6 to 15 or 8 to 10, such first and second guide polynucleotide or guide polynucleotide/polynucleotide-guided effector protein complexes. Where the panel comprises multiple first and second guide polynucleotides or guide polynucleotide/polynucleotide-guided effector protein complexes, each second guide polynucleotide or guide polynucleotide/polynucleotide-guided effector protein complex typically comprises a different adaptor. This enables the panel to distinguish between different target polynucleotides present in the sample.


A panel may comprise a first guide polynucleotide or guide polynucleotide/polynucleotide-guided effector protein complex that binds to a first sequence of the target polynucleotide and a second guide polynucleotide or guide polynucleotide/polynucleotide-guided effector protein complex that binds to a second sequence of the target polynucleotide. Further guide polynucleotides or guide polynucleotide/polynucleotide-guided effector protein complexes binding to further sequences of the same target polynucleotide may be included in the panel. The first, second and further guide polynucleotides or guide polynucleotide/polynucleotide-guided effector protein complexes may comprise the same or different adaptors, or may comprise no adaptors. The first guide polynucleotides or guide polynucleotidelpolynucleotide-guided effector protein complexes may comprise a membrane anchor and the second and/or further guide polynucleotides or guide polynucleotidelpolynucleotide-guided effector protein complexes may comprise the same adaptors or, preferably, different adaptors.


No adaptors need to be included in the guide polynucleotides or guide polynucleotide/polynucleotide-guided effector protein complexes where the panel is for use in a method that detects the effect of the guide polynucleotide/polynucleotide-guided effector protein complex bound to the target polynucleotide interacting with the transmembrane pore by detecting a signal, e.g. change current passing through the pore, caused by the guide polynucleotide/polynucleotide-guided effector protein complex stalling passage of the target polynucleotide through the pore or by the bound guide polynucleotide/polynucleotide-guided effector protein complex passing through the pore.


The first, second and/or further guide polynucleotides or guide polynucleotide/polynucleotide-guided effector protein complexes may bind to the same part of the target polynucleotide, but may each be specific for a different polymorphism present in that part of the target polynucleotide. In this embodiment, each guide polynucleotide or guide polynucleotide/polynucleotide-guided effector protein complex that is specific for a different polymorphism may comprise a different adaptor and/or leader sequence. The method of the invention can distinguish between different adaptors and/or between different leader sequences, and hence can be used to identify a polymorphism.


A panel may comprise a first guide polynucleotide or guide polynucleotide/polynucleotide-guided effector protein complex that binds to a first target polynucleotide and a second guide polynucleotide or guide polynucleotide/polynucleotide-guided effector protein complex that binds to a second target polynucleotide. Further guide polynucleotides or guide polynucleotide/polynucleotide-guided effector protein complexes binding to further target polynucleotides may be included in the panel. For example, the first, second and/or further guide polynucleotides or guide polynucleotide/polynucleotide-guided effector proteins may each be coupled to an anchor and/or other binding moieties. Such a panel would be useful for delivering multiple polynucleotides of interest in a sample to a transmembrane pore for further characterization, for example by sequencing. For example, such a panel would select for multiple polynucleotides of interest and tether them to the membrane comprising a transmembrane pore so that other polynucleotides in the sample may be washed away prior to the application of a membrane potential.


Sample

The sample may be any suitable sample. The sample is typically one that is known to contain or is suspected of containing at least one of the target polynucleotides. The method can be used to select target polynucleotides for delivery to the transmembrane pore. Other components of the sample may be washed away, for example, they may be flushed out of a cell comprising the transmembrane pore. Such other components include one or more of the following: proteins, which may be folded or unfolded, peptides, carbohydrates, polymers, such as non-target polynucleotides, and cell debris.


The sample may be a biological sample. The invention may be carried out in vitro on a sample obtained from or extracted from any organism or microorganism. The organism or microorganism is typically archaean, prokaryotic or eukaryotic and typically belongs to one the five kingdoms: plantae, animalia, fungi, monera and protista. The invention may be carried out in vitro on a sample obtained from or extracted from any virus.


The sample is preferably a fluid sample. The sample typically comprises a body fluid. The body fluid may be obtained from a human or animal. The human or animal may have, be suspected of having or be at risk of a disease. The sample may be urine, lymph, saliva, mucus, seminal fluid or amniotic fluid, but is preferably whole blood, plasma or serum. Typically, the sample is human in origin, but alternatively it may be from another mammal such as from commercially farmed animals such as horses, cattle, sheep or pigs or may alternatively be pets such as cats or dogs.


Alternatively a sample of plant origin is typically obtained from a commercial crop, such as a cereal, legume, fruit or vegetable, for example wheat, barley, oats, canola, maize, soya, rice, bananas, apples, tomatoes, potatoes, grapes, tobacco, beans, lentils, sugar cane, cocoa, cotton, tea or coffee.


The sample may be a non-biological sample. The non-biological sample is preferably a fluid sample. Examples of non-biological samples include surgical fluids, water such as drinking water, sea water or river water, and reagents for laboratory tests.


The sample may be processed prior to being assayed, for example by centrifugation or by passage through a membrane that filters out unwanted molecules or cells, such as red blood cells. The sample may be measured immediately upon being taken. The sample may also be typically stored prior to assay, preferably below −70° C.


The sample may comprise genomic DNA. The genomic DNA may be fragmented or step (a) of the method may further comprise fragmenting the genomic DNA. The DNA may be fragmented by any suitable method. For example, methods of fragmenting DNA are known in the art. Such methods may use a transposase, such as a MuA transposase.


The sample may comprise T-cell DNA.


The sample may comprise non-target polynucleotides. In one embodiment, the target polynucleotide and the non-target polynucleotides may be derived from the same gene or genome.


Monitoring Interaction of Complex with Pore


The method comprises monitoring for the presence or absence of an effect resulting from the interaction of the complex formed by the guide polynucleotide, the polynucleotide-guided effector protein and the target polynucleotide with the transmembrane pore to determine the presence or absence of the complex. The effect is indicative of the complex formed by the guide polynucleotide, the polynucleotide-guided effector protein and the target polynucleotide interacting with the transmembrane pore. The effect may be caused by the translocation through the pore of an adaptor attached to one of the components of the complex, the target polynucleotide or the guide polynucleotide. The effect is indicative of the translocation through the pore of an adaptor attached to one of the components of the complex, the target polynucleotide or the guide polynucleotide.


The effect may be monitored using an electrical measurement and/or an optical measurement. In this case, the effect is a measured change or measured changes in an electrical or optical quantity.


The electrical measurement may be a current measurement, an impedance measurement, a tunnelling measurement or a field effect transistor (FET) measurement.


The effect may be a change in ion flow through the transmembrane pore resulting in a change in current, resistance or a change in an optical property. The effect may be electron tunneling across the transmembrane pore. The effect may be a change in potential due to the interaction of the complex with the transmembrane pore wherein the effect is monitored using localized potential sensor in a FET measurement.


Adaptor

The adaptor may comprise at least one single stranded polynucleotide or non-polynucleotide region. Single stranded polynucleotides are useful because they can pass through the pore and can easily be divided into at least two different regions that affect the current flowing through the pore in different ways. For instance, different regions of a polynucleotide having different sequences typically affect the current flowing through the pore in different ways. The at least two different regions preferably correspond to at least two stretches of different nucleotides. For instance, the single stranded polynucleotide region may comprise a stretch of adenine nucleotides and a stretch of abasic nucleotides. Each stretch will affect the current flowing through the pore in a different way.


Alternatively, the at least two stretches of different nucleotides are different polynucleotide barcodes. Polynucleotide barcodes are well-known in the art (Kozarewa, I. et al., (2011). Methods Mol. Biol. 733, p 279-298). A barcode is a specific sequence of polynucleotide that affects the current flowing through the pore in a specific and known manner.


The adaptor may comprise a double-stranded polynucleotide that cannot pass through the pore. The presence of such a double stranded region may delay the adaptor from moving through the pore as one of the strands in the region is stripped from the probe under the influence of the potential. Such a delay produces a detectable signal, for example a change in the current flowing through the pore. The length of the double stranded region may be varied between different polynucleotide adaptors such that the length of the delay can be used to identify the adaptor interacting with the pore. Typical lengths of the double stranded region are from about 4 to about 50 base pairs, such as from 5, 6, 7, 8, 9 or 10 to 20, 30 or 40 base pairs, or any integer between 4 and 50.


Including one or more double stranded polynucleotide regions in the adaptor increases the number of possible signals that can be obtained from a population of adaptors in the panel of guide polynucleotides and hence increases the number of target polynucleotides that can be assayed using the method of the invention.


A double stranded polynucleotide region may, for example, be used to hold a specific region of the adaptor, such as a barcode that is indicative of the guide polynucleotide, in the barrel or channel of the pore so that it may be read in accordance with the invention.


The adaptor may comprise a nucleotide sequence. A nucleotide typically contains a nucleobase, a sugar and at least one phosphate group. The nucleobase is typically heterocyclic. Nucleobases include, but are not limited to, purines and pyrimidines and more specifically adenine, guanine, thymine, uracil and cytosine. The sugar is typically a pentose sugar. Nucleotide sugars include, but are not limited to, ribose and deoxyribose. The nucleotide is typically a ribonucleotide or deoxyribonucleotide. The nucleotide typically contains a monophosphate, diphosphate or triphosphate. Phosphates may be attached on the 5′ or 3′ side of a nucleotide.


Nucleotides include, but are not limited to, adenosine monophosphate (AMP), adenosine diphosphate (ADP), adenosine triphosphate (ATP), guanosine monophosphate (GMP), guanosine diphosphate (GDP), guanosine triphosphate (GTP), thymidine monophosphate (TMP), thymidine diphosphate (TDP), thymidine triphosphate (TTP), uridine monophosphate (UMP), uridine diphosphate (UDP), uridine triphosphate (UTP), cytidine monophosphate (CMP), cytidine diphosphate (CDP), cytidine triphosphate (CTP), 5-methylcytidine monophosphate, 5-methylcytidine diphosphate, 5-methylcytidine triphosphate, 5-hydroxymethylcytidine monophosphate, 5-hydroxymethyleytidine diphosphate, 5-hydroxymethylcytidine triphosphate, cyclic adenosine monophosphate (cAMP), cyclic guanosine monophosphate (cGMP), deoxyadenosine monophosphate (dAMP), deoxyadenosine diphosphate (dADP), deoxyadenosine triphosphate (dATP), deoxyguanosine monophosphate (dGMP), deoxyguanosine diphosphate (dGDP), deoxyguanosine triphosphate (dGTP), deoxythymidine monophosphate (dTMP), deoxythymidine diphosphate (dTDP), deoxythymidine triphosphate (dTTP), deoxyuridine monophosphate (dUMP), deoxyuridine diphosphate (dUDP), deoxyuridine triphosphate (dUTP), deoxycytidine monophosphate (dCMP), deoxycytidine diphosphate (dCDP) and deoxycytidine triphosphate (dCTP), 5-methyl-2′-deoxycytidine monophosphate, 5-methyl-2′-deoxycytidine diphosphate, 5-methyl-2′-deoxycytidine triphosphate, 5-hydroxymethyl-2′-deoxycytidine monophosphate, 5-hydroxymethyl-2′-deoxycytidine diphosphate and 5-hydroxymethyl-2′-deoxycytidine triphosphate. The nucleotides in the adaptor are preferably selected from AMP, TMP, GMP, UMP, dAMP, dTMP, dGMP or dCMP. The nucleotides may be abasic (e.g. lack a nucleobase). The nucleotides may contain additional modifications. In particular, suitable modified nucleotides include, but are not limited to, 2′amino pyrimidines (such as 2′-amino cytidine and 2′-amino uridine), 2′-hyrdroxyl purines (such as, 2′-fluoro pyrimidines (such as 2′-fluorocytidine and 2′fluoro uridine), hydroxyl pyrimidines (such as 5′-α-P-borano uridine), 2′-O-methyl nucleotides (such as 2′-O-methyl adenosine, 2′-O-methyl guanosine, 2′-O-methyl cytidine and 2′-O-methyl uridine), 4′-thio pyrimidines (such as 4′-thio uridine and 4′-thio cytidine) and nucleotides have modifications of the nucleobase (such as 5-pentynyl-2′-deoxy uridine, 5-(3-aminopropyl)-uridine and 1,6-diaminohexyl-N-5-carbamoylmethyl uridine).


The adaptor may comprise one or more different nucleotide species. For instance, T k-mers (e.g. k-mers in which the central nucleotide is thymine-based, such as TTA, GTC, GTG and CTA) typically have the lowest current states. Modified versions of T nucleotides may be introduced into the modified polynucleotide to reduce the current states further and thereby increase the total current range seen when the adaptor moves through the pore.


G k-mers (e.g. k-mers in which the central nucleotide is guanine-based, such as TGA, GGC, TGT and CGA) tend to be strongly influenced by other nucleotides in the k-mer and so modifying the G nucleotides in the modified polynucleotide may help them to have more independent current positions.


Including three copies of the same nucleotide species instead of three different species may facilitate characterisation because it is then only necessary to map, for example, 3-nucleotide k-mers in the modified polynucleotide. However, such modifications do reduce the information provided by the adaptor.


Including one or more nucleotide species with abasic nucleotides in the adaptor results in characteristic current spikes. This allows the clear highlighting of the positions of the one or more nucleotide species in the adaptor.


The nucleotide species in the adaptor may comprise a chemical atom or group such as a propynyl group, a thio group, an oxo group, a methyl group, a hydroxymethyl group, a formyl group, a carboxy group, a carbonyl group, a benzyl group, a propargyl group or a propargylamine group. The chemical group or atom may be or may comprise a fluorescent molecule, biotin, digoxigenin, DNP (dinitrophenol), a photo-labile group, an alkyne, DBCO, azide, free amino group, a redox dye, a mercury atom or a selenium atom.


The adaptor may comprise a nucleotide species comprising a halogen atom. The halogen atom may be attached to any position on the different nucleotide species, such as the nucleobase and/or the sugar. The halogen atom is preferably fluorine (F), chlorine (Cl), bromine (Br) or iodine (I). The halogen atom is most preferably F or I.


The adaptor may comprise a sequence capable of forming a quadruplex. A quadruplex is a three dimensional structure formed from four sequence strands. The quadruplex is incapable of translocating or moving through the narrowest part of the pore. The quadruplex is wider than the narrowest part of the pore. For example, the narrowest part of wild-type α-HL pore is 1.3 nm is diameter. The narrowest part of α-HL-NN pore is 1.5 nm in diameter. If either of these pores is used in the invention, the quadruplex preferably has a width of greater than 1.3 nm, such as greater than 1.5 nm, such as greater than 2 nm, greater than 3 nm or greater than 5 nm. A person skilled in the art will be able to design a suitably sized quadruplex for the pore being used. The quadruplex-forming sequence is capable of translocating or moving through the narrowest part of the pore when it is not formed into a quadruplex. The quadruplex-forming sequence is preferably a polynucleotide. It may be any of the polynucleotides discussed herein.


The quadruplex may be any type of quadruplex. The quadruplex may be an intermolecular quadruplex, such as a bimolecular quadruplex or a tetramolecular quadruplex. The quadruplex-forming sequence is preferably capable of forming an intramolecular quadruplex.


The quadruplex-forming sequence is preferably capable of forming G-quadruplexes (also known as G-tetrads or G4-DNA). These are polynucleotide sequences that are rich in guanine and are capable of forming a four-stranded structure. Four guanine bases can associate through Hoogsteen hydrogen bonding to form a square planar structure called a guanine tetrad, and two or more guanine tetrads can stack on top of each other to form a G-quadruplex. The quadruplex structure is further stabilized by the presence of a cation, especially potassium, which sits in a central channel between each pair of tetrads. Forming G-quadruplexes is well known in the art (Marathias and Bolton, Nucleic Acids Research, 2000; 28(9): 1969-1977; Kankia and Marky, J. Am. Chem. Soc. 2001, 123, 10799-10804; and Marusic et al., Nucleic Acids Research, 2012, 1-11).


The quadruplex-forming sequence more preferably comprises the sequence Ga followed by Nb followed by Gc followed by Nd followed by Ge followed by Nf followed by Gg, wherein G is a nucleotide comprising guanine, wherein a, c, e and g are independently selected from 1, 2, 3, 4 and 5, wherein N is any nucleotide and wherein b, d and f are from 2 to 50. The values of a, c, e and g may be identical. G is preferably guanosine monophosphate (GMP), cyclic guanosine monophosphate (cGMP), deoxyguanosine monophosphate (dGMP), dideoxyguanosine monophosphate, N2-methyl-GMP, N2-methyl-cGMP, N2-methyl-dGMP, N2-methyl-dideoxyguanosine monophosphate, N2-methyl-06-methyl-GMP, N2-methyl-06-methyl-cGMP, N2-methyl-06-methyl-dGMP, N2-methyl-06-methyl-dideoxyguanosine monophosphate, 2′-O-methyl-GMP, 2′-O-methyl-cGMP, 2′-O-methyl-dGMP, 2′-O-methyl-dideoxyguanosine monophosphate, 6-thio-GMP, 6-thio-cGMP, 6-thio-dGMP, 6-thio-dideoxyguanosine monophosphate, 7-methyl-GMP, 7-methyl-cGMP, 7-methyl-dGMP, 7-methyl-dideoxyguanosine monophosphate, 7-deaza-GMP, 7-deaza-cGMP, 7-deaza-dGMP, 7-deaza-dideoxyguanosine monophosphate, 8-oxo-GMP, 8-oxo-cGMP, 8-oxo-dGMP or 8-oxo-dideoxyguanosine monophosphate.


Suitable quadruplex-forming sequences are disclosed in WO 2014/072703.


Since the quadruplex is incapable of translocating through the narrowest part of the pore, it acts like a brake and holds another, typically single stranded, region of the adaptor or guide polynucleotide in the narrowest part of the pore. The adaptor region then results in a distinctive current which identifies the guide polynucleotide and hence the target polynucleotide in the complex. After a short while, the quadruplex will typically destabilise under the influence of the applied potential and unfold. The braking action of the quadruplex is therefore typically temporary. The unfolded quadruplex-forming sequence typically translocates or moves through the pore under the influence of the applied potential.


Coupling

The complex comprising a guide polynucleotide, a polynucleotide-guided effector protein and a target polynucleotide may be coupled to the membrane using an anchor. One or more anchors may be used to couple the complex to the membrane. Typically the one or more anchors are present on the same component of the complex, such as on the target polynucleotide, the guide polynucleotide or the polynucleotide-guided effector protein. Alternatively the one or more anchors may be present on different components such as on the guide polynucleotide and the polynucleotide-guided effector protein.


If the membrane is an amphiphilic layer, such as a triblock copolymer membrane, the one or more anchors preferably comprise a polypeptide anchor and/or a hydrophobic anchor that can be inserted into the membrane. The hydrophobic anchor is preferably a lipid, fatty acid, sterol, carbon nanotube, polypeptide, protein or amino acid, for example cholesterol, palmitate or tocopherol. In preferred embodiments, the one or more anchors are not the pore.


The components of the membrane, such as the amphiphilic molecules, copolymer or lipids, may be chemically-modified or functionalised to form the one or more anchors. Examples of suitable chemical modifications and suitable ways of functionalising the components of the membrane are discussed in more detail below. Any proportion of the membrane components may be functionalised, for example at least 0.01%, at least 0.1%, at least 1%, at least 10%, at least 25%, at least 50% or 100%.


The one or more anchors preferably comprise a linker. The one or more anchors may comprise one or more, such as 2, 3, 4 or more, linkers. One linker may be used to couple both a guide polynucleotide and a polynucleotide-guided effector protein to the membrane.


Preferred linkers include, but are not limited to, polymers, such as polynucleotides, polyethylene glycols (PEGs), polysaccharides and polypeptides. These linkers may be linear, branched or circular. For instance, the linker may be a circular polynucleotide. The target polynucleotide or the guide polynucleotide may hybridise to a complementary sequence on the circular polynucleotide linker.


The one or more anchors or one or more linkers may comprise a component that can be cut or broken down, such as a restriction site or a photolabile group.


Functionalised linkers and the ways in which they can couple molecules are known in the art. For instance, linkers functionalised with maleimide groups will react with and attach to cysteine residues in proteins.


Cross-linkage of polynucleotides can be avoided using a “lock and key” arrangement. Only one end of each linker may react together to form a longer linker and the other ends of the linker each react with the polynucleotide or membrane respectively. Such linkers are described in WO 2010/086602.


The use of a linker is preferred in the sequencing methods of the invention. If a polynucleotide is permanently coupled directly to the membrane in the sense that it does not uncouple when interacting with the pore, then some sequence data will be lost as the sequencing run cannot continue to the end of the polynucleotide due to the distance between the membrane and the pore. If a linker is used, then the polynucleotide can be processed to completion.


The coupling may be permanent or stable. In other words, the coupling may be such that the complex remains coupled to the membrane when interacting with the pore.


The coupling may be transient. In other words, the coupling may be such that the complex may decouple from the membrane when interacting with the pore. For complex detection and polynucleotide sequencing, the transient nature of the coupling is preferred. If a permanent or stable linker is attached directly to either the 5′ or 3′ end of a polynucleotide and the linker is shorter than the distance between the membrane and the channel of the transmembrane pore, then some sequence data will be lost as the sequencing run cannot continue to the end of the polynucleotide. If the coupling is transient, then when the coupled end randomly becomes free of the membrane, then the polynucleotide can be processed to completion. Chemical groups that form permanent/stable or transient links are discussed in more detail below. The complex may be transiently coupled to an amphiphilic layer or triblock copolymer membrane using cholesterol or a fatty acyl chain. Any fatty acyl chain having a length of from 6 to 30 carbon atom, such as hexadecanoic acid, may be used.


In preferred embodiments, anchor couples the complex to an amphiphilic layer such as a triblock copolymer membrane or lipid bilayer. Coupling of nucleic acids to synthetic lipid bilayers has been carried out previously with various different tethering strategies. These are summarised in Table 1 below.











TABLE 1





Anchor
Type of



comprising
coupling
Reference







Thiol
Stable
Yoshina-Ishii, C. and S. G. Boxer (2003).




“Arrays of mobile tethered vesicles on




supported lipid bilayers.” J Am Chem Soc




125(13): 3696-7.


Biotin
Stable
Nikolov, V., R. Lipowsky, et al. (2007).




“Behavior of giant vesicles with anchored




DNA molecules.” Biophys J 92(12):




4356-68


Cholesterol
Transient
Pfeiffer, I. and F. Hook (2004). “Bivalent




cholesterol-based coupling of oligo-




nucletides to lipid membrane assemblies.”





J Am Chem
Soc 126(33): 10224-5



Surfactant
Stable
van Lengerich, B., R. J. Rawle, et al.


(e.g. Lipid,

“Covalent attachment of lipid vesicles to a


Palmitate, etc)

fluid-supported bilayer allows observation




of DNA-mediated vesicle interactions.”





Langmuir 26(11): 8666-72










Synthetic polynucleotides and/or linkers may be functionalised using a modified phosphoramidite in the synthesis reaction, which is easily compatible for the direct addition of suitable anchoring groups, such as cholesterol, tocopherol, palmitate, thiol, lipid and biotin groups. These different attachment chemistries give a suite of options for attachment to polynucleotides. Each different modification group couples the polynucleotide in a slightly different way and coupling is not always permanent so giving different dwell times for the polynucleotide to the membrane.


Coupling of polynucleotides to a linker or to a functionalised membrane can also be achieved by a number of other means provided that a complementary reactive group or an anchoring group can be added to the polynucleotide. The addition of reactive groups to either end of a polynucleotide has been reported previously. A thiol group can be added to the 5′ of ssDNA or dsDNA using T4 polynucleotide kinase and ATPγS (Grant, G. P. and P. Z. Qin (2007). “A facile method for attaching nitroxide spin labels at the 5′ terminus of nucleic acids.” Nucleic Acids Res 35(10): e77). An azide group can be added to the 5′-phosphate of ssDNA or dsDNA using T4 polynucleotide kinase and γ-[2-Azidoethyl]-ATP or 7-[6-Azidohexyl]-ATP. Using thiol or Click chemistry a tether, containing either a thiol, iodoacetamide OPSS or maleimide group (reactive to thiols) or a DIBO (dibenzocyclooxtyne) or alkyne group (reactive to azides), can be covalently attached to the polynucleotide. A more diverse selection of chemical groups, such as biotin, thiols and fluorophores, can be added using terminal transferase to incorporate modified oligonucleotides to the 3′ of ssDNA (Kumar, A., P. Tchen, et al. (1988). “Nonradioactive labeling of synthetic oligonucleotide probes with terminal deoxynucleotidyl transferase.” Anal Biochem 169(2): 376-82). Streptavidin/biotin and/or streptavidin/desthiobiotin coupling may be used for any other polynucleotide. It may also be possible that anchors may be directly added to polynucleotides using terminal transferase with suitably modified nucleotides (e.g. cholesterol or palmitate).


The one or more anchors may couple the complex to the membrane via hybridisation. The hybridisation may be between the one or more anchors and the target polynucleotide or guide polynucleotide, within the one or more anchors or between the one or more anchors and the membrane. Hybridisation in the one or more anchors allows coupling in a transient manner as discussed above. For instance, a linker may comprise two or more polynucleotides, such as 3, 4 or 5 polynucleotides, hybridised together. The one or more anchors may hybridise to the target or guide polynucleotide. The one or more anchors may hybridise directly to the target or guide polynucleotide, directly to a Y adaptor and/or leader sequence attached to the polynucleotide or directly to a hairpin loop adaptor attached to the polynucleotide. Alternatively, the one or more anchors may be hybridised to one or more, such as 2 or 3, intermediate polynucleotides (or “splints”) which are hybridised to the polynucleotide, to a Y adaptor and/or leader sequence attached to the polynucleotide or to a hairpin loop adaptor attached to the polynucleotide.


The one or more anchors may comprise a single stranded or double stranded polynucleotide. One part of the anchor may be ligated to a single stranded or double stranded polynucleotide analyte. Ligation of short pieces of ssDNA have been reported using T4 RNA ligase I (Troutt, A. B., M. G. McHeyzer-Williams, et al. (1992). “Ligation-anchored PCR: a simple amplification technique with single-sided specificity.” Proc Natl Acad Sci USA 89(20): 9823-5). Alternatively, either a single stranded or double stranded polynucleotide can be ligated to a double stranded polynucleotide and then the two strands separated by thermal or chemical denaturation. To a double stranded polynucleotide, it is possible to add either a piece of single stranded polynucleotide to one or both of the ends of the duplex, or a double stranded polynucleotide to one or both ends. For addition of single stranded polynucleotides to the double stranded polynucleotide, this can be achieved using T4 RNA ligase I as for ligation to other regions of single stranded polynucleotides. For addition of double stranded polynucleotides to a double stranded polynucleotide then ligation can be “blunt-ended”, with complementary 3′ dA/dT tails on the polynucleotide and added polynucleotide respectively (as is routinely done for many sample preparation applications to prevent concatemer or dimer formation) or using “sticky-ends” generated by restriction digestion of the polynucleotide and ligation of compatible adapters. Then, when the duplex is melted, each single strand will have either a 5′ or 3′ modification if a single stranded polynucleotide was used for ligation or a modification at the 5′ end, the 3′ end or both if a double stranded polynucleotide was used for ligation.


If the polynucleotide is a synthetic strand, the one or more anchors can be incorporated during the chemical synthesis of the polynucleotide. For instance, the polynucleotide can be synthesised using a primer having a reactive group attached to it.


Adenylated polynucleotides are intermediates in ligation reactions, where an adenosine-monophosphate is attached to the 5′-phosphate of the polynucleotide. Various kits are available for generation of this intermediate, such as the 5′ DNA Adenylation Kit from NEB. By substituting ATP in the reaction for a modified nucleotide triphosphate, then addition of reactive groups (such as thiols, amines, biotin, azides, etc) to the 5′ of a polynucleotide can be possible. It may also be possible that anchors could be directly added to polynucleotides using a 5′ DNA adenylation kit with suitably modified nucleotides (e.g. cholesterol or palmitate).


A common technique for the amplification of sections of genomic DNA is using polymerase chain reaction (PCR). Here, using two synthetic oligonucleotide primers, a number of copies of the same section of DNA can be generated, where for each copy the 5′ of each strand in the duplex will be a synthetic polynucleotide. Single or multiple nucleotides can be added to 3′ end of single or double stranded DNA by employing a polymerase. Examples of polymerases which could be used include, but are not limited to, Terminal Transferase, Klenow and E. coli Poly(A) polymerase). By substituting ATP in the reaction for a modified nucleotide triphosphate then anchors, such as a cholesterol, thiol, amine, azide, biotin or lipid, can be incorporated into double stranded polynucleotides. Therefore, each copy of the amplified polynucleotide will contain an anchor.


Ideally, the polynucleotide is coupled to the membrane without having to functionalise the polynucleotide. This can be achieved by coupling the one or more anchors, such as a polynucleotide binding protein or a chemical group, to the membrane and allowing the one or more anchors to interact with the polynucleotide or by functionalizing the membrane. The one or more anchors may be coupled to the membrane by any of the methods described herein. In particular, the one or more anchors may comprise one or more linkers, such as maleimide functionalised linkers. In this embodiment, the polynucleotide is typically RNA, DNA, PNA, TNA or LNA and may be double or single stranded. This embodiment is particularly suited to genomic DNA polynucleotides.


The one or more anchors can comprise any group that couples to, binds to or interacts with single or double stranded polynucleotides, specific nucleotide sequences within the polynucleotide or patterns of modified nucleotides within the polynucleotide, or any other ligand that is present on the polynucleotide.


Suitable binding proteins for use in anchors include, but are not limited to, E. coli single stranded binding protein, P5 single stranded binding protein, T4 gp32 single stranded binding protein, the TOPO V dsDNA binding region, human histone proteins, E. coli HU DNA binding protein and other archaeal, prokaryotic or eukaryotic single stranded or double stranded polynucleotide (or nucleic acid) binding proteins, including those listed below.


The specific nucleotide sequences could be sequences recognised by transcription factors, ribosomes, endonucleases, topoisomerases or replication initiation factors. The patterns of modified nucleotides could be patterns of methylation or damage.


The one or more anchors can comprise any group which couples to, binds to, intercalates with or interacts with a polynucleotide. The group may intercalate or interact with the polynucleotide via electrostatic, hydrogen bonding or Van der Waals interactions. Such groups include a lysine monomer, poly-lysine (which will interact with ssDNA or dsDNA), ethidium bromide (which will intercalate with dsDNA), universal bases or universal nucleotides (which can hybridise with any polynucleotide) and osmium complexes (which can react to methylated bases). A polynucleotide may therefore be coupled to the membrane using one or more universal nucleotides attached to the membrane. Each universal nucleotide may be coupled to the membrane using one or more linkers. The universal nucleotide preferably comprises one of the following nucleobases: hypoxanthine, 4-nitroindole, 5-nitroindole, 6-nitroindole, formylindole, 3-nitropyrrole, nitroimidazole, 4-nitropyrazole, 4-nitrobenzimidazole, 5-nitroindazole, 4-aminobenzimidazole or phenyl (C6-aromatic ring). The universal nucleotide more preferably comprises one of the following nucleosides: 2′-deoxyinosine, inosine, 7-deaza-2′-deoxyinosine, 7-deaza-inosine, 2-aza-deoxyinosine, 2-aza-inosine, 2-0′-methylinosine, 4-nitroindole 2′-deoxyribonucleoside, 4-nitroindole ribonucleoside, 5-nitroindole 2′-deoxyribonucleoside, 5-nitroindole ribonucleoside, 6-nitroindole 2′-deoxyribonucleoside, 6-nitroindole ribonucleoside, 3-nitropyrrole 2′-deoxyribonucleoside, 3-nitropyrrole ribonucleoside, an acyclic sugar analogue of hypoxanthine, nitroimidazole 2′-deoxyribonucleoside, nitroimidazole ribonucleoside, 4-nitropyrazole 2′-deoxyribonucleoside, 4-nitropyrazole ribonucleoside, 4-nitrobenzimidazole 2′-deoxyribonucleoside, 4-nitrobenzimidazole ribonucleoside, 5-nitroindazole 2′-deoxyribonucleoside, 5-nitroindazole ribonucleoside, 4-aminobenzimidazole 2′-deoxyribonucleoside, 4-aminobenzimidazole ribonucleoside, phenyl C-ribonucleoside, phenyl C-2′-deoxyribosyl nucleoside, 2′-deoxynebularine, 2′-deoxyisoguanosine, K-2′-deoxyribose, P-2′-deoxyribose and pyrrolidine. The universal nucleotide more preferably comprises 2′-deoxyinosine. The universal nucleotide is more preferably IMP or dIMP. The universal nucleotide is most preferably dPMP (2′-Deoxy-P-nucleoside monophosphate) or dKMP (N6-methoxy-2, 6-diaminopurine monophosphate).


The one or more anchors may couple to (or bind to) the polynucleotide via Hoogsteen hydrogen bonds (where two nucleobases are held together by hydrogen bonds) or reversed Hoogsteen hydrogen bonds (where one nucleobase is rotated through 180° with respect to the other nucleobase). For instance, the one or more anchors may comprise one or more nucleotides, one or more oligonucleotides or one or more polynucleotides which form Hoogsteen hydrogen bonds or reversed Hoogsteen hydrogen bonds with the polynucleotide. These types of hydrogen bonds allow a third polynucleotide strand to wind around a double stranded helix and form a triplex. The one or more anchors may couple to (or bind to) a double stranded polynucleotide by forming a triplex with the double stranded duplex.


In this embodiment at least 1%, at least 10%, at least 25%, at least 50% or 100% of the membrane components may be functionalised.


Where the one or more anchors comprise a protein, they may be able to anchor directly into the membrane without further functionalisation, for example if it already has an external hydrophobic region which is compatible with the membrane. Examples of such proteins include, but are not limited to, transmembrane proteins, intramembrane proteins and membrane proteins. Alternatively the protein may be expressed with a genetically fused hydrophobic region which is compatible with the membrane. Such hydrophobic protein regions are known in the art.


The one or more anchors are preferably mixed with the polynucleotide before delivery to the membrane, but the one or more anchors may be contacted with the membrane and subsequently contacted with the polynucleotide.


In another aspect the polynucleotide may be functionalised, using methods described above, so that it can be recognised by a specific binding group. Specifically the polynucleotide may be functionalised with a ligand such as biotin (for binding to streptavidin), amylose (for binding to maltose binding protein or a fusion protein), Ni-NTA (for binding to poly-histidine or poly-histidine tagged proteins) or peptides (such as an antigen).


According to a preferred embodiment, the one or more anchors may be used to couple a polynucleotide to the membrane when the polynucleotide is attached to a leader sequence which preferentially threads into the pore. Preferably, the polynucleotide is attached (such as ligated) to a leader sequence which preferentially threads into the pore. Such a leader sequence may comprise a homopolymeric polynucleotide or an abasic region. The leader sequence is typically designed to hybridise to the one or more anchors either directly or via one or more intermediate polynucleotides (or splints). In such instances, the one or more anchors typically comprise a polynucleotide sequence which is complementary to a sequence in the leader sequence or a sequence in the one or more intermediate polynucleotides (or splints). In such instances, the one or more splints typically comprise a polynucleotide sequence which is complementary to a sequence in the leader sequence.


Any of the methods discussed above for coupling polynucleotides to membranes, such as amphiphilic layers, can of course be applied to other polynucleotide and membrane combinations. In some embodiments, an amino acid, peptide, polypeptide or protein is coupled to an amphiphilic layer, such as a triblock copolymer layer or lipid bilayer. Various methodologies for the chemical attachment of such polynucleotides are available. An example of a molecule used in chemical attachment is EDC (1-ethyl-3-[3-dimethylaminopropyl]carbodiimide hydrochloride). Reactive groups can also be added to the 5′ of polynucleotides using commercially available kits (Thermo Pierce, Part No. 22980). Suitable methods include, but are not limited to, transient affinity attachment using histidine residues and Ni-NTA, as well as more robust covalent attachment by reactive cysteines, lysines or non natural amino acids.


Leader Sequence

The leader sequence typically comprises a polymer. The polymer is preferably negatively charged. The polymer is preferably a polynucleotide, such as DNA or RNA, a modified polynucleotide (such as abasic DNA), PNA, LNA, polyethylene glycol (PEG) or a polypeptide. The leader preferably comprises a polynucleotide and more preferably comprises a single stranded polynucleotide. The single stranded leader sequence most preferably comprises a single strand of DNA, such as a poly dT section. The leader sequence preferably comprises the one or more spacers.


The leader sequence can be any length, but is typically 10 to 150 nucleotides in length, such as from 20 to 150 nucleotides in length. The length of the leader typically depends on the transmembrane pore used in the method.


The leader sequence preferentially threads into the transmembrane pore and thereby facilitates the movement of polynucleotide through the pore. The leader sequence can also be used to link the polynucleotide to the one or more anchors as discussed herein.


Sequencing Adaptors—Y Adaptors

Y-adaptors for use in nanopore sequencing are known in the art. A Y adaptor typically comprises (a) a double stranded region and (b) a single stranded region or a region that is not complementary at the other end. A Y adaptor may be described as having an overhang if it comprises a single stranded region. The presence of a non-complementary region in the Y adaptor gives the adaptor its Y shape since the two strands typically do not hybridise to each other unlike the double stranded portion. The Y adaptor may comprise one or more anchors.


The Y adaptor preferably comprises a leader sequence which preferentially threads into the pore.


The Y adaptor and/or the hairpin loop may be ligated to the polynucleotide using any method known in the art. One or both of the adaptors may be ligated using a ligase, such as T4 DNA ligase, E. coli DNA ligase, Taq DNA ligase, Tma DNA ligase and 9° N DNA ligase. Alternatively, the adaptors may be added to the polynucleotide using the methods discussed below.


In a preferred embodiment, the method comprises modifying the double stranded polynucleotides in the sample so that they comprise the Y adaptor at one end and the hairpin loop at the other end. Any manner of modification can be used. The method preferably comprises modifying the double stranded target polynucleotide.


The double stranded polynucleotide may be provided with adaptors, such as Y adaptors and hairpin loops, or anchors by contacting the polynucleotide with a MuA transposase and a population of double stranded MuA substrates. The transposase fragments the double stranded polynucleotide and ligates MuA substrates to one or both ends of the fragments. This produces a plurality of modified double stranded polynucleotides comprising an adaptor or anchor. The modified double stranded polynucleotides may then be investigated using the method of the invention.


These MuA based methods are disclosed in WO 2015/022544 and WO 2016/059363. They are also discussed in detail in WO2015/150786.


A double stranded polynucleotide may be provided with a Y adaptor at one end and a hairpin loop at the other end. For example, a proportion of the MuA substrates in the population may be Y adaptors comprising a leader sequence and a proportion of the substrates in the population may be hairpin loops.


The Y adaptor may comprise a capture sequence, affinity tag or pore tether that is revealed when a double stranded region to which the adaptor is attached is unwound. The capture sequence or tag functions to prevent the second strand of a double stranded polynucleotide from diffusing away from a nanopore when the double stranded polynucleotide is unwound as the first strand of the double stranded polynucleotide passes through a pore, wherein the pore binds to the tether or is tagged with an oligonucleotide comprising a sequence that is complementary to the capture sequence in the Y adaptor, an affinity partner of the tag on the Y-adaptor.


Hairpin Loops

Hairpin loop adaptors for use in nanopore sequencing are known in the art. A hairpin loop may be provided at one end of a double stranded polynucleotide, the method preferably further comprises providing the polynucleotide with a hairpin loop at one end of the polynucleotide. The two strands of the polynucleotide may be joined at one end with the hairpin loop.


Suitable hairpin loops can be designed using methods known in the art. The hairpin loop may be any length. The hairpin loop is typically 110 or fewer nucleotides, such as 100 or fewer nucleotides, 90 or fewer nucleotides, 80 or fewer nucleotides, 70 or fewer nucleotides, 60 or fewer nucleotides, 50 or fewer nucleotides, 40 or fewer nucleotides, 30 or fewer nucleotides, 20 or fewer nucleotides or 10 or fewer nucleotides, in length. The hairpin loop is preferably from about 1 to 110, from 2 to 100, from 5 to 80 or from 6 to 50 nucleotides in length. Longer lengths of the hairpin loop, such as from 50 to 110 nucleotides, are preferred if the loop is involved in the differential selectability of the adaptor. Similarly, shorter lengths of the hairpin loop, such as from 1 to 5 nucleotides, are preferred if the loop is not involved in the selectable binding as discussed below.


The hairpin loop may be provided at either end of the polynucleotide, e.g. the 5′ or the 3′ end. The hairpin loop may be ligated to the polynucleotide using any method known in the art. The hairpin loop may be ligated using a ligase, such as T4 DNA ligase, E. coli DNA ligase, Taq DNA ligase, Tma DNA ligase and 9°N DNA ligase.


In a method of characterizing a polynucleotide by sequencing, the two strands of a double stranded polynucleotide joined by a hairpin loop may be separated using any method known in the art. The two strands of the polynucleotide are then moved through the pore one strand at a time. Linking and interrogating both strands on a double stranded construct in this way increases the efficiency and accuracy of characterisation.


The hairpin loop preferably comprises a selectable binding moiety. This allows the polynucleotide to be purified or isolated. A selectable binding moiety is a moiety that can be selected on the basis of its binding properties. Hence, a selectable binding moiety is preferably a moiety that specifically binds to a surface. A selectable binding moiety specifically binds to a surface if it binds to the surface to a much greater degree than any other moiety used in the invention. In preferred embodiments, the moiety binds to a surface to which no other moiety used in the invention binds.


Suitable selective binding moieties are known in the art. Preferred selective binding moieties include, but are not limited to, biotin, a polynucleotide sequence, antibodies, antibody fragments, such as Fab and ScSv, antigens, polynucleotide binding proteins, poly histidine tails and GST tags. The most preferred selective binding moieties are biotin and a selectable polynucleotide sequence. Biotin specifically binds to a surface coated with avidins. Selectable polynucleotide sequences specifically bind (e.g. hybridise) to a surface coated with homologus sequences. Alternatively, selectable polynucleotide sequences specifically bind to a surface coated with polynucleotide binding proteins.


The hairpin loop and/or the selectable binding moiety may comprise a region that can be cut, nicked, cleaved or hydrolysed. Such a region can be designed to allow the polynucleotide to be removed from the surface to which it is bound following purification or isolation. Suitable regions are known in the art. Suitable regions include, but are not limited to, an RNA region, a region comprising desthiobiotin and streptavidin, a disulphide bond and a photocleavable region.


Beads

A bead, typically a microparticle, may be used to deliver the complex to the transmembrane pore. This is described in WO 2016/059375. Any number of microparticles can be used in the method of the invention. For instance, the method may use a single microparticle or 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 50, 100, 1,000, 5,000, 10,000, 100,000, 500,000 or 1,000,000 or more microparticles. If two or more microparticles are used, the microparticles may be the same. Alternatively, a mixture of different microparticles may be used.


Each microparticle may have one complex attached. Alternatively, each microparticle may have two or more complexes, such as 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more, 20 or more, 30 or more, 50 or more, 100 or more, 500 or more, 1,000 or more, 5,000 or more, 10,000 or more, 100,000 or more, 1000,000 or more or 5000,000 or more polynucleotides, attached. A microparticle may be substantially or completed coated or covered with complexes. A microparticle may have a complex attached over substantially all of or all of its surface. A microparticle may be attached to a complex via an adaptor. The adaptor may be a Y-adaptor or a hairpin adaptor.


The complex may be attached to a microparticle via any one or more of its components. The guide polynucleotide, the polynucleotide-guided effector protein and/or the target polynucleotide may be attached to the microparticle. For example, the polynucleotide-guided effector protein, guide polynucleotide and/or the target polynucleotide may have a binding moiety attached that will bind to the surface of a microparticle.


Examples of suitable binding moieties include: protein binding tags (strep tag, flag tags, etc), conjugated attachments (polynucleotides, polymers, biotins, peptides) and amino acids (cysteines, Faz, etc).


A complex may be attached to two or more microparticles.


A microparticle is a microscopic particle whose size is typically measured in micrometres (μm). Microparticles may also known as microspheres or microbeads. The microparticle may be a nanoparticle. A nanoparticle is a microscopic particle whose size is typically measured in nanometres (nm).


A microparticle typically has a particle size of from about 0.001 μm to about 500 μm. For instance, a nanoparticle may have a particle size of from about 0.01 μm to about 200 μm or about 0.1 μm to about 100 μm. More often, a microparticle has a particle size of from about 0.5 μm to about 100 μm, or for instance from about 1 μm to about 50 μm. The microparticle may have a particle size of from about 1 nm to about 1000 nm, such as from about 10 nm to about 500 nm, about 20 nm to about 200 nm or from about 30 nm to about 100 nm.


A microparticle may be spherical or non-spherical. Spherical microparticles may be called microspheres. Non-spherical particles may for instance be plate-shaped, needle-shaped, irregular or tubular. The term “particle size” as used herein means the diameter of the particle if the particle is spherical or, if the particle is non-spherical, the volume-based particle size. The volume-based particle size is the diameter of the sphere that has the same volume as the non-spherical particle in question.


If two or more microparticles are used in the method, the average particle size of the microparticles may be any of the sizes discussed above, such as from about 0.5 μm to about 500 μm. A population of two or more microparticles preferably has a coefficient of variation (ratio of the standard deviation to the mean) of 10% or less, such as 5% or less or 2% or less.


Any method may be used to determine the size of the microparticle. Suitable methods include, but are not limited to, flow cytometry (see, for example, Chandler et al., J Thromb Haemost. 2011 Jun.; 9(6):1216-24).


The microparticle may be formed from any material. The microparticle is preferably formed from a ceramic, glass, silica, a polymer or a metal. The polymer may be a natural polymer, such as polyhydroxyalkanoate, dextran, polylactide, agarose, cellulose, starch or chitosan, or a synthetic polymer, such as polyurethane, polystyrene, poly(vinyl chloride), silane or methacrylate. Suitable microparticles are known in the art and are commercially available. Ceramic and glass microspheres are commercially available from 3M®. Silica and polymer microparticles are commercially available from EPRUI Nanoparticles & Microspheres Co. Ltd. Microparticles are also commercially available from Polysciences Inc., Bangs Laboratories Inc. and Life Technologies.


The microparticle may be solid. The microparticle may be hollow. The microparticle may be formed from polymer fibers.


The microparticle may be derived from the kit used to extract and isolate the polynucleotide.


The surface of the microparticle may interact with and attach the analyte. The surface may naturally interact with the analyte, such as the polynucleotide, without functionalisation. The surface of the microparticle is typically functionalised to facilitate attachment of the analyte. Suitable functionalisations are known in the art. For instance, the surface of the microparticle may be functionalised with a polyhistidine-tag (hexa histidine-tag, 6×His-tag, His6 tag or His-Tag®), Ni-NTA, streptavidin, biotin, an oligonucleotide, a polynucleotide (such as DNA, RNA, PNA, GNA, TNA or LNA), carboxyl groups, quaternary amine groups, thiol groups, azide groups, alkyne groups, DIBO, lipid, FLAG-tag (FLAG octapeptide, polynucleotide binding proteins (including any of those discussed below), peptides, proteins, antibodies or antibody fragments. The microparticle may also be functionalised with any of the linkers or groups discussed herein.


The microparticle may be functionalised with a molecule or group which specifically binds to the polynucleotide. In this instance, the polynucleotide which will be attached to the microparticle and delivered to the transmembrane pore may be called the target polynucleotide. This allows the microparticle to select or capture the target polynucleotide from a sample containing other polynucleotides. A molecule or group specifically binds to the target polynucleotide if it binds to the target polynucleotide with preferential or high affinity, but does not bind or binds with only low affinity to other or different polynucleotides. A molecule or group binds with preferential or high affinity if it binds with a Kd of 1×10−6 M or less, more preferably 1×10−7 M or less, 5×10−8 M or less, more preferably 1×10−8 M or less or more preferably 5×10−9 M or less. A molecule or group binds with low affinity if it binds with a Kd of 1×10−6 M or more, more preferably 1×10−5 M or more, more preferably 1×10−4 M or more, more preferably 1×10−3 M or more, even more preferably 1×10−2 M or more.


Preferably, the molecule or group binds to the target polynucleotide with an affinity that is at least 10 times, such as at least 50, at least 100, at least 200, at least 300, at least 400, at least 500, at least 1000 or at least 10,000 times, greater than its affinity for other polynucleotides. Affinity can be measured using known binding assays, such as those that make use of fluorescence and radioisotopes. Competitive binding assays are also known in the art. The strength of binding between peptides or proteins and polynucleotides can be measured using nanopore force spectroscopy as described in Hornblower et al., Nature Methods. 4: 315-317. (2007).


The microparticle may be functionalised with an oligonucleotide or a polynucleotide which specifically hybridises to a target polynucleotide or guide polynucleotide or which comprises a portion or region which is complementary to a portion or region of the target polynucleotide or guide polynucleotide. This allows the microparticle to select or capture the target polynucleotide or guide polynucleotide from a sample containing other polynucleotides.


An oligonucleotide or polynucleotide specifically hybridises to a target polynucleotide when it hybridises with preferential or high affinity to the target polynucleotide but does not substantially hybridise, does not hybridise or hybridises with only low affinity to other polynucleotide. An oligonucleotide or polynucleotide specifically hybridises if it hybridises to the target polynucleotide with a melting temperature (Tm) that is at least 2° C., such as at least 3° C., at least 4° C., at least 5° C., at least 6° C., at least 7° C., at least 8° C., at least 9° C. or at least 10° C., greater than its Tm for other sequences. More preferably, the oligonucleotide or polynucleotide hybridise to the target polynucleotide with a Tm that is at least 2° C., such as at least 3° C., at least 4° C., at least 5° C., at least 6° C., at least 7° C., at least 8° C., at least 9° C., at least 10° C., at least 20° C., at least 30° C. or at least 40° C., greater than its Tm for other nucleic acids. Preferably, the oligonucleotide or polynucleotide hybridises to the target polynucleotide with a Tm that is at least 2° C., such as at least 3° C., at least 4° C., at least 5° C., at least 6° C., at least 7° C., at least 8° C., at least 9° C., at least 10° C., at least 20° C., at least 30° C. or at least 40° C., greater than its Tm for a sequence which differs from the target polynucleotide by one or more nucleotides, such as by 1, 2, 3, 4 or 5 or more nucleotides. The oligonucleotide or polynucleotide typically hybridises to the target polynucleotide with a Tm of at least 90° C., such as at least 92° C. or at least 95° C. Tm can be measured experimentally using known techniques, including the use of DNA microarrays, or can be calculated using publicly available Tm calculators, such as those available over the internet.


Conditions that permit the hybridisation are well-known in the art (for example, Sambrook et al., 2001, Molecular Cloning: a laboratory manual, 3rd edition, Cold Spring Harbour Laboratory Press; and Current Protocols in Molecular Biology, Chapter 2. Ausubel et al., Eds., Greene Publishing and Wiley-Interscience, New York (1995)). Hybridisation can be carried out under low stringency conditions, for example in the presence of a buffered solution of 30 to 35% formamide, 1 M NaCl and 1% SDS (sodium dodecyl sulfate) at 37° C. followed by a 20 wash in from 1× (0.1650 M Na+) to 2× (0.33 M Na+) SSC (standard sodium citrate) at 50° C. Hybridisation can be carried out under moderate stringency conditions, for example in the presence of a buffer solution of 40 to 45% formamide, 1 M NaCl, and 1% SDS at 37° C., followed by a wash in from 0.5× (0.0825 M Na+) to 1× (0.1650 M Na+) SSC at 55° C. Hybridisation can be carried out under high stringency conditions, for example in the presence of a buffered solution of 50% formamide, 1 M NaCl, 1% SDS at 37° C., followed by a wash in 0.1× (0.0165 M Na+) SSC at 60° C.


The oligonucleotide or polynucleotide may comprise a portion or region which is substantially complementary to a portion or region of the target polynucleotide or guide polynucleotide. The region or portion of the oligonucleotide or polynucleotide may therefore have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more mismatches across a region of 5, 10, 15, 20, 21, 22, 30, 40 or 50 nucleotides compared with the portion or region in the target polynucleotide or guide polynucleotide.


A portion of region is typically 50 nucleotides or fewer, such as 40 nucleotides or fewer, 30 nucleotides or fewer, 20 nucleotides or fewer, 10 nucleotides or fewer or 5 nucleotides or fewer.


The microparticle is preferably paramagnetic or magnetic. The microparticle preferably comprises a paramagnetic or a superparamagnetic material or a paramagnetic or a superparamagnetic metal, such as iron. Any suitable magnetic microparticle may be used. For instance, magnetic heads commercially available from, for instance, Clontech, Promega, Invitrogen ThermoFisher Scientific and NEB, may be used. In some embodiments, the microparticle comprises a magnetic particle with an organic group such as a metal-chelating group, such as nitrilotriacetic acid (NTA), attached. The organic component may, for instance, comprise a group selected from —C(═O)O—, —C—O—C—, —C(═O)—, —NH—, —C(═O)—NH, —C(═O)—CH2—I, —S(═O)2— and —S—. The organic component may comprise a metal chelating group, such as NTA (nitrilotriacetic acid). Usually, a metal such as gold, iron, nickel or cobalt is also attached to the metal-chelating group. Magnetic beads of this sort are commonly used for capturing His-tagged proteins, but are also suitable for use in the invention.


The microparticle is most preferably a His-Tag Dynabead® which is commercially available from Life Technologies, Mag Strep beads from IBA, Streptavidin magnetic beads from NEB, Solid Phase Reversible Immobilization (SPRI) beads or Agencourt AMPure XP beads from Beckman Coulter or Dynabeads @ MyOne™ Streptavidin C1 (ThermoFisher Scientific).


Membrane

Any membrane may be used in accordance with the invention. Suitable membranes are well-known in the art. The membrane is preferably an amphiphilic layer or a solid state layer.


An amphiphilic layer is a layer formed from amphiphilic molecules, such as phospholipids, which have both hydrophilic and lipophilic properties. The amphiphilic molecules may be synthetic or naturally occurring. Non-naturally occurring amphiphiles and amphiphiles which form a monolayer are known in the art and include, for example, block copolymers (Gonzalez-Perez et al., Langmuir, 2009, 25, 10447-10450). Block copolymers are polymeric materials in which two or more monomer sub-units that are polymerised together to create a single polymer chain. Block copolymers typically have properties that are contributed by each monomer sub-unit. However, a block copolymer may have unique properties that polymers formed from the individual sub-units do not possess. Block copolymers can be engineered such that one of the monomer sub-units is hydrophobic (e.g. lipophilic), whilst the other sub-unit(s) are hydrophilic whilst in aqueous media. In this case, the block copolymer may possess amphiphilic properties and may form a structure that mimics a biological membrane. The block copolymer may be a diblock (consisting of two monomer sub-units), but may also be constructed from more than two monomer sub-units to form more complex arrangements that behave as amphiphiles. The copolymer may be a triblock, tetrablock or pentablock copolymer. The membrane is preferably a triblock copolymer membrane.


Archaebacterial bipolar tetraether lipids are naturally occurring lipids that are constructed such that the lipid forms a monolayer membrane. These lipids are generally found in extremophiles that survive in harsh biological environments, thermophiles, halophiles and acidophiles. Their stability is believed to derive from the fused nature of the final bilayer. It is straightforward to construct block copolymer materials that mimic these biological entities by creating a triblock polymer that has the general motif hydrophilic-hydrophobic-hydrophilic. This material may form monomeric membranes that behave similarly to lipid bilayers and encompass a range of phase behaviours from vesicles through to laminar membranes. Membranes formed from these triblock copolymers hold several advantages over biological lipid membranes. Because the triblock copolymer is synthesised, the exact construction can be carefully controlled to provide the correct chain lengths and properties required to form membranes and to interact with pores and other proteins.


Block copolymers may also be constructed from sub-units that are not classed as lipid sub-materials: for example a hydrophobic polymer may be made from siloxane or other non-hydrocarbon based monomers. The hydrophilic sub-section of block copolymer can also possess low protein binding properties, which allows the creation of a membrane that is highly resistant when exposed to raw biological samples. This head group unit may also be derived from non-classical lipid head-groups.


Triblock copolymer membranes also have increased mechanical and environmental stability compared with biological lipid membranes, for example a much higher operational temperature or pH range. The synthetic nature of the block copolymers provides a platform to customise polymer based membranes for a wide range of applications.


The membrane is most preferably one of the membranes disclosed in WO2014/064443 or WO2014/064444.


The amphiphilic molecules may be chemically-modified or functionalised to facilitate coupling of the complex.


The amphiphilic layer may be a monolayer or a bilayer. The amphiphilic layer is typically planar. The amphiphilic layer may be curved. The amphiphilic layer may be supported. The amphiphilic layer may be concave. The amphiphilic layer may be suspended from raised pillars such that the peripheral region of the amphiphilic layer (which is attached to the pillars) is higher than the amphiphilic layer region. This may allow the microparticle to travel, move, slide or roll along the membrane as described above.


Amphiphilic membranes are typically naturally mobile, essentially acting as two dimensional fluids with lipid diffusion rates of approximately 10−8 cm s−1. This means that the pore and coupled complex can typically move within an amphiphilic membrane.


The membrane may be a lipid bilayer. Lipid bilayers are models of cell membranes and serve as excellent platforms for a range of experimental studies. For example, lipid bilayers can be used for in vitro investigation of membrane proteins by single-channel recording. Alternatively, lipid bilayers can be used as biosensors to detect the presence of a range of substances. The lipid bilayer may be any lipid bilayer. Suitable lipid bilayers include, but are not limited to, a planar lipid bilayer, a supported bilayer or a liposome. The lipid bilayer is preferably a planar lipid bilayer. Suitable lipid bilayers are disclosed in WO 2008/102121, WO 2009/077734 and WO 2006/100484.


Methods for forming lipid bilayers are known in the art. Lipid bilayers are commonly formed by the method of Montal and Mueller (Proc. Natl. Acad. Sci. USA., 1972; 69: 3561-3566), in which a lipid monolayer is carried on aqueous solution/air interface past either side of an aperture which is perpendicular to that interface. The lipid is normally added to the surface of an aqueous electrolyte solution by first dissolving it in an organic solvent and then allowing a drop of the solvent to evaporate on the surface of the aqueous solution on either side of the aperture. Once the organic solvent has evaporated, the solution/air interfaces on either side of the aperture are physically moved up and down past the aperture until a bilayer is formed. Planar lipid bilayers may be formed across an aperture in a membrane or across an opening into a recess.


The method of Montal & Mueller is popular because it is a cost-effective and relatively straightforward method of forming good quality lipid bilayers that are suitable for protein pore insertion. Other common methods of bilayer formation include tip-dipping, painting bilayers and patch-clamping of liposome bilayers.


Tip-dipping bilayer formation entails touching the aperture surface (for example, a pipette tip) onto the surface of a test solution that is carrying a monolayer of lipid. Again, the lipid monolayer is first generated at the solution/air interface by allowing a drop of lipid dissolved in organic solvent to evaporate at the solution surface. The bilayer is then formed by the Langmuir-Schaefer process and requires mechanical automation to move the aperture relative to the solution surface.


For painted bilayers, a drop of lipid dissolved in organic solvent is applied directly to the aperture, which is submerged in an aqueous test solution. The lipid solution is spread thinly over the aperture using a paintbrush or an equivalent. Thinning of the solvent results in formation of a lipid bilayer. However, complete removal of the solvent from the bilayer is difficult and consequently the bilayer formed by this method is less stable and more prone to noise during electrochemical measurement.


Patch-clamping is commonly used in the study of biological cell membranes. The cell membrane is clamped to the end of a pipette by suction and a patch of the membrane becomes attached over the aperture. The method has been adapted for producing lipid bilayers by clamping liposomes which then burst to leave a lipid bilayer sealing over the aperture of the pipette. The method requires stable, giant and unilamellar liposomes and the fabrication of small apertures in materials having a glass surface.


Liposomes can be formed by sonication, extrusion or the Mozafari method (Colas et al. (2007) Micron 38:841-847).


In a preferred embodiment, the lipid bilayer is formed as described in WO 2009/077734. Advantageously in this method, the lipid bilayer is formed from dried lipids. In a most preferred embodiment, the lipid bilayer is formed across an opening as described in WO2009/077734.


A lipid bilayer is formed from two opposing layers of lipids. The two layers of lipids are arranged such that their hydrophobic tail groups face towards each other to form a hydrophobic interior. The hydrophilic head groups of the lipids face outwards towards the aqueous environment on each side of the bilayer. The bilayer may be present in a number of lipid phases including, but not limited to, the liquid disordered phase (fluid lamellar), liquid ordered phase, solid ordered phase (lamellar gel phase, interdigitated gel phase) and planar bilayer crystals (lamellar sub-gel phase, lamellar crystalline phase).


Any lipid composition that forms a lipid bilayer may be used. The lipid composition is chosen such that a lipid bilayer having the required properties, such as surface charge, ability to support membrane proteins, packing density or mechanical properties, is formed. The lipid composition can comprise one or more different lipids. For instance, the lipid composition can contain up to 100 lipids. The lipid composition preferably contains 1 to 10 lipids. The lipid composition may comprise naturally-occurring lipids and/or artificial lipids.


The lipids typically comprise a head group, an interfacial moiety and two hydrophobic tail groups which may be the same or different. Suitable head groups include, but are not limited to, neutral head groups, such as diacylglycerides (DG) and ceramides (CM): zwitterionic head groups, such as phosphatidylcholine (PC), phosphatidylethanolamine (PE) and sphingomyelin (SM); negatively charged head groups, such as phosphatidylglycerol (PG); phosphatidylserine (PS), phosphatidylinositol (PI), phosphatic acid (PA) and cardiolipin (CA); and positively charged headgroups, such as trimethylammonium-Propane (TAP). Suitable interfacial moieties include, but are not limited to, naturally-occurring interfacial moieties, such as glycerol-based or ceramide-based moieties. Suitable hydrophobic tail groups include, but are not limited to, saturated hydrocarbon chains, such as lauric acid (n-Dodecanolic acid), myristic acid (n-Tetradecononic acid), palmitic acid (n-Hexadecanoic acid), stearic acid (n-Octadecanoic) and arachidic (n-Eicosanoic); unsaturated hydrocarbon chains, such as oleic acid (cis-9-Octadecanoic); and branched hydrocarbon chains, such as phytanoyl. The length of the chain and the position and number of the double bonds in the unsaturated hydrocarbon chains can vary. The length of the chains and the position and number of the branches, such as methyl groups, in the branched hydrocarbon chains can vary. The hydrophobic tail groups can be linked to the interfacial moiety as an ether or an ester. The lipids may be mycolic acid.


The lipids can also be chemically-modified. The head group or the tail group of the lipids may be chemically-modified. Suitable lipids whose head groups have been chemically-modified include, but are not limited to, PEG-modified lipids, such as 1,2-Diacyl-sn-Glycero-3-Phosphoethanolamine-N-[Methoxy(Polyethylene glycol)-2000]; functionalised PEG Lipids, such as 1,2-Distearoyl-sn-Glycero-3 Phosphoethanolamine-N-[Biotinyl(Polyethylene Glycol)2000]; and lipids modified for conjugation, such as 1,2-Dioleoyl-sn-Glycero-3-Phosphoethanolamine-N-(succinyl) and 1,2-Dipalmitoyl-sn-Glycero-3-Phosphoethanolamine-N-(Biotinyl). Suitable lipids whose tail groups have been chemically-modified include, but are not limited to, polymerisable lipids, such as 1,2-bis(10,12-tricosadiynoyl)-sn-Glycero-3-Phosphocholine; fluorinated lipids, such as 1-Palmitoyl-2-(16-Fluoropalmitoyl)-sn-Glycero-3-Phosphocholine; deuterated lipids, such as 1,2-Dipalmitoyl-D62-sn-Glycero-3-Phosphocholine; and ether linked lipids, such as 1,2-Di-O-phytanyl-sn-Glycero-3-Phosphocholine. The lipids may be chemically-modified or functionalised to facilitate coupling of the complex.


The amphiphilic layer, for example the lipid composition, typically comprises one or more additives that will affect the properties of the layer. Suitable additives include, but are not limited to, fatty acids, such as palmitic acid, myristic acid and oleic acid; fatty alcohols, such as palmitic alcohol, myristic alcohol and oleic alcohol; sterols, such as cholesterol, ergosterol, lanosterol, sitosterol and stigmasterol; lysophospholipids, such as 1-Acyl-2-Hydroxy-sn-Glycero-3-Phosphocholine; and ceramides.


Solid state layers can be formed from both organic and inorganic materials including, but not limited to, microelectronic materials, insulating materials such as Si3N4, Al2O3, and SiO, organic and inorganic polymers such as polyamide, plastics such as Teflon® or elastomers such as two-component addition-cure silicone rubber, and glasses. The solid state layer may be formed from graphene. Suitable graphene layers are disclosed in WO 2009/035647. Yusko et al., Nature Nanotechnology, 2011; 6: 253-260 and US Patent Application No. 2013/0048499 describe the delivery of proteins to transmembrane pores in solid state layers without the use of microparticles. The method of the invention may be used to improve the delivery in the methods disclosed in these documents.


The method is typically carried out using (i) an artificial amphiphilic layer comprising a pore, (ii) an isolated, naturally-occurring lipid bilayer comprising a pore, or (iii) a cell having a pore inserted therein. The method is typically carried out using an artificial amphiphilic layer, such as an artificial triblock copolymer layer. The layer may comprise other transmembrane and/or intramembrane proteins as well as other molecules in addition to the pore. Suitable apparatus and conditions are discussed below. The method of the invention is typically carried out in vitro.


The membrane to which the complex is delivered is typically contained in a liquid. The liquid keeps the membrane “wet” and stops it drying out. The liquid is typically an aqueous solution. The aqueous solution typically has the same density as water. The density of the aqueous solution is typically about 1 g/cm3. The density of the solution may vary depending on temperature and the exact composition of the solution. The aqueous solution typically has a density between about 0.97 and about 1.03 g/cm3.


The membrane typically separates two volumes of aqueous solution. The membrane resists the flow of electrical current between the volumes. The transmembrane pore inserted into the membrane selectively allows the passage of ions across the membrane, which can be recorded as an electrical signal detected by electrodes in the two volumes of aqueous solution. The presence of a complex comprising the target polynucleotide modulates the flow of ions and is detected by observing the resultant variations in the electrical signal.


Array

The membrane is typically part of an array of membranes, wherein each membrane preferably comprises a transmembrane pore. Therefore, the invention provides a method of detecting a target polynucleotide using an array of membranes.


The membrane may be comprised in an apparatus having an array of electrically isolated membranes, each individually addressed using its own electrode, such that the array is equivalent to many individual sensors measuring in parallel from a test sample. The membranes may be relatively densely packed, allowing a large number of membranes to be used for a given volume of test sample. Suitable arrays of membranes and apparatuses are described in the art, for example in WO 2009/077734 and WO2012/042226. WO 2009/077734, for example, discloses a plurality of individually addressable lipid bilayers formed across an array of microwell apertures, each microwell containing an electrode and an aqueous medium in contact with the lipid bilayer.


The apparatus is typically provided to the end user in a ‘ready to use’ state wherein the membranes and transmembrane pores are pre-inserted. A typical apparatus provided in a ‘ready to use’ state comprises an array of amphiphilic membranes, each membrane comprising a transmembrane pore and being provided across a well containing a liquid. Such an apparatus and method of making it are disclosed by WO2014/064443. Test liquid to be analysed is applied to the upper surface of the amphiphilic membranes.


Providing an apparatus in a ‘ready to use’ state however has additional considerations in that care needs to be taken that the sensor does not dry out, namely that liquid is not lost from the well by passage through the amphiphilic membrane, which may result in a loss of performance or damage the sensor. One solution to address the problem of drying out of the sensor is to provide the device with a buffer liquid over the surface of the amphiphilic membrane such that any evaporation through the surface of the membrane is minimised and the liquids provided on either side of the membrane may have the same ionic strength so as to reduce any osmotic effects. In use the buffer liquid may be removed from the surface of the amphiphilic membrane and a test liquid to be analysed is introduced to contact the surface.


Some applications may use measurement of electrical properties across the membranes, for example ion current flow. To provide for such measurements, the apparatus may further comprise respective electrodes in each compartment making electrical contact with the volumes comprising polar medium. Other types of measurements may be carried out for example optical measurements such as fluorescence measurements and FET measurements. Optical measurements and electrical measurements may be carried out simultaneously (Heron A J et al., J Am Chem Soc. 2009; 131(5):1652-3).


The apparatus may further comprise a common electrode. The apparatus may further comprise an electrical circuit connected between the common electrode and the respective electrodes in each compartment, the electrical circuit being arranged to take electrical measurements. Such electrical measurements may be dependent on a process occurring at or through the membranes.


The apparatus may comprise FET array for making measurements of the nanopore array.


Pore

A nanopore is an aperture with at least one dimension on the nanometer scale. A nanopore may be created by a pore-forming protein or as a hole in synthetic materials such as silicon or graphene. Alternatively a nanopore may be a hybrid of these e.g., a protein channel set in a synthetic membrane. A nanopore may also be a DNA origami pore or a glass capillary. A nanopore is typically less than about 20 nm in diameter but can be up to about 100 nm in diameter.


A transmembrane pore is a structure that crosses a membrane to some degree. It permits hydrated ions driven by an applied potential to flow across or within the membrane. The transmembrane pore typically crosses the entire membrane so that hydrated ions may flow from one side of the membrane to the other side of the membrane. However, the transmembrane pore does not have to cross the membrane. It may be closed at one end. For instance, the pore may be a well, gap, channel, trench or slit in the membrane along which or into which hydrated ions may flow.


Any transmembrane pore may be used in the invention. The pore may be biological or artificial. Suitable pores include, but are not limited to, protein pores, polynucleotide pores and solid state pores. The pore may be a DNA origami pore (Langecker et al., Science, 2012; 338: 932-936). The transmembrane pore is preferably a transmembrane protein pore. A transmembrane protein pore is a polypeptide or a collection of polypeptides that permits hydrated ions, such as polynucleotide, to flow from one side of a membrane to the other side of the membrane. In the present invention, the transmembrane protein pore is capable of forming a pore that permits hydrated ions driven by an applied potential to flow from one side of the membrane to the other. The transmembrane protein pore preferably permits polynucleotides to flow from one side of the membrane, such as a triblock copolymer membrane, to the other. The transmembrane protein pore allows a polynucleotide, such as DNA or RNA, to be moved through the pore.


The transmembrane protein pore may be a monomer or an oligomer. The pore is preferably made up of several repeating subunits, such as at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, or at least 16 subunits. The pore is preferably a hexameric, heptameric, octameric or nonameric pore. The pore may be a homo-oligomer or a hetero-oligomer.


The transmembrane protein pore typically comprises a barrel or channel through which the ions may flow. The subunits of the pore typically surround a central axis and contribute strands to a transmembrane β barrel or channel or a transmembrane α-helix bundle or channel.


The barrel or channel of the transmembrane protein pore typically comprises amino acids that facilitate interaction with s, such as nucleotides, polynucleotides or nucleic acids. These amino acids are preferably located near a constriction of the barrel or channel. The transmembrane protein pore typically comprises one or more positively charged amino acids, such as arginine, lysine or histidine, or aromatic amino acids, such as tyrosine or tryptophan. These amino acids typically facilitate the interaction between the pore and nucleotides, polynucleotides or nucleic acids.


Transmembrane protein pores for use in accordance with the invention can be derived from β-barrel pores or α-helix bundle pores. β-barrel pores comprise a barrel or channel that is formed from β-strands. Suitable β-barrel pores include, but are not limited to, β-toxins, such as α-hemolysin, anthrax toxin and leukocidins, and outer membrane proteins/porins of bacteria, such as Mycobacterium smegmatis porin (Msp), for example MspA, MspB, MspC or MspD, CsgG, outer membrane porin F (OmpF), outer membrane porin G (OmpG), outer membrane phospholipase A and Neisseria autotransporter lipoprotein (NalP) and other pores, such as lysenin. α-helix bundle pores comprise a barrel or channel that is formed from α-helices. Suitable α-helix bundle pores include, but are not limited to, inner membrane proteins and α outer membrane proteins, such as WZA and ClyA toxin.


The transmembrane pore may be derived from or based on Msp, α-hemolysin (α-HL), lysenin, CsgG, ClyA, Sp1 and haemolytic protein fragaceatoxin C (FraC). The transmembrane protein pore is preferably derived from CsgG, more preferably from CsgG from E. coli Str. K-12 substr. MC4100. Suitable pores derived from CsgG are disclosed in WO 2016/034591. The transmembrane pore may be derived from lysenin. Suitable pores derived from lysenin are disclosed in WO 2013/153359.


The wild type α-hemolysin pore is formed of 7 identical monomers or sub-units (i.e., it is heptameric). The sequence of one monomer or sub-unit of α-hemolysin-NN is disclosed in, for example, WO2016/059375.


The transmembrane protein pore is preferably derived from Msp, more preferably from MspA. Suitable pores derived from MspA are disclosed in WO 2012/107778.


Any of the proteins described herein, such as the transmembrane protein pores, may be modified to assist their identification or purification, for example by the addition of histidine residues (a his tag), aspartic acid residues (an asp tag), a streptavidin tag, a flag tag, a SUMO tag, a GST tag or a MBP tag, or by the addition of a signal sequence to promote their secretion from a cell where the polypeptide does not naturally contain such a sequence. An alternative to introducing a genetic tag is to chemically react a tag onto a native or engineered position on the pore or construct. An example of this would be to react a gel-shift reagent to a cysteine engineered on the outside of the pore. This has been demonstrated as a method for separating hemolysin hetero-oligomers (Chem Biol. 1997 Jul.; 4(7):497-505).


The pore may be labelled with a revealing label. The revealing label may be any suitable label which allows the pore to be detected. Suitable labels include, but are not limited to, fluorescent molecules, radioisotopes, e.g. 125I, 35S, enzymes, antibodies, antigens, polynucleotides and ligands such as biotin.


Any of the proteins described herein, such as the transmembrane protein pores, may be made synthetically or by recombinant means. For example, the pore may be synthesised by in vitro translation and transcription (IVTT). The amino acid sequence of the pore may be modified to include non-naturally occurring amino acids or to increase the stability of the protein. When a protein is produced by synthetic means, such amino acids may be introduced during production. The pore may also be altered following either synthetic or recombinant production.


Any of the proteins described herein, such as the transmembrane protein pores, can be produced using standard methods known in the art. Polynucleotide sequences encoding a pore or construct may be derived and replicated using standard methods in the art. Polynucleotide sequences encoding a pore or construct may be expressed in a bacterial host cell using standard techniques in the art. The pore may be produced in a cell by in situ expression of the polypeptide from a recombinant expression vector. The expression vector optionally carries an inducible promoter to control the expression of the polypeptide. These methods are described in Sambrook, J. and Russell, D. (2001). Molecular Cloning: A Laboratory Manual, 3rd Edition. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY.


The pore may be produced in large scale following purification by any protein liquid chromatography system from protein producing organisms or after recombinant expression. Typical protein liquid chromatography systems include FPLC, AKTA systems, the Bio-Cad system, the Bio-Rad BioLogic system and the Gilson HPLC system.


Diagnosis

The methods of the invention can be used to diagnose or prognose a disease or condition. The disease or condition is preferably cancer, coronary heart disease, cardiovascular disease, tuberculosis or sepsis.


Examples of the disease or condition include abdominal aortic aneurysm, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), acute myocardial infarction, acute promyelocytic leukemia (APL), adenoma, adrenocortical carcinoma, alcoholic liver disease, Alzheimer's disease, anaplastic thyroid carcinoma (ATC), anxiety disorder, asthma, astrocytoma, atopic dermatitis, autism spectrum disorder (ASD), B-cell chronic lymphocytic leukemia, B-cell lymphoma, Becker muscular dystrophy (BMD), bladder cancer, brain neoplasm, breast cancer, Burkitt lymphoma, cardiac hypertrophy, cardiomyopathy, cardiovascular disease, cerebellar neurodegeneration, cervical cancer, cholangiocarcinoma, cholesteatoma, choriocarcinoma, chronic lymphocytic leukemia, chronic myeloid leukemia, chronic pancreatitis, colon carcinoma, colorectal cancer, congenital heart disease, coronary artery disease, cowden syndrome, dermatomyositis (DM), diabetic nephropathy, diarrhea predominant irritable bowel syndrome, diffuse large B-cell lymphoma, dilated cardiomyopathy, down syndrome (DS), duchenne muscular dystrophy (DMD), endometrial cancer, endometrial endometrioid adenocarcinoma, endometriosis, epithelial ovarian cancer, esophageal cancer, esophagus squamous cell carcinoma, essential thrombocythemia (ET), facioscapulohumeral muscular dystrophy (FSHD), follicular lymphoma (FL), follicular thyroid carcinoma (FTC), frontotemporal dementia, gastric cancer (stomach cancer), glioblastoma, glioblastoma multiforme (GBM), glioma, glomerular disease, glomerulosclerosis, hamartoma, HBV-related cirrhosis, HCV infection, head and neck cancer, head and neck squamous cell carcinoma (HNSCC), hearing loss, heart disease, heart failure, hepatitis B, hepatitis C, hepatocellular carcinoma (HCC), hilar cholangiocarcinoma, Hodgkin's lymphoma, homozygous sickle cell disease (HbSS), Huntington's disease (HD), hypertension, hypopharyngeal cancer, inclusion body myositis (IBM), insulinoma, intrahepatic cholangiocarcinoma (ICC), kidney cancer, kidney disease, laryngeal carcinoma, late insomnia (sleep disease), leiomyoma of lung, leukemia, limb-girdle muscular dystrophies types 2A (LGMD2A), lipoma, lung adenocarcinoma, lung cancer, lymphoproliferative disease, malignant lymphoma, malignant melanoma, malignant mesothelioma (MM), mantle cell lymphoma (MCL), medulloblastoma, melanoma, meningioma, metabolic disease, miyoshi myopathy (MM), multiple myeloma (MM), multiple sclerosis, MYC-rearranged lymphoma, myelodysplastic syndrome, myeloproliferative disorder, myocardial infarction, myocardial injury, myoma, nasopharyngeal carcinoma (NPC), nemaline myopathy (NM), nephritis, neuroblastoma (NB), neutrophilia, Niemann-Pick type C (NPC) disease, non-alcoholic fatty liver disease (NAFLD), non-small cell lung cancer (NSCLC), obesity, oral carcinomaosteosarcoma ovarian cancer (OC), pancreatic cancer, pancreatic ductal adenocarcinoma (PDAC), pancreatic neoplasia, panic disease, papillary thyroid carcinoma (PTC), Parkinson's disease, PFV-1 infection, pharyngeal disease, pituitary adenoma, polycystic kidney disease, polycystic liver disease, polycythemia vera (PV), polymyositis (PM), primary biliary cirrhosis (PBC), primary myelotibrosis, prion disease, prostate cancer, psoriasic arthritis, psoriasis, pulmonary hypertension, recurrent ovarian cancer, renal cell carcinoma, renal clear cell carcinoma, retinitis pigmentosa (RP), retinoblastoma, rhabdomyosarcoma, rheumatic heart disease and atrial fibrillation, rheumatoid arthritis, sarcoma, schizophrenia, sepsis, serous ovarian cancer, Sezary syndrome, skin disease, small cell lung cancer, spinocerebellar ataxia, squamous carcinoma, T-cell leukemia, teratocarcinoma, testicular germ cell tumor, thalassemia, thyroid cancer, tongue squamous cell carcinoma, tourette's syndrome, type 2 diabetes, ulcerative colitis (UC), uterine leiomyoma (ULM), uveal melanoma, vascular disease, vesicular stomatitis or Waldenstrom macroglobulinemia (WM).


Since in an embodiment using a multiplex method the presence of absence of two or more target polynucleotides (e.g. at least 5 ore more, 10 or more, 20 or more or 30 or more) may be determined, it is possible to prognose or diagnose two or more (e.g. 3, 4, 5, 6 or more) of any of the diseases listed above. Accordingly, a multiplex method for detecting and/or analyzing a plurality (e.g. at least 2 or more, at least 3 or more, at least 10 or more, at least 20 or more or at least 30 or more) of target polynucleotides is provided.


The method may also be used to detect polynucleotides derived from a microorganism or group of microorganisms. This is useful in disease diagnosis and monitoring, but also has other applications. For example, the method may be used to analyse gut or vaginal flora, microorganisms present on the skin or elsewhere. The microorganism may, for example, be a bacterium, virus, fungus or mycobacterium. The method may be used to determine which infectious agent is causing a disease and hence to determine the best course of treatment. For example, urinary tract infections and other infections are increasingly developing antibacterial resistance. The method may be used to determine the bacterium responsible for an infection and hence to identify an antibiotic or other treatment that will successfully treat the infection.


The method may be used to characterize genomic DNA. In one particular exemplary embodiment, the method may be used to identity polymorphisms, such as SNPs. In another embodiment the method so the invention may be used for repertoire analysis, for example of V(D)J regions. Such methods may use samples derived from blood cells, or T-cells for analysis.


The methods may also be used to characterize unknown sequences.


Polynucleotide Binding Protein

The polynucleotide binding protein may be any protein that is capable of binding to the polynucleotide and controlling its movement through the pore. It is straightforward in the art to determine whether or not a protein binds to a polynucleotide. The protein typically interacts with and modifies at least one property of the polynucleotide. The protein may modify the polynucleotide by cleaving it to form individual nucleotides or shorter chains of nucleotides, such as di- or trinucleotides. The moiety may modify the polynucleotide by orienting it or moving it to a specific position, e.g. controlling its movement.


The polynucleotide binding protein is preferably derived from a polynucleotide handling enzyme. A polynucleotide handling enzyme is a polypeptide that is capable of interacting with and modifying at least one property of a polynucleotide. The enzyme may modify the polynucleotide by cleaving it to form individual nucleotides or shorter chains of nucleotides, such as di- or trinucleotides. The enzyme may modify the polynucleotide by orienting it or moving it to a specific position. The polynucleotide handling enzyme does not need to display enzymatic activity as long as it is capable of binding the polynucleotide and controlling its movement through the pore. For instance, the enzyme may be modified to remove its enzymatic activity or may be used under conditions which prevent it from acting as an enzyme. Such conditions are discussed in more detail below.


The polynucleotide handling enzyme is preferably derived from a nucleolytic enzyme. The polynucleotide handling enzyme used in the construct of the enzyme is more preferably derived from a member of any of the Enzyme Classification (EC) groups 3.1.11, 3.1.13, 3.1.14, 3.1.15, 3.1.16, 3.1.21, 3.1.22, 3.1.25, 3.1.26, 3.1.27, 3.1.30 and 3.1.31. The enzyme may be any of those disclosed in WO 2010/086603.


Preferred enzymes are polymerases, exonucleases, helicases, translocases and topoisomerases, such as gyrases. Suitable enzymes include, but are not limited to, exonuclease I from E. coli, exonuclease Ill enzyme from E. coli, RecJ from T. thermophilus and bacteriophage lambda exonuclease, TatD exonuclease and variants thereof. The polymerase may be PyroPhage® 3173 DNA Polymerase (which is commercially available from Lucigen® Corporation), SD Polymerase (commercially available from Bioron®) or variants thereof. The enzyme is preferably Phi29 DNA polymerase or a variant thereof. The topoisomerase is preferably a member of any of the Moiety Classification (EC) groups 5.99.1.2 and 5.99.1.3.


The enzyme is most preferably derived from a helicase. The helicase may be or be derived from a Hel308 helicase, a RecD helicase, such as TraI helicase or a TrwC helicase, a XPD helicase or a Dda helicase. The helicase may be or be derived from Hel308 Mbu, Hel308 Csy Hel308 Tga. Hel308 Mhu, TraI Eco, XPD Mbu or a variant thereof.


The helicase may be any of the helicases, modified helicases or helicase constructs disclosed in WO 2013/057495, WO 2013/098562, WO2013098561, WO 2014/013260, WO 2014/013259, WO 2014/013262 and WO/2015/055981.


The Dda helicase preferably comprises any of the modifications disclosed in WO/2015/055981 and WO 2016/055777.


Any number of helicases may be used in accordance with the invention. For instance, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more helicases may be used. In some embodiments, different numbers of helicases may be used. Any combination of two or more of the helicases mentioned above may be used. The two or more helicases may be two or more Dda helicases. The two or more helicases may be one or more Dda helicases and one or more TrwC helicases. The two or more helicases may be different variants of the same helicase.


The two or more helicases are preferably attached to one another. The two or more helicases are more preferably covalently attached to one another. The helicases may be attached in any order and using any method. Preferred helicase constructs for use in the invention are described in WO 2014/013260, WO 2014/013259, WO 2014/013262 and WO2015/055981.


Polynucleotide binding ability can be measured using any method known in the art. For instance, the protein can be contacted with a polynucleotide and its ability to bind to and move along the polynucleotide can be measured. The protein may include modifications that facilitate binding of the polynucleotide and/or facilitate its activity at high salt concentrations and/or room temperature. Proteins may be modified such that they bind polynucleotides (e.g. retain polynucleotide binding ability) but do not function as a helicase (e.g. do not move along polynucleotides when provided with all the necessary components to facilitate movement, e.g. ATP and Mg2+). Such modifications are known in the art. For instance, modification of the Mg2′ binding domain in helicases typically results in variants which do not function as helicases. These types of variants may act as molecular brakes.


The enzyme may be covalently attached to the pore. Any method may be used to covalently attach the enzyme to the pore.


In strand sequencing, the polynucleotide is translocated through the pore either with or against an applied potential. Exonucleases that act progressively or processively on double stranded polynucleotides can be used on the cis side of the pore to feed the remaining single strand through under an applied potential or the trans side under a reverse potential. Likewise, a helicase that unwinds the double stranded DNA can also be used in a similar manner. A polymerase may also be used. There are also possibilities for sequencing applications that require strand translocation against an applied potential, but the DNA must be first “caught” by the enzyme under a reverse or no potential. With the potential then switched back following binding the strand will pass cis to trans through the pore and be held in an extended conformation by the current flow. The single strand DNA exonucleases or single strand DNA dependent polymerases can act as molecular motors to pull the recently translocated single strand back through the pore in a controlled stepwise manner, trans to cis, against the applied potential.


Any helicase may be used in the invention. Helicases may work in two modes with respect to the pore. First, the method is preferably carried out using a helicase such that it moves the polynucleotide through the pore with the field resulting from the applied voltage. In this mode the 5′ end of the polynucleotide is first captured in the pore, and the helicase moves the polynucleotide into the pore such that it is passed through the pore with the field until it finally translocates through to the trans side of the membrane. Alternatively, the method is preferably carried out such that a helicase moves the polynucleotide through the pore against the field resulting from the applied voltage. In this mode the 3′ end of the polynucleotide is first captured in the pore, and the helicase moves the polynucleotide through the pore such that it is pulled out of the pore against the applied field until finally ejected back to the cis side of the membrane.


The method may also be carried out in the opposite direction. The 3′ end of the polynucleotide may be first captured in the pore and the helicase may move the polynucleotide into the pore such that it is passed through the pore with the field until it finally translocates through to the trans side of the membrane.


When the helicase is not provided with the necessary components to facilitate movement or is modified to hinder or prevent its movement, it can bind to the polynucleotide and act as a brake slowing the movement of the polynucleotide when it is pulled into the pore by the applied field. In the inactive mode, it does not matter whether the polynucleotide is captured either 3′ or 5′ down, it is the applied field which pulls the polynucleotide into the pore towards the trans side with the enzyme acting as a brake. When in the inactive mode, the movement control of the polynucleotide by the helicase can be described in a number of ways including ratcheting, sliding and braking. Helicase variants which lack helicase activity can also be used in this way.


The polynucleotide may be contacted with the polynucleotide binding protein and the pore in any order. It is preferred that, when the polynucleotide is contacted with the polynucleotide binding protein, such as a helicase, and the pore, the polynucleotide firstly forms a complex with the protein. When the voltage is applied across the pore, the polynucleotide/protein complex then forms a complex with the pore and controls the movement of the polynucleotide through the pore.


Any steps in the method using a polynucleotide binding protein are typically carried out in the presence of free nucleotides or free nucleotide analogues and an enzyme cofactor that facilitates the action of the polynucleotide binding protein. The free nucleotides may be one or more of any of the individual nucleotides discussed above. The free nucleotides include, but are not limited to, adenosine monophosphate (AMP), adenosine diphosphate (ADP), adenosine triphosphate (ATP), guanosine monophosphate (GMP), guanosine diphosphate (GDP), guanosine triphosphate (GTP), thymidine monophosphate (TMP), thymidine diphosphate (TDP), thymidine triphosphate (TTP), uridine monophosphate (UMP), uridine diphosphate (UDP), uridine triphosphate (UTP), cytidine monophosphate (CMP), cytidine diphosphate (CDP), cytidine triphosphate (CTP), cyclic adenosine monophosphate (cAMP), cyclic guanosine monophosphate (cGMP), deoxyadenosine monophosphate (dAMP), deoxyadenosine diphosphate (dADP), deoxyadenosine triphosphate (dATP), deoxyguanosine monophosphate (dGMP), deoxyguanosine diphosphate (dGDP), deoxyguanosine triphosphate (dGTP), deoxythymidine monophosphate (dTMP), deoxythymidine diphosphate (dTDP), deoxythymidine triphosphate (dTTP), deoxyuridine monophosphate (dUMP), deoxyuridine diphosphate (dUDP), deoxyuridine triphosphate (dUTP), deoxycytidine monophosphate (dCMP), deoxycytidine diphosphate (dCDP) and deoxycytidine triphosphate (dCTP). The free nucleotides are preferably selected from AMP, TMP, GMP, CMP, UMP, dAMP, dTMP, dGMP or dCMP. The free nucleotides are preferably adenosine triphosphate (ATP). The enzyme cofactor is a factor that allows the construct to function. The enzyme cofactor is preferably a divalent metal cation. The divalent metal cation is preferably Mg2+, Mn2+, Ca2+ or Co2+. The enzyme cofactor is most preferably Mg2+.


The molecular brakes may be any compound or molecule which binds to the polynucleotide and slows the movement of the polynucleotide through the pore. The molecular brake may be any of those discussed above. The molecular brake preferably comprises a compound which binds to the polynucleotide. The compound is preferably a macrocycle. Suitable macrocycles include, but are not limited to, cyclodextrins, calixarenes, cyclic peptides, crown ethers, cucurbiturils, pillararenes, derivatives thereof or a combination thereof. The cyclodextrin or derivative thereof may be any of those disclosed in Eliseev, A. V., and Schneider, H-J. (1994) J. Am. Chem. Soc. 116, 6081-6088. The cyclodextrin is more preferably heptakis-6-amino-β-cyclodextrin (am7-βCD), 6-monodeoxy-6-monoamino-β-cyclodextrin (ami-PCD) or heptakis-(6-deoxy-6-guanidino)-cyclodextrin (gu7-βCD).


Polynucleotide Characterisation

The method may involve characterising the target polynucleotide. As the target polynucleotide is contacted with the pore, one or more measurements which are indicative of one or more characteristics of the target polynucleotide are taken as the polynucleotide moves with respect to the pore.


The method may involve measuring two, three, four or five or more characteristics of each polynucleotide. The one or more characteristics are preferably selected from (i) the length of the polynucleotide, (ii) the identity of the polynucleotide, (iii) the sequence of the polynucleotide, (iv) the secondary structure of the polynucleotide and (v) whether or not the polynucleotide is modified. Any combination of (i) to (v) may be measured in accordance with the invention, such as {i}, {ii}, {iii}, {iv}, {v}, {i,ii}, {i,iii}, {i,iv}, {i,v}, {ii,iii}, {ii,iv}, {ii,v}, {iii,iv}, {iii,v}, {iv,v}, {i,ii,iii}, {iii,iv}, {i,i,v}, {i,iii,iv}, {i,iii,v}, {i,iv,v}, {ii,iii,iv}, {ii,iii,v}, {ii,iv,v}, {iii,iv,v}, {i,ii,iii,iv}, {i,ii,iii,v}, {i,ii,iv,v}, {i,iii,iv,v}, {ii,iii,iv,v} or {ii,ii,iii,iv,v}.


For (i), the length of the polynucleotide may be measured for example by determining the number of interactions between the polynucleotide and the pore or the duration of interaction between the polynucleotide and the pore.


For (ii), the identity of the polynucleotide may be measured in a number of ways. The identity of the polynucleotide may be measured in conjunction with measurement of the sequence of the polynucleotide or without measurement of the sequence of the polynucleotide. The former is straightforward; the polynucleotide is sequenced and thereby identified. The latter may be done in several ways. For instance, the presence of a particular motif in the polynucleotide may be measured (without measuring the remaining sequence of the polynucleotide). Alternatively, the measurement of a particular electrical and/or optical signal in the method may identify the polynucleotide as coming from a particular source.


For (iii), the sequence of the polynucleotide can be determined as described previously. Suitable sequencing methods, particularly those using electrical measurements, are described in Stoddart D et al., Proc Natl Acad Sci, 12; 106(19):7702-7, Lieberman K R et al, J Am Chem Soc. 2010; 132(50):17961-72, and International Application WO 2000/28312.


For (iv), the secondary structure may be measured in a variety of ways. For instance, if the method involves an electrical measurement, the secondary structure may be measured using a change in dwell time or a change in current flowing through the pore. This allows regions of single-stranded and double-stranded polynucleotide to be distinguished.


For (v), the presence or absence of any modification may be measured. The method preferably comprises determining whether or not the polynucleotide is modified by methylation, by oxidation, by damage, with one or more proteins or with one or more labels, tags or spacers. Specific modifications will result in specific interactions with the pore which can be measured using the methods described below. For instance, methylcytosine may be distinguished from cytosine on the basis of the current flowing through the pore during its interaction with each nucleotide.


The methods may be carried out using any apparatus that is suitable for investigating a membrane/pore system in which a pore is present in a membrane. The method may be carried out using any apparatus that is suitable for transmembrane pore sensing. For example, the apparatus comprises a chamber comprising an aqueous solution and a barrier that separates the chamber into two sections. The barrier typically has an aperture in which the membrane containing the pore is formed. Alternatively the barrier forms the membrane in which the pore is present.


The methods may be carried out using the apparatus described in WO 2008/102120).


A variety of different types of measurements may be made. This includes without limitation: electrical measurements and optical measurements. A suitable optical method involving the measurement of fluorescence is disclosed by J. Am. Chem. Soc. 2009, 131 1652-1653. Possible electrical measurements include: current measurements, impedance measurements, tunnelling measurements (Ivanov A P et al., Nano Lett. 2011 Jan. 12; 11(1):279-85), and FET measurements (International Application WO 2005/124888). Optical measurements may be combined with electrical measurements (Soni G V et al., Rev Sci Instrum. 2010 January; 81(1):014301). The measurement may be a transmembrane current measurement such as measurement of ionic current flowing through the pore.


Electrical measurements may be made using standard single channel recording equipment as describe in Stoddart D et al., Proc Natl Acad Sci, 12; 106(19):7702-7, Lieberman K R et al, J Am Chem Soc. 2010; 132(50):17961-72, and international Application WO 2000/28312. Alternatively, electrical measurements may be made using a multi-channel system, for example as described in International Application WO 2009/077734 and International Application WO 2011/067559.


The method is preferably carried out with a potential applied across the membrane. The applied potential may be a voltage potential. Alternatively, the applied potential may be a chemical potential. An example of this is using a salt gradient across a membrane, such as an amphiphilic layer. A salt gradient is disclosed in Holden et al., J Am Chem Soc. 2007 Jul. 11; 129(27):8650-5. In some instances, the current passing through the pore as a polynucleotide moves with respect to the pore is used to estimate or determine the sequence of the polynucleotide. This is strand sequencing.


The methods may involve measuring the current passing through the pore as the polynucleotide moves with respect to the pore. Therefore the apparatus may also comprise an electrical circuit capable of applying a potential and measuring an electrical signal across the membrane and pore. The methods may be carried out using a patch clamp or a voltage clamp. The methods preferably involve the use of a voltage clamp.


The methods may involve the measuring of a current passing through the pore as the polynucleotide moves with respect to the pore. Suitable conditions for measuring ionic currents through transmembrane protein pores are known in the art and disclosed in the Example. The method is typically carried out with a voltage applied across the membrane and pore. The voltage used is typically from +5 V to −5 V, such as from +4 V to −4 V, +3 V to −3 V or +2 V to −2 V. The voltage used is typically from −600 mV to +600 mV or −400 mV to +400 mV. The voltage used is preferably in a range having a lower limit selected from −400 mV, −300 mV, −200 mV, −150 mV, −100 mV, −50 mV, −20 mV and 0 mV and an upper limit independently selected from +10 mV, +20 mV, +50 mV, +100 mV, +150 mV, +200 mV, +300 mV and +400 mV. The voltage used is more preferably in the range 100 mV to 240 mV and most preferably in the range of 120 mV to 220 mV. It is possible to increase discrimination between different nucleotides by a pore by using an increased applied potential.


The methods are typically carried out in the presence of any charge carriers, such as metal salts, for example alkali metal salt, halide salts, for example chloride salts, such as alkali metal chloride salt. Charge carriers may include ionic liquids or organic salts, for example tetramethyl ammonium chloride, trimethylphenyl ammonium chloride, phenyltrimethyl ammonium chloride, or 1-ethyl-3-methyl imidazolium chloride. In the exemplary apparatus discussed above, the salt is present in the aqueous solution in the chamber. Potassium chloride (KCl), sodium chloride (NaCl), caesium chloride (CsCl) or a mixture of potassium ferrocyanide and potassium ferricyanide is typically used. KCl, NaCl and a mixture of potassium ferrocyanide and potassium ferricyanide are preferred. The charge carriers may be asymmetric across the membrane. For instance, the type and/or concentration of the charge carriers may be different on each side of the membrane.


The salt concentration may be at saturation. The salt concentration may be 3 M or lower and is typically from 0.1 to 2.5 M, from 0.3 to 1.9 M, from 0.5 to 1.8 M, from 0.7 to 1.7 M, from 0.9 to 1.6 M or from 1 M to 1.4 M. The salt concentration is preferably from 150 mM to 1 M. The method is preferably carried out using a salt concentration of at least 0.3 M, such as at least 0.4 M, at least 0.5 M, at least 0.6 M, at least 0.8 M, at least 1.0 M, at least 1.5 M, at least 2.0 M, at least 2.5 M or at least 3.0 M. High salt concentrations provide a high signal to noise ratio and allow for currents indicative of the presence of a nucleotide to be identified against the background of normal current fluctuations.


The methods are typically carried out in the presence of a buffer. In the exemplary apparatus discussed above, the buffer is present in the aqueous solution in the chamber. Any buffer may be used in the method of the invention. Typically, the buffer is phosphate buffer. Other suitable buffers are HEPES and Tris-HCl buffer. The methods are typically carried out at a pH of from 4.0 to 12.0, from 4.5 to 10.0, from 5.0 to 9.0, from 5.5 to 8.8, from 6.0 to 8.7 or from 7.0 to 8.8 or 7.5 to 8.5. The pH used is preferably about 7.5.


The methods may be carried out at from 0° C. to 100° C., from 15° C. to 95° C., from 16° C. to 90° C., from 17° C. to 85° C. from 18° C. to 80° C., 19° C. to 70° C., or from 20° C. to 60° C. The methods are typically carried out at room temperature. The methods are optionally carried out at a temperature that supports enzyme function, such as about 37° C.


Free Nucleotides and Co-Factors

The method may be carried out in the presence of free nucleotides or free nucleotide analogues and/or an enzyme cofactor that facilitates the action of the polynucleotide binding protein. The method may also be carried out in the absence of free nucleotides or free nucleotide analogues and in the absence of an enzyme cofactor. The free nucleotides may be one or more of any of the individual nucleotides discussed above. The free nucleotides include, but are not limited to, adenosine monophosphate (AMP), adenosine diphosphate (ADP), adenosine triphosphate (ATP), guanosine monophosphate (GMP), guanosine diphosphate (GDP), guanosine triphosphate (GTP), thymidine monophosphate (TMP), thymidine diphosphate (TDP), thymidine triphosphate (TTP), uridine monophosphate (UMP), uridine diphosphate (UDP), uridine triphosphate (UTP), cytidine monophosphate (CMP), cytidine diphosphate (CDP), cytidine triphosphate (CTP), cyclic adenosine monophosphate (cAMP), cyclic guanosine monophosphate (cGMP), deoxyadenosine monophosphate (dAMP), deoxyadenosine diphosphate (dADP), deoxyadenosine triphosphate (dATP), deoxyguanosine monophosphate (dGMP), deoxyguanosine diphosphate (dGDP), deoxyguanosine triphosphate (dGTP), deoxythymidine monophosphate (dTMP), deoxythymidine diphosphate (dTDP), deoxythymidine triphosphate (dTTP), deoxyuridine monophosphate (dUMP), deoxyuridine diphosphate (dUDP), deoxyuridine triphosphate (dUTP), deoxycytidine monophosphate (dCMP), deoxycytidine diphosphate (dCDP) and deoxycytidine triphosphate (dCTP). The free nucleotides are preferably selected from AMP, TMP, GMP, CMP, UMP, dAMP, dTMP, dGMP or dCMP. The free nucleotides are preferably adenosine triphosphate (ATP). The enzyme cofactor is a factor that allows the polynucleotide binding protein to function. The enzyme cofactor is preferably a divalent metal cation. The divalent metal cation is preferably Mg2+, Mn2+, Ca2+ or CO2+. The enzyme cofactor is most preferably Mg2+.


Measurement Types

A variety of different types of measurements may be made. This includes without limitation: electrical measurements and optical measurements. A suitable optical method involving the measurement of fluorescence is disclosed by J. Am. Chem. Soc. 2009, 131 1652-1653. Possible electrical measurements include: current measurements, impedance measurements, tunnelling measurements (Ivanov A P et al., Nano Lett. 2011 Jan. 12; 11(1):279-85), and FET measurements (International Application WO 2005/124888). Optical measurements may be combined with electrical measurements (Soni G V et al., Rev Sci Instrum. 2010 January; 81(1):014301). The measurement may be a transmembrane current measurement such as measurement of ionic current flowing through the pore. Electrical measurements may be made using standard single channel recording equipment as describe in Stoddart D et al., Proc Natl Acad Sci, 12; 106(19):7702-7, Lieberman K R et al, J Am Chem Soc. 2010; 132(50):17961-72, and International Application WO 2000/28312. Alternatively, electrical measurements may be made using a multi-channel system, for example as described in International Application WO 2009/077734 and International Application WO 2011/067559.


The method is preferably carried out with a potential applied across the membrane. The applied potential may be a voltage potential. Alternatively, the applied potential may be a chemical potential. An example of this is using a salt gradient across a membrane, such as an amphiphilic layer. A salt gradient is disclosed in Holden et al., J Am Chem Soc. 2007 Jul. 11; 129(27):8650-5. In some instances, the current passing through the pore as a polynucleotide moves with respect to the pore is used to estimate or determine the sequence of the polynucleotide. This is strand sequencing.


Kits

The invention also provides a kit for use in a method of the invention. The kit typically comprises: a polynucleotide-guided effector protein and an anchor capable of coupling to a membrane. The kit may further comprise one or more of a guide polynucleotide, an adaptor sequence, a polynucleotide binding protein capable of moving along a polynucleotide and/or a leader sequence. The kit may further comprise a microparticle.


The guide polynucleotide, polynucleotide-guided effector protein, anchor, adaptor, polynucleotide binding protein, leader sequence and/or microparticle may be any of those defined herein. The kit may comprise a panel of guide polynucleotides or of guide polynucleotide/polynucleotide-guided effector protein complexes. The panel is typically designed for a particular purpose, such as to detect a particular microorganism, markers associated with a disease, particular polymorphisms etc.


The kit may comprise components of any of the membranes disclosed above, such as an amphiphilic layer or a triblock copolymer membrane. The kit may further comprise a transmembrane pore. Any of the embodiments discussed above with reference to the method equally apply to the kits.


The kit may additionally comprise one or more other reagents or instruments which enable any of the embodiments mentioned above to be carried out. Such reagents or instruments include one or more of the following: suitable buffer(s) (aqueous solutions), means to obtain a sample from a subject (such as a vessel or an instrument comprising a needle), means to amplify and/or express polynucleotides, a membrane as defined above or voltage or patch clamp apparatus. Reagents may be present in the kit in a dry state such that a fluid sample is used to resuspend the reagents. The kit may also, optionally, comprise instructions to enable the kit to be used in the methods described herein or details regarding for which organism the method may be used. The kit may comprise a magnet or an electromagnet. The kit may, optionally, comprise nucleotides.


The kit may comprise a guide polynucleotide having an end extension, or first and second end extensions as described herein and a capture oligonucleotide or first and second capture oligonucleotides as described herein. The kit may further comprise a competitor oligonucleotide as described herein. The kit may further comprise beads comprising one half of an affinity molecule pair (e.g. streptavidin) and first and second capture oligonucleotides comprising the other half of an affinity molecule pair (e.g. biotin). The first and second capture oligonucleotides may each be bound to a separate surface, e.g. to a separate population of beads. The first capture oligonucleotide may be bound, for example, to “purification” beads or to a “purification” column. The second capture oligonucleotide may be bound, for example, to “delivery” beads. The “purification” beads and/or the “delivery” beads may be magnetic.


Also provided is a system for detecting a target polynucleotide in a sample comprising: a nanopore; a polynucleotide-guided effector protein comprising a guide polynucleotide binding domain; and a guide polynucleotide comprising a first portion that is complementary to a sequence in a portion of the target polynucleotide and a structure that is adapted to bind to the guide polynucleotide binding domain of the polynucleotide-guided effector protein. In one embodiment, the system further comprises a membrane, wherein the nanopore is present in the membrane. In one embodiment, the system further comprises a target polynucleotide. In one embodiment of the system, the target polynucleotide, guide polynucleotide and polynucleotide-guided effector protein form a complex. In one embodiment of the system, the target polynucleotide is coupled to a membrane.


The following non-limiting Examples illustrate the invention.


Example 1

This Example describes a method for detection of a specific target polynucleotide in a mixture by a nanopore. In this Example, the target DNA is identified using two types of CRISPR-Cas probes that bind to a target polynucleotide. The first contains an extension that anchors the target polynucleotide to the membrane via a cholesterol-tagged CRISPR-Cas probe. The second (“the analyte”) bears an extension carrying a bound polynucleotide binding protein (helicase), and positively identifies the target polynucleotide indirectly via polynucleotide binding protein controlled movement of a barcode sequence on the analyte through a nanopore.


Materials and Methods

Oligonucleotides AR131 and AR132 were annealed, each at 40 μM, in 10 mM Tris-Cl (pH 8.0), 1 mM EDTA, 100 mM NaCl, from 95° C. to 25° C. at 0.6° C. per minute. The hybridised DNA was known as “cholesterol hyb” (ONLA17351).


Oligonucleotides AR130 and ONLA11326 were annealed, each at 40 μM, in 10 mM Tris-Cl (pH 8.0), 1 mM EDTA, 100 mM NaCl, from 95° C. to 25° C. at 0.6° C. per minute. The hybridised DNA was known as ONLA17350. The polynucleotide binding protein was loaded and closed on the stall-containing strand of ONLA17350 as follows: the helicase was buffer-exchanged into 50 mM HEPES (pH 8.0), 100 mM potassium acetate, 1 mM EDTA using a Zeba desalting column (Thermo); the helicase was loaded on ONLA17350 by incubation (200 pd) of 500 nM (molecules) ONLA17350 with a 3.5 μM buffer-exchanged helicase in 50 mM HEPES (pH 8.0), 100 mM potassium acetate at room temperature for 5 min. The helicase was then closed around DNA by incubation of the mixture with 100 μM TMAD for 1 h at room temperature (final volume, 220 μl). Non-specifically bound and unclosed helicase was run off the adaptor using 0.25-volume equivalent of a salt-ATP stress buffer (55 μl) comprising 5 mM ATP, 10 mM MgCl2, 2.5 M NaCl, 100 mM Tris (pH 8.0) (final volume, 275 μl), for 25 min at room temperature. The complex was subjected to SPRI purification by addition of 3.7-volume equivalents of SPRI beads in 25 mM Tris-Cl (pH 7.5 at 21° C.), 28% (w/v) PEG-8000, 2.5 M NaCl for 5 min at room temperature. The beads were pelleted on a magnetic rack and the supernatant removed. While still on the magnetic rack the beads were washed with 500 ul of 50 mM Tris (pH 7.5 at 21° C.), 2.5 M NaCl, 20% PEG (w/v) 8.000, turning through 360° to bathe the pellet on the rack. The wash buffer was removed and the pellet pulsed briefly in a centrifuge before returning to the magnetic rack to remove the last remnants of solution. The pellet was then resuspended in 30 ul of 25 mM Tris-Cl (pH 7.5 at 21° C.), 20 mM NaCl for 5 mins at room temperature before being placed on a magnetic rack to recover the purified adapter which was known as “helicase-Y-adaptor hyb”.


A 3.6-kilobase test analyte was amplified by PCR using specific primers directed against lambda phage genomic DNA, resulting in a double-stranded DNA analyte bearing blunt ends. This analyte was known as “blunt lambda 3.6 kb”.


CRISPR RNAs (“crRNAs”) bearing 3′ extensions that allow hybridisation to either “cholesterol hyb” or “helicase-Y-adaptor hyb” were hybridised with tracrRNA by annealing 40 μM “Alt-R™” tracrRNA (purchased from IDT) with each crRNA separately in 10 mM Tris-Cl (pH 8.0), 1 mM EDTA, 100 mM NaCl from 65° C. to 25° C. at 1.0° C. per minute, resulting in complex known as a “guide RNA”. CRISPR-dCas9 complexes were formed by incubating 100 nM “guide RNA” with 100 nM dCas9 (ONLP11836) in Cas9 binding buffer (20 mM HEPES-NaOH, 100 mM NaCl, 5 mM MgCl2, 0.1 mM EDTA, pH 6.5 at 25° C.), for 10 minutes at 21° C., yielding 100 nM of CRISPR-dCas9 complex. These complexes, with bound dCas9, were known as “anchor probes” or “helicase probes”, according to whether “cholesterol hyb” or “helicase-Y-adaptor hyb” can anneal to the crRNA 3′ extension, respectively.


In this example, the “anchor probes” comprised oligonucleotide AR145 or AR138 or AR141 or AR142, hybridised separately to tracrRNA, with bound dCas9, at a molecular concentration of 100 nM of each named species.


In this Example, the “helicase probes” comprised 100 nM oligonucleotides AR133 or AR134 or AR135, hybridised separately to tracrRNA, with bound dCas9, at a molecular concentration of 100 nM of each named species.


The “anchor probes” and “helicase probes” were pooled together in the following combinations, to a total of 20 μl, according to the table below:














“Probe

“Helicase


combination”
“Anchor probes”
probes”







A
AR145
AR133


B
None (control)
AR133


C
AR145
None (control)


D
AR138, AR141, AR142
AR134, AR135


E
None (control)
None (control)









These mixtures were known as “probe combinations”.


To 20 μl of “probe combinations” (100 nM molecules) was added 1.1 μl of target DNA (“blunt 3.6 kb, ONLA17510”) to a final concentration of 10 nM molecules of ONLA17510, resulting in a complex known as “probe-target complex”. 21.1 μL of “probe-target complex” was diluted to a final volume of 100 μL in a mixture of “helicase-Y-adaptor hyb”, “cholesterol hyb”, HEPES-KOH, KCl, MgCl2 and rATP, resulting in final concentrations of 25 mM HEPES-KOH, 500 mM KCl, 10 mM MgCl2, 10 mM rATP, 30 nM “helicase-Y-adaptor hyb”, 100 nM “cholesterol hyb”, 10 nM “CRISPR-dCas9 complex”, pH 8.0, known as “MinION reaction mix”. The “MinION reaction mix” was incubated for 10 min at ambient temperature before subjecting the mixture to nanopore analysis, as follows: Electrical measurements were acquired from single CsgG nanopores inserted in block co-polymer in buffer at 37° C. (25 mM HEPES-KOH, 150 mM potassium ferrocyanide (11), 150 mM potassium ferricyanide (III), pH 8.0). After achieving a single pore inserted in the block co-polymer, buffer (2 mL, 25 mM HEPES-KOH, 150 mM potassium ferrocyanide (II), 150 mM potassium ferricyanide (111). pH 8.0) was flowed through the system to remove any excess CsgG nanopores. All subsequent steps were performed at 34° C. The cis compartment was equilibrated with 500 μl of 25 mM HEPES-KOH (pH 8.0), 500 mM KCl, 10 mM MgCl2 and 10 mM rATP (known as “wash buffer”), with 10 mins between each wash. 75 μl of “MinION reaction mix”, pre-incubated for 10 min at 21° C., was applied to the flow-cell and incubated for 10 min to allow any probe-dCas9 complexes contacting target DNA to attach to the block co-polymer. After a further 10 min, a further 2 mL of “wash buffer” was perfused through the flow-cell to remove any non-specific target DNA, including any dCas9-bound CRISPR probes and “helicase-Y-adaptor hybs” not contacting the target. The experiment was run at 180 mV and helicase-controlled DNA movement monitored. The electrical signals resulting from the translocation of DNA strands were analysed by counting the frequency of nanopore of the helicase-Y-adaptor hyb, identified by its distinctive electrical current signal.


Results

The helicase was used to control the movement of Cas-contacted pre-sequencing mix, tethered to tri-block copolymer via “cholesterol hyb”, through an CsgG nanopore. FIG. 8 shows a target DNA molecule bearing two CRISPR-dCas9 probes bound to their cognate sites in the target DNA. FIG. 23 shows the electrical signal resulting from helicase-controlled translocation of the analyte through the nanopore. The example signals show that both the “anchor probes” and the “helicase probes” contacted the target DNA. The data demonstrate that immobilisation of the target polynucleotide via a tethered CRISPR-dCas9 complex successfully identified the target DNA polynucleotide.


Example 2

This Example describes a method for direct enrichment and sequencing of a fragment containing a specific 20 nt target DNA polynucleotide sequence (“target”) from a mixture by nanopore sequencing, wherein the target DNA contacts a cholesterol-tagged CRISPR-Cas probe and movement of DNA through the nanopore is controlled by a DNA motor protein.


In this example, the “target” is positively identified directly by its sequence. The bound CRISPR-Cas probe may temporarily stall the translocation of the helicase and may thus also be used to additionally positively identify the sample.


Materials and Methods

Oligonucleotides AR131 and AR132 were annealed, each at 40 μM, in 10 mM Tris-Cl (pH 8.0), 1 mM EDTA, 100 mM NaCl, from 95° C. to 25° C. at 0.6° C. per minute. The hybridised DNA was known as “cholesterol hyb” (ONLA17351).


CRISPR RNAs (“crRNAs”) bearing 3′ extensions that allow hybridisation to a “cholesterol hyb” were hybridised with tracrRNA by annealing 40 μM “Alt-R™” tracrRNA (purchased from IDT) with oligonucleotide AR139 in 10 mM Tris-Cl (pH 8.0), 1 mM EDTA, 100 mM NaCl from 65° C. to 25° C. at 1.0° C. per minute, resulting in a complex known as a “guide RNA”. CRISPR-dCas9 complexes were formed by incubating 100 nM “guide RNA” with 100 nM dCas9 (ONLP11836) in Cas9 binding buffer (20 mM HEPES-NaOH, 100 mM NaCl, 5 mM MgCl2, 0.1 mM EDTA, pH 6.5 at 25° C.), for 10 minutes at 21° C., yielding 100 nM of CRISPR-dCas9 complex. These complexes, with bound dCas9, were known as “anchor probes” because “cholesterol hyb” could anneal to the crRNA 3′ extension. Enterobacteria lambda phage genomic DNA was fragmented to an average size of approximately 1 kb using a gTube (Covaris, Inc.). The fragmented DNA was end-repaired and dA-tailed using an NEBNext End-Repair/dA-tailing Module (NEB). Standard SK007 adapter was ligated to end-repaired, fragmented lambda phage DNA purified using SPRI beads. To the resultant library (25 μl; 1 μg total DNA) was added 275 nM (molecules) of ONLA16941 at room temperature for >5 minutes to block the leader against non-specific hybridisation of “cholesterol hyb”. The resultant DNA library, bearing end-ligated, loaded helicase on both DNA ends, was known as “pre-sequencing mix”.


To 12 μl pre-sequencing mix was added 33 μl “anchor probe”, yielding a mixture containing 73 nM “anchor probe” and approx. 0.32 nM target sites. The binding was allowed to proceed for 10 min at 21° C., after which the mixture was subjected to purification step using SPRI magnetic beads, as follows: 0.4 volume equivalents of AMPure XP SPRI magnetic beads (Beckman Coulter) were added to the mixture and the resultant mixture agitated for 5 min at 21° C. The magnetic beads were pelleted using a magnetic separator, the supernatant aspirated, and 100 μl of 50 mM Tris-Cl, 2.5 M NaCl, 20% PEG 8.000 (pH 7.5 at 25° C.) added to the beads while still on the rack, turning the pellet through 360° to wash the pellet on the rack. The beads were immediately pelleted once more and the supernatant aspirated, after which the tube was removed from the rack and 45 μl of a buffer containing of 25 mM Tris-Cl, 20 mM NaCl (pH 7.5 at 25° C.) added to the beads to elute the DNA by incubation for 5 min at 21° C. The beads were pelleted using the magnetic separator, and the eluate retained (known as “probe-target complex”).


45 μL of “probe-target complex” was diluted to a final volume of 330 IL in a mixture of ONLA17351, HEPES-KOH, KCl, MgCl2 and rATP, resulting in final concentrations of 25 mM HEPES-KOH, 500 mM KCl, 10 mM MgCl2, 10 mM rATP, 10 nM ONLA17351, 10 nM “CRISPR-dCas9 complex” and approx. 44 μM target sites, pH 8.0, known as “MinION reaction mix”.


Electrical measurements were acquired from single CsgG nanopores inserted in block co-polymer in buffer at 37° C. (25 mM HEPES-KOH, 150 mM potassium ferrocyanide (II). 150 mM potassium ferricyanide (III), pH 8.0). After achieving a single pore inserted in the block co-polymer, buffer (2 mL, 25 mM HEPES-KOH, 150 mM potassium ferrocyanide (II), 150 mM potassium ferricyanide (III), pH 8.0) was flowed through the system to remove any excess CsgG nanopores. All subsequent steps were performed at 34° C. The cis compartment was equilibrated with 500 μl of 25 mM HEPES-KOH (pH 8.0), 500 mM KCl, 10 mM MgCl2 and 10 mM rATP (known as “wash buffer”), with 10 mins between each wash. 150 μl of “MinION reaction mix”, pre-incubated for 10 min at 21° C., was applied to the flow-cell and incubated for 10 min to allow any cholesterol:CRISPR probe:dCas9 complexes contacting target DNA to attach to the block co-polymer. After a further 10 min, a further 2 mL of “wash buffer” was perfused through the flow-cell to remove any non-specific target DNA. The experiment was run at 180 mV and helicase-controlled DNA movement monitored. The electrical signals resulting from the translocation of DNA strands were analysed and their nucleotide sequences determined.


Results

The helicase was used to control the movement of Cas-contacted pre-sequencing mix, tethered to tri-block copolymer via “cholesterol hyb”, through an CsgG nanopore. FIG. 9 shows a target DNA molecule bearing an end-loaded helicase, CRISPR-dCas9 bound to its cognate site and the cholesterol tether. FIG. 15 shows the path of the helicase and how its translocation might be transiently stalled upon encounter of the bound CRISPR-dCas9 complex. FIG. 22 shows the electrical signal resulting from helicase-controlled translocation of target DNA (in this case, a 3.6-kilobase fragment of lambda DNA) through the nanopore and one such transient stalling event, mid-way through the translocation event. The example signal shows that dCas9 contacted the target DNA, and that the helicase contacted the dCas9. The data demonstrate that immobilisation of the target polynucleotide via a tethered CRISPR-dCas9 complex successfully enriched (see FIG. 21) and sequenced the target DNA polynucleotide in preference to the other non-specific fragments.


Example 3

This Example describes a method for direct enrichment and sequencing of a fragment containing a specific 20 nt target DNA polynucleotide sequence (“target”) from a mixture of DNA polynucleotides (“DNA”) by nanopore sequencing, wherein the target DNA contacts a cholesterol-tagged CRISPR-Cas probe. In this Example, the mixture of oligonucleotides bear an polynucleotide binding protein loaded on a Y-adaptor at each end of the mixture of DNA. In this example, Y-adaptor does not contain a stall site, but is anchored to a membrane surface via a tether oligonucleotide containing a cholesterol moiety hybridised to the Y-adaptor. The motor protein fully unwinds any DNA in the mixture that does not contain a bound CRISPR-Cas complex, thereby releasing non-target DNA from the membrane. Additionally, an exonuclease, such as E. coli Exonuclease I, may be used to degrade the non-translocated strand of the target concomitantly with DNA motor translocation, as well as any non-target DNA in the sample that is fully unwound. The polynucleotide binding protein partially unwinds any DNA that contains a bound CRISPR-Cas complex, but stalls upon encounter of the CRISPR-Cas complex independent of the nanopore. Upon capture of the target by the nanopore, the CRISPR-Cas complex is dislodged from the target by the applied potential, thereby resuming the translocation of the polynucleotide binding protein on the target. The sequence of the analyte and the position of the stall may be used to positively identify the sample.


Methods

Oligonucleotides AR131 and AR132 were annealed, each at 40 μM, in 10 mM Tris-Cl (pH 8.0), 1 mM EDTA, 100 mM NaCl, from 95° C. to 25° C. at 0.6° C. per minute. The hybridised DNA was known as “cholesterol hyb” (ONLA17351).


CRISPR RNAs (“crRNAs”) bearing 3′ extensions that allow hybridisation to a “cholesterol hyb” were hybridised with tracrRNA by annealing 40 μM “Alt-R™” tracrRNA (purchased from IDT) with oligonucleotide AR145 in 10 mM Tris-Cl (pH 8.0), 1 mM EDTA, 100 mM NaCl from 65° C. to 25° C. at 1.0° C. per minute, resulting in a complex known as a “guide RNA”. CRISPR-dCas9 complexes were formed by incubating 100 nM “guide RNA” with 100 nM dCas9 (ONLP11836) in Cas9 binding buffer (20 mM HEPES-NaOH, 100 mM NaCl, 5 mM MgCl2, 0.1 mM EDTA, pH 6.5 at 25° C.), for 10 minutes at 21° C., yielding 100 nM of CRISPR-dCas9 complex. These complexes, with bound dCas9, were known as “anchor probes” because “cholesterol hyb” could anneal to the crRNA 3′ extension.


Approx. 20 nM of Y-adapter ONLA17917, bearing the helicase, was ligated to 1 μg of end-repaired, dA-tailed 3.6 kb DNA CS (ONLA17510) using 20,000 units of NEB Quick T4 DNA ligase in 66 mM Tris-Cl (pH 8.0), 10 mM MgCl2, 2 mM ATPγS, 4.5% (w/v) PEG-8W0 in a volume of 100 pd at ambient temperature for 10 min. The ligated DNA was purified by SPRI purification as detailed in Example 2, except the DNA was eluted in 24 μl of 20 mM CAPS, 40 mM KCl (pH 10). To this DNA was added 10 nM (molecules) of “anchor probes”, and the sample incubated for 10 min at ambient temperature to allow the anchor probes to contact the target. To this DNA was added 10 nM (molecules) of SK43, an oligonucleotide bearing a cholesterol moiety that can hybridise to the Y-adaptor. This yielded a 3.6-kilobase target double-stranded DNA bearing an polynucleotide binding protein loaded Y-adaptor on each end, known as “MinION sequencing mix”.


Pre-sequencing mix was diluted to a volume of 150 g1 for analysis resulting in a mixture containing: 25 mM HEPES-KOI-1 (pH 8.0), 500 mM KCl, 10 nM cholesterol hyb (ONLA 17351), and approx. 250 ng of MinION sequencing mix.


Electrical measurements were acquired from single CsgG nanopores inserted in block co-polymer in buffer at 37° C. (25 mM HEPES-KOH, 150 mM potassium ferrocyanide (II), 150 mM potassium ferricyanide (111), pH 8.0). After achieving a single pore inserted in the block co-polymer, buffer (2 mL, 25 mM HEPES-KOH, 150 mM potassium ferrocyanide (II), 150 mM potassium ferricyanide (11T), pH 8.0) was flowed through the system to remove any excess CsgG nanopores. All subsequent steps were performed at 34° C. The cis compartment was equilibrated twice with 500 μl of 25 mM HEPES-KOH (pH 8.0), 500 mM KCl (known as “fuel-less wash buffer”), with 10 mins between each wash. 150 μl of “MinION reaction mix”, pre-incubated for 10 min at 21° C., was applied to the flow-cell and incubated for 10 min to allow any cholesterol:CRISPR probe:dCas9 complexes contacting target DNA to attach to the block co-polymer. After a further 10 min, a further 2 mL of “fuel-less wash buffer” was perfused through the flow-cell to remove any unbound target DNA. The experiment was run at 180 mV and nanopore currents monitored for approx. 800 s, after which the flow-cell was perfused with 2 mL of 25 mM HEPES-KOH (pH 8.0), 500 mM KCl, 10 mM ATP, 0.1 mM MgCl2. The electrical signals resulting from the translocation of DNA strands were analysed and their nucleotide sequences determined.


Results

The helicase was ligated on both ends of the target in the presence of non-hydrolysable ATP analogue ATPγS, and used to unwind any target DNA that did not contain a bound CRISPR-dCas9, or which preceded the CRISPR-dCas9 stall, independent of a nanopore. CRISPR-dCas9 and ligated Y-adaptor were tethered to tri-block copolymer via “cholesterol hyb” and via an oligonucleotide hybridized to both ends of the target. FIG. 28 shows the immobilization of the target to a membrane surface. The target bears a bound CRISPR-dCas9 probe, and, in the absence of MgATP, the helicase is located at the ends of the target DNA. FIG. 29 shows the translocation and stalling of both helicases towards the bound CRISPR-dCas9 complex upon the addition of MgATP. The stalling may be accomplished by one or both helicases. FIG. 30 shows the capture of the target analyte by a nanopore upon application of potential. FIG. 31 shows dislodgement of the bound CRISPR-dCas9 complex by the helicase upon capture of the target by a nanopore. FIG. 32 shows an example trace, ˜2350 secs after the addition of MgATP, comprising an initial, pre-dCas9 translocation event (B), stalling (C), and resumption of translocation (D). The resumption from the stall is highlighted and expanded (E).


Sequences
Oligonucleotides

tracrRNA


The tracrRNA used throughout was a 67mer purchased from IDT (“Alt-R™” tracrRNA; catalogue #1072534)












Custom oligonucleotides used in this filing:








INTERNAL



REFERENCE
SEQUENCE (5’-3’)





AR130
/5Phos/CAGACGCCGCAATATCAGCACCAACAGAAA/iBNA-



meC//iBNA-A//iBNA-A//iBNA-meC//iBNA-meC/TTT





ONLA11326
333333333333333333333333333333TTTTTTTTTTTT/iSp18//



iSp18//iSp18//iSp18/GGTTGTTTCTGTTGGTGCTGATATTGCGGC




GTCTGCTTGGGTGTTTAACCT






AR131
/5Phos/TGTTCTGATCGGAACGATCG/iSp18//iSp18//iSp18//3



CholTEG/





AR132
/5PhoS/CGATCGTTCCGATCAGAACACAAAGATGTATTGCT





AR133
/5Phos/rCrUrUrCrGrCrGrGrCrArGrArUrArUrArArUrGrGrGr



UrUrUrUrArGrArGrCrUrArUrGrCrUAGGTTAAACACCCAAG





AR134
/5Phos/rCrCrGrArCrCrArCrGrCrCrArGrCrArUrArUrCrGrGr



UrUrUrUrArGrArGrCrUrArUrGrCrUAGGTTAAACACCCAAG





AR135
/5Phos/rUrGrCrArArCrGrGrUrCrGrArUrUrGrCrCrUrGrArGr



UrUrUrUrArGrArGrCrUrArUrGrCrUAGGTTAAACACCCAAG





AR136
/5Phos/rGrGrUrGrArArArUrArArUrCrCrCrGrUrUrCrArGrGr



UrUrUrUrArGrArGrCrUrArUrGrCrUAGGTTAAACACCCAAG





AR137
/5Phos/rCrCrGrGrArCrGrUrUrArUrGrArUrUrUrArGrCrGrGr



UrUrUrUrArGrArGrCrUrArUrGrCrUAGGTTAAACACCCAAG





AR138
/5Phos/rCrUrUrCrGrCrGrGrCrArGrArUrArUrArArUrGrGrGr



UrUrUrUrArGrArGrCrUrArUrGrCrUAGCAATACATCTTTG





AR139
/5Phos/rCrCrGrArCrCrArCrGrCrCrArGrCrArUrArUrCrGrGr



UrUrUrUrArGrArGrCrUrArUrGrCrUAGCAATACATCTTTG





AR140
/5Phos/rUrGrCrArArCrGrGrUrCrGrArUrUrGrCrCrUrGrArGr



UrUrUrUrArGrArGrCrUrArUrGrCrUAGCAATACATCTTTG





AR141
/5Phos/rGrGrUrGrArArArUrArArUrCrCrCrGrUrUrCrArGrGr



UrUrUrUrArGrArGrCrUrArUrGrCrUAGCAATACATCTTTG





AR142
/5Phos/rCrCrGrGrArCrGrUrUrArUrGrArUrUrUrArGrCrGrGr



UrUrUrUrArGrArGrCrUrArUrGrCrUAGCAATACATCTTTG





AR143
/5Phos/rGrGrUrArCrGrCrCrArUrUrGrCrArArArCrGrCrArGr



UrUrUrUrArGrArGrCrUrArUrGrCrUAGCAATACATCTTTG





AR144
/5Phos/rArCrGrArArUrGrArArCrUrArGrGrCrGrArUrArArGr



UrUrUrUrArGrArGrCrUrArUrGrCrUAGCAATACATCTTTG





AR145
/5Phos/rArArArArArArGrCrCrGrGrArGrUrArGrArArGrArGr



UrUrUrUrArGrArGrCrUrArUrGrCrUAGCAATACATCTTTG





AR146
/5Phos/rGrArCrGrUrCrArUrArArCrCrArUrGrArUrUrUrCrGr



UrUrUrUrArGrArGrCrUrArUrGrCrUAGCAATACATCTTTG





ONLA16941
TTGACCGCTCGCCTC





/5Phos/ = 5’ phosphate moiety; /iBNA-meC/ = branched nucleic acid methyl cytosine base; /iBNA-A/ = branched nucleic acid adenosine base; /3CholTEG/ = 3’ cholesterol moiety, linked via triethylene glycol; r = ribonucleotide base (RNA); 3 = C3 spacer; iSp18 = internal Spl8 spacer














DNA SAMPLE LIBRARIES: SEQUENCES AND PREPARATION



•3.6 kb derivative of enterobacteria phage lambda (″lambda 3.6 kb″)


>lambda_3.6kb


GCCATCAGATTGTGTTTGTTAGTCGCTGCCATCAGATTGTGTTTGTTAGTCGCTTTTTTTTTTTGGAATTTTTTTTTTGGAATTTTTTTTTTGCGCT





AACAACCTCCTGCCGTTTTGCCCGTGCATATCGGTCACGAACAAATCTGATTACTAAACACAGTAGCCTGGATTTGTTCTATCAGTAATCGACCTTA





TTCCTAATTAAATAGAGCAAATCCCCTTATTGGGGGTAAGACATGAAGATGCCAGAAAAACATGACCTGTTGGCCGCCATTCTCGCGGCAAAGGAAC





AAGGCATCGGGGCAATCCTTGCGTTTGCAATGGCGTACCTTCGCGGCAGATATAATGGCGGTGCGTTTACAAAAACAGTAATCGACGCAACGATGTG





CGCCATTATCGCCTAGTTCATTCGTGACCTTCTCGACTTCGCCGGACTAAGTAGCAATCTCGCTTATATAACGAGCGTGTTTATCGGCTACATCGGT





ACTGACTCGATTGGTTCGCTTATCAAACGCTTCGCTGCTAAAAAAGCCGGAGTAGAAGATGGTAGAAATCAATAATCAACGTAAGGCGTTCCTCGAT





ATGCTGGCGTGGTCGGAGGGAACTGATAACGGACGTCAGAAAACCAGAAATCATGGTTATGACGTCATTGTAGGCGGAGAGCTATTTACTGATTACT





CCGATCACCCTCGCAAACTTGTCACGCTAAACCCAAAACTCAAATCAACAGGCGCCGGACGCTACCAGCTTCTTTCCCGTTGGTGGGATGCCTACCG





CAAGCAGCTTGGCCTGAAAGACTTCTCTCCGAAAAGTCAGGACGCTGTGGCATTGCAGCAGATTAAGGAGCGTGGCGCTTTACCTATGATTGATCGT





GGTGATATCCGTCAGGCAATCGACCGTTGCAGCAATATCTGGGCTTCACTGCCGGGCGCTGGTTATGGTCAGTTCGAGCATAAGGCTGACAGCCTGA





TTGCAAAATTCAAAGAAGCGGGCGGAACGGTCAGAGAGATTGATGTATGAGCAGAGTCACCGCGATTATCTCCGCTCTGGTTATCTGCATCATCGTC





TGCCTGTCATGGGCTGTTAATCATTACCGTGATAACGCCATTACCTACAAAGCCCAGCGCGACAAAAATGCCAGAGAACTGAAGCTGGCGAACGCGG





CAATTACTGACATGCAGATGCGTCAGCGTGATGTTGCTGCGCTCGATGCAAAATACACGAAGGAGTTAGCTGATGCTAAAGCTGAAAATGATGCTCT





GCGTGATGATGTTGCCGCTGGTCGTCGTCGGTTGCACATCAAAGCAGTCTGTCAGTCAGTGCGTGAAGCCACCACCGCCTCCGGCGTGGATAATGCA





GCCTCCCCCCGACTGGCAGACACCGCTGAACGGGATTATTTCACCCTCAGAGAGAGGCTGATCACTATGCAAAAACAACTGGAAGGAACCCAGAAGT





ATATTAATGAGCAGTGCAGATAGAGTTGCCCATATCGATGGGCAACTCATGCAATTATTGTGAGCAATACACACGCGCTTCCAGCGGAGTATAAATG





CCTAAAGTAATAAAACCGAGCAATCCATTTACGAATGTTTGCTGGGTTTCTGTTTTAACAACATTTTCTGCGCCGCCACAAATTTTGGCTGCATCGA





CAGTTTTCTTCTGCCCAATTCCAGAAACGAAGAAATGATGGGTGATGGTTTCCTTTGGTGCTACTGCTGCCGGTTTGTTTTGAACAGTAAACGTCTG





TTGAGCACATCCTGTAATAAGCAGGGCCAGCGCAGTAGCGAGTAGCATTTTTTTCATGGTGTTATTCCCGATGCTTTTTGAAGTTCGCAGAATCGTA





TGTGTAGAAAATTAAACAAACCCTAAACAATGAGTTGAAATTTCATATTGTTAATATTTATTAATGTATGTCAGGTGCGATGAATCGTCATTGTATT





CCCGGATTAACTATGTCCACAGCCCTGACGGGGAACTTCTCTGCGGGAGTGTCCGGGAATAATTAAAACGATGCACACAGGGTTTAGCGCGTACACG





TATTGCATTATGCCAACGCCCCGGTGCTGACACGGAAGAAACCGGACGTTATGATTTAGCGTGGAAAGATTTGTGTAGTGTTCTGAATGCTCTCAGT





AAATAGTAATGAATTATCAAAGGTATAGTAATATCTTTTATGTTCATGGATATTTGTAACCCATCGGAAAACTCCTGCTTTAGCAAGATTTTCCCTG





TATTGCTGAAATGTGATTTCTCTTGATTTCAACCTATCATAGGACGTTTCTATAAGATGCGTGTTTCTTGAGAATTTAACATTTACAACCTTTTTAA





GTCCTTTTATTAACACGGTGTTATCGTTTTCTAACACGATGTGAATATTATCTGTGGCTAGATAGTAAATATAATGTGAGACGTTGTGACGTTTTAG





TTCAGAATAAAACAATTCACAGTCTAAATCTTTTCGCACTTGATCGAATATTTCTTTAAAAATGGCAACCTGAGCCATTGGTAAAACCTTCCATGTG





ATACGAGGGCGCGTAGTTTGCATTATCGTTTTTATCGTTTCAATCTGGTCTGACCTCCTTGTGTTTTGTTGATGATTTATGTCAAATATTAGGAATG





TTTTCACTTAATAGTATTGGTTGCGTAACAAAGTGCGGTCCTGCTGGCATTCTGGAGGGAAATACAACCGACAGATGTATGTAAGGCCAACGTGCTC





AAATCTTCATACAGAAAGATTTGAAGTAATATTTTAACCGCTAGATGAAGAGCAAGCGCATGGAGCGACAAAATGAATAAAGAACAATCTGCTGATG





ATCCCTCCGTGGATCTGATTCGTGTAAAAAATATGCTTAATAGCACCATTTCTATGAGTTACCCTGATGTTGTAATTGCATGTATAGAACATAAGGT





GTCTCTGGAAGCATTCAGAGCAATTGAGGCAGCGTTGGTGAAGCACGATAATAATATGAAGGATTATTCCCTGGTGGTTGACTGATCACCATAACTG





CTAATCATTCAAACTATTTAGTCTGTGACAGAGCCAACACGCAGTCTGTCACTGTCAGGAAAGTGGTAAAACTGCAACTCAATTACTGCAATGCCCT





CGTAATTAAGTGAATTTACAATATCGTCCTGTTCGGAGGGAAGAACGCGGGATGTTCATTCTTCATCACTTTTAATTGATGTATATGCTCTCTTTTC





TGACGTTAGTCTCCGACGGCAGGCTTCAATGACCCAGGCTGAGAAATTCCCGGACCCTTTTTGCTCAAGAGCGATGTTAATTTGTTCAATCATTTGG





TTAGGAAAGCGGATGTTGCGGGTTGTTGTTCTGCGGGTTCTGTTCTTCGTTGACATGAGGTTGCCCCGTATTCAGTGTCGCTGATTTGTATTGTCTG





AAGTTGTTTTTACGTTAAGTTGATGCAGATCAATTAATACGATACCTGCGTCATAATTGATTATTTGACGTGGTTTGATGGCCTCCACGCACGTTGT





GATATGTAGATGATAATCATTATCACTTTACGGGTCCTTTCCGGTGAAAAAAAAGGTACCAAAAAAAACATCGTCGTGAGTAGTGAACCGTAAGC


•Enterobacteria phage lambda genome: GenBank accession ID J02459.1


•Seven-fragment derivative of bacteriophage lambda, ONLA15339






Bacteriophage lambda DNA (GenBank accession ID J02459.1; obtained from NEB) was digested with SnaBI and BanmHI-HF (NEB), and end-repaired and dA-tailed using an NEBNext Ultra End Repair/dA-Tailing Module (NEB). Helicase loaded adapters were ligated to dA-tailed DNA using NEB Blunt/TA Ligase Master Mix.









Fragment 1 (positions 1-5505 of phage lambda)


GGGCGGCGAC CTCGCGGGTT TTCGCTATTT





ATGAAAATTT TCCGGTTTAA





GGCGTTTCCG TTCTTCTTCG TCATAACTTA





ATGTTTTTAT TTAAAATACC





CTCTGAAAAG AAAGGAAACG ACAGGTGCTG





AAAGCGAGGC TTTTTGGCCT





CTGTCGTTTC CTTTCTCTGT TTTTGTCCGT





GGAATGAACA ATGGAAGTCA





ACAAAAAGCA GCTGGCTGAC ATTTTCGGTG





CGAGTATCCG TACCATTCAG





AACTGGCAGG AACAGGGAAT GCCCGTTCTG





CGAGGCGGTG GCAAGGGTAA





TGAGGTGCTT TATGACTCTG CCGCCGTCAT





AAAATGGTAT GCCGAAAGGG





ATGCTGAAAT TGAGAACGAA AAGCTGCGCC





GGGAGGTTGA AGAACTGCGG





CAGGCCAGCG AGGCAGATCT CCAGCCAGGA





ACTATTGAGT ACGAACGCCA





TCGACTTACG CGTGCGCAGG CCGACGCACA





GGAACTGAAG AATGCCAGAG





ACTCCGCTGA AGTGGTGGAA ACCGCATTCT





GTACTTTCGT GCTGTCGCGG





ATCGCAGGTG AAATTGCCAG TATTCTCGAC





GGGCTCCCCC TGTCGGTGCA





GCGGCGTTTT CCGGAACTGG AAAACCGACA





TGTTGATTTC CTGAAACGGG





ATATCATCAA AGCCATGAAC AAAGCAGCCG





CGCTGGATGA ACTGATACCG





GGGTTGCTGA GTGAATATAT CGAACAGTCA





GGTTAACAGG CTGCGGCATT





TTGTCCGCGC CGGGCTTCGC TCACTGTTCA





GGCCGGAGCC ACAGACCGCC





GTTGAATGGG CGGATGCTAA TTACTATCTC





CCGAAAGAAT CCGCATACCA





GGAAGGGCGC TGGGAAACAC TGCCCTTTCA





GCGGGCCATC ATGAATGCGA





TGGGCAGCGA CTACATCCGT GAGGTGAATG





TGGTGAAGTC TGCCCGTGTC





GGTTATTCCA AAATGCTGCT GGGTGTTTAT





GCCTACTTTA TAGAGCATAA





GCAGCGCAAC ACCCTTATCT GGTTGCCGAC





GGATGGTGAT GCCGAGAACT





TTATGAAAAC CCACGTTGAG CCGACTATTC





GTGATATTCC GTCGCTGCTG





GCGCTGGCCC CGTGGTATGG CAAAAAGCAC





CGGGATAACA CGCTCACCAT





GAAGCGTTTC ACTAATGGGC GTGGCTTCTG





GTGCCTGGGC GGTAAAGCGG





CAAAAAACTA CCGTGAAAAG TCGGTGGATG





TGGCGGGTTA TGATGAACTT





GCTGCTTTTG ATGATGATAT TGAACAGGAA





GGCTCTCCGA CGTTCCTGGG





TGACAAGCGT ATTGAAGGCT CGGTCTGGCC





AAAGTCCATC CGTGGCTCCA





CGCCAAAAGT GAGAGGCACC TGTCAGATTG





AGCGTGCAGC CAGTGAATCC





CCGCATTTTA TGCGTTTTCA TGTTGCCTGC





CCGCATTGCG GGGAGGAGCA





GTATCTTAAA TTTGGCGACA AAGAGACGCC





GTTTGGCCTC AAATGGACGC





CGGATGACCC CTCCAGCGTG TTTTATCTCT





GCGAGCATAA TGCCTGCGTC





ATCCGCCAGC AGGAGCTGGA CTTTACTGAT





GCCCGTTATA TCTGCGAAAA





GACCGGGATC TGGACCCGTG ATGGCATTCT





CTGGTTTTCG TCATCCGGTG





AAGAGATTGA GCCACCTGAC AGTGTGACCT





TTCACATCTG GACAGCGTAC





AGCCCGTTCA CCACCTGGGT GCAGATTGTC





AAAGACTGGA TGAAAACGAA





AGGGGATACG GGAAAACGTA AAACCTTCGT





AAACACCACG CTCGGTGAGA





CGTGGGAGGC GAAAATTGGC GAACGTCCGG





ATGCTGAAGT GATGGCAGAG





CGGAAAGAGC ATTATTCAGC GCCCGTTCCT





GACCGTGTGG CTTACCTGAC





CGCCGGTATC GACTCCCAGC TGGACCGCTA





CGAAATGCGC GTATGGGGAT





GGGGGCCGGG TGAGGAAAGC TGGCTGATTG





ACCGGCAGAT TATTATGGGC





CGCCACGACG ATGAACAGAC GCTGCTGCGT





GTGGATGAGG CCATCAATAA





AACCTATACC CGCCGGAATG GTGCAGAAAT





GTCGATATCC CGTATCTGCT





GGGATACTGG CGGGATTGAC CCGACCATTG





TGTATGAACG CTCGAAAAAA





CATGGGCTGT TCCGGGTGAT CCCCATTAAA





GGGGCATCCG TCTACGGAAA





GCCGGTGGCC AGCATGCCAC GTAAGCGAAA





CAAAAACGGG GTTTACCTTA





CCGAAATCGG TACGGATACC GCGAAAGAGC





AGATTTATAA CCGCTTCACA





CTGACGCCGG AAGGGGATGA ACCGCTTCCC





GGTGCCGTTC ACTTCCCGAA





TAACCCGGAT ATTTTTGATC TGACCGAAGC





GCAGCAGCTG ACTGCTGAAG





AGCAGGTCGA AAAATGGGTG GATGGCAGGA





AAAAAATACT GTGGGACAGC





AAAAAGCGAC GCAATGAGGC ACTCGACTGC





TTCGTTTATG CGCTGGCGGC





GCTGCGCATC AGTATTTCCC GCTGGCAGCT





GGATCTCAGT GCGCTGCTGG





CGAGCCTGCA GGAAGAGGAT GGTGCAGCAA





CCAACAAGAA AACACTGGCA





GATTACGCCC GTGCCTTATC CGGAGAGGAT





GAATGACGCG ACAGGAAGAA





CTTGCCGCTG CCCGTGCGGC ACTGCATGAC





CTGATGACAG GTAAACGGGT





GGCAACAGTA CAGAAAGACG GACGAAGGGT





GGAGTTTACG GCCACTTCCG





TGTCTGACCT GAAAAAATAT ATTGCAGAGC





TGGAAGTGCA GACCGGCATG





ACACAGCGAC GCAGGGGACC TGCAGGATTT





TATGTATGAA AACGCCCACC





ATTCCCACCC TTCTGGGGCC GGACGGCATG





ACATCGCTGC GCGAATATGC





CGGTTATCAC GGCGGTGGCA GCGGATTTGG





AGGGCAGTTG CGGTCGTGGA





ACCCACCGAG TGAAAGTGTG GATGCAGCCC





TGTTGCCCAA CTTTACCCGT





GGCAATGCCC GCGCAGACGA TCTGGTACGC





AATAACGGCT ATGCCGCCAA





CGCCATCCAG CTGCATCAGG ATCATATCGT





CGGGTCTTTT TTCCGGCTCA





GTCATCGCCC AAGCTGGCGC TATCTGGGCA





TCGGGGAGGA AGAAGCCCGT





GCCTTTTCCC GCGAGGTTGA AGCGGCATGG





AAAGAGTTTG CCGAGGATGA





CTGCTGCTGC ATTGACGTTG AGCGAAAACG





CACGTTTACC ATGATGATTC





GGGAAGGTGT GGCCATGCAC GCCTTTAACG





GTGAACTGTT CGTTCAGGCC





ACCTGGGATA CCAGTTCGTC GCGGCTTTTC





CGGACACAGT TCCGGATGGT





CAGCCCGAAG CGCATCAGCA ACCCGAACAA





TACCGGCGAC AGCCGGAACT





GCCGTGCCGG TGTGCAGATT AATGACAGCG





GTGCGGCGCT GGGATATTAC





GTCAGCGAGG ACGGGTATCC TGGCTGGATG





CCGCAGAAAT GGACATGGAT





ACCCCGTGAG TTACCCGGCG GGCGCGCCTC





GTTCATTCAC GTTTTTGAAC





CCGTGGAGGA CGGGCAGACT CGCGGTGCAA





ATGTGTTTTA CAGCGTGATG





GAGCAGATGA AGATGCTCGA CACGCTGCAG





AACACGCAGC TGCAGAGCGC





CATTGTGAAG GCGATGTATG CCGCCACCAT





TGAGAGTGAG CTGGATACGC





AGTCAGCGAT GGATTTTATT CTGGGCGCGA





ACAGTCAGGA GCAGCGGGAA





AGGCTGACCG GCTGGATTGG TGAAATTGCC





GCGTATTACG CCGCAGCGCC





GGTCCGGCTG GGAGGCGCAA AAGTACCGCA





CCTGATGCCG GGTGACTCAC





TGAACCTGCA GACGGCTCAG GATACGGATA





ACGGCTACTC CGTGTTTGAG





CAGTCACTGC TGCGGTATAT CGCTGCCGGG





CTGGGTGTCT CGTATGAGCA





GCTTTCCCGG AATTACGCCC AGATGAGCTA





CTCCACGGCA CGGGCCAGTG





CGAACGAGTC GTGGGCGTAC TTTATGGGGC





GGCGAAAATT CGTCGCATCC





CGTCAGGCGA GCCAGATGTT TCTGTGCTGG





CTGGAAGAGG CCATCGTTCG





CCGCGTGGTG ACGTTACCTT CAAAAGCGCG





CTTCAGTTTT CAGGAAGCCC





GCAGTGCCTG GGGGAACTGC GACTGGATAG





GCTCCGGTCG TATGGCCATC





GATGGTCTGA AAGAAGTTCA GGAAGCGGTG





ATGCTGATAG AAGCCGGACT





GAGTACCTAC GAGAAAGAGT GCGCAAAACG





CGGTGACGAC TATCAGGAAA





TTTTTGCCCA GCAGGTCCGT GAAACGATGG





AGCGCCGTGC AGCCGGTCTT





AAACCGCCCG CCTGGGCGGC TGCAGCATTT





GAATCCGGGC TGCGACAATC





AACAGAGGAG GAGAAGAGTG ACAGCAGAGC





TGCGTAATCT CCCGCATATT





GCCAGCATGG CCTTTAATGA GCCGCTGATG





CTTGAACCCG CCTATGCGCG





GGTTTTCTTT TGTGCGCTTG CAGGCCAGCT





TGGGATCAGC AGCCTGACGG





ATGCGGTGTC CGGCGACAGC CTGACTGCCC





AGGAGGCACT CGCGACGCTG





GCATTATCCG GTGATGATGA CGGACCACGA





CAGGCCCGCA GTTATCAGGT





CATGAACGGC ATCGCCGTGC TGCCGGTGTC





CGGCACGCTG GTCAGCCGGA





CGCGGGCGCT GCAGCCGTAC TCGGGGATGA





CCGGTTACAA CGGCATTATC





GCCCGTCTGC AACAGGCTGC CAGCGATCCG





ATGGTGGACG GCATTCTGCT





CGATATGGAC ACGCCCGGCG GGATGGTGGC





GGGGGCATTT GACTGCGCTG





ACATCATCGC CCGTGTGCGT GACATAAAAC





CGGTATGGGC GCTTGCCAAC





GACATGAACT GCAGTGCAGG TCAGTTGCTT





GCCAGTGCCG CCTCCCGGCG





TCTGGTCACG CAGACCGCCC GGACAGGCTC





CATCGGCGTC ATGATGGCTC





ACAGTAATTA CGGTGCTGCG CTGGAGAAAC





AGGGTGTGGA AATCACGCTG





ATTTACAGCG GCAGCCATAA GGTGGATGGC





AACCCCTACA GCCATCTTCC





GGATGACGTC CGGGAGACAC TGCAGTCCCG





GATGGACGCA ACCCGCCAGA





TGTTTGCGCA GAAGGTGTCG GCATATACCG





GCCTGTCCGT GCAGGTTGTG





CTGGATACCG AGGCTGCAGT GTACAGCGGT





CAGGAGGCCA TTGATGCCGG





ACTGGCTGAT GAACTTGTTA ACAGCACCGA





TGCGATCACC GTCATGCGTG





ATGCACTGGA TGCACGTAAA TCCCGTCTCT





CAGGAGGGCG AATGACCAAA





GAGACTCAAT CAACAACTGT TTCAGCCACT





GCTTCGCAGG CTGACGTTAC





TGACGTGGTG CCAGCGACGG AGGGCGAGAA





CGCCAGCGCG GCGCAGCCGG





ACGTGAACGC GCAGATCACC GCAGCGGTTG





CGGCAGAAAA CAGCCGCATT





ATGGG













Fragment 2 (positions 5509-12910 of phage lambda)


GATCCTCAAC TGTGAGGAGG CTCACGGACG


CGAAGAACAG GCACGCGTGC


TGGCAGAAAC CCCCGGTATG ACCGTGAAAA


CGGCCCGCCG CATTCTGGCC


GCAGCACCAC AGAGTGCACA GGCGCGCAGT


GACACTGCGC TGGATCGTCT


GATGCAGGGG GCACCGGCAC CGCTGGCTGC


AGGTAACCCG GCATCTGATG


CCGTTAACGA TTTGCTGAAC ACACCAGTGT


AAGGGATGTT TATGACGAGC


AAAGAAACCT TTACCCATTA CCAGCCGCAG


GGCAACAGTG ACCCGGCTCA


TACCGCAACC GCGCCCGGCG GATTGAGTGC


GAAAGCGCCT GCAATGACCC


CGCTGATGCT GGACACCTCC AGCCGTAAGC


TGGTTGCGTG GGATGGCACC


ACCGACGGTG CTGCCGTTGG CATTCTTGCG


GTTGCTGCTG ACCAGACCAG


CACCACGCTG ACGTTCTACA AGTCCGGCAC


GTTCCGTTAT GAGGATGTGC


TCTGGCCGGA GGCTGCCAGC GACGAGACGA


AAAAACGGAC CGCGTTTGCC


GGAACGGCAA TCAGCATCGT TTAACTTTAC


CCTTCATCAC TAAAGGCCGC


CTGTGCGGCT TTTTTTACGG GATTTTTTTA


TGTCGATGTA CACAACCGCC


CAACTGCTGG CGGCAAATGA GCAGAAATTT


AAGTTTGATC CGCTGTTTCT


GCGTCTCTTT TTCCGTGAGA GCTATCCCTT


CACCACGGAG AAAGTCTATC


TCTCACAAAT TCCGGGACTG GTAAACATGG


CGCTGTACGT TTCGCCGATT


GTTTCCGGTG AGGTTATCCG TTCCCGTGGC


GGCTCCACCT CTGAATTTAC


GCCGGGATAT GTCAAGCCGA AGCATGAAGT


GAATCCGCAG ATGACCCTGC


GTCGCCTGCC GGATGAAGAT CCGCAGAATC


TGGCGGACCC GGCTTACCGC


CGCCGTCGCA TCATCATGCA GAACATGCGT


GACGAAGAGC TGGCCATTGC


TCAGGTCGAA GAGATGCAGG CAGTTTCTGC


CGTGCTTAAG GGCAAATACA


CCATGACCGG TGAAGCCTTC GATCCGGTTG


AGGTGGATAT GGGCCGCAGT


GAGGAGAATA ACATCACGCA GTCCGGCGGC


ACGGAGTGGA GCAAGCGTGA


CAAGTCCACG TATGACCCGA CCGACGATAT


CGAAGCCTAC GCGCTGAACG


CCAGCGGTGT GGTGAATATC ATCGTGTTCG


ATCCGAAAGG CTGGGCGCTG


TTCCGTTCCT TCAAAGCCGT CAAGGAGAAG


CTGGATACCC GTCGTGGCTC


TAATTCCGAG CTGGAGACAG CGGTGAAAGA


CCTGGGCAAA GCGGTGTCCT


ATAAGGGGAT GTATGGCGAT GTGGCCATCG


TCGTGTATTC CGGACAGTAC


GTGGAAAACG GCGTCAAAAA GAACTTCCTG


CCGGACAACA CGATGGTGCT


GGGGAACACT CAGGCACGCG GTCTGCGCAC


CTATGGCTGC ATTCAGGATG


CGGACGCACA GCGCGAAGGC ATTAACGCCT


CTGCCCGTTA CCCGAAAAAC


TGGGTGACCA CCGGCGATCC GGCGCGTGAG


TTCACCATGA TTCAGTCAGC


ACCGCTGATG CTGCTGGCTG ACCCTGATGA


GTTCGTGTCC GTACAACTGG


CGTAATCATG GCCCTTCGGG GCCATTGTTT


CTCTGTGGAG GAGTCCATGA


CGAAAGATGA ACTGATTGCC CGTCTCCGCT


CGCTGGGTGA ACAACTGAAC


CGTGATGTCA GCCTGACGGG GACGAAAGAA


GAACTGGCGC TCCGTGTGGC


AGAGCTGAAA GAGGAGCTTG ATGACACGGA


TGAAACTGCC GGTCAGGACA


CCCCTCTCAG CCGGGAAAAT GTGCTGACCG


GACATGAAAA TGAGGTGGGA


TCAGCGCAGC CGGATACCGT GATTCTGGAT


ACGTCTGAAC TGGTCACGGT


CGTGGCACTG GTGAAGCTGC ATACTGATGC


ACTTCACGCC ACGCGGGATG


AACCTGTGGC ATTTGTGCTG CCGGGAACGG


CGTTTCGTGT CTCTGCCGGT


GTGGCAGCCG AAATGACAGA GCGCGGCCTG


GCCAGAATGC AATAACGGGA


GGCGCTGTGG CTGATTTCGA TAACCTGTTC


GATGCTGCCA TTGCCCGCGC


CGATGAAACG ATACGCGGGT ACATGGGAAC


GTCAGCCACC ATTACATCCG


GTGAGCAGTC AGGTGCGGTG ATACGTGGTG


TTTTTGATGA CCCTGAAAAT


ATCAGCTATG CCGGACAGGG CGTGCGCGTT


GAAGGCTCCA GCCCGTCCCT


GTTTGTCCGG ACTGATGAGG TGCGGCAGCT


GCGGCGTGGA GACACGCTGA


CCATCGGTGA GGAAAATTTC TGGGTAGATC


GGGTTTCGCC GGATGATGGC


GGAAGTTGTC ATCTCTGGCT TGGACGGGGC


GTACCGCCTG CCGTTAACCG


TCGCCGCTGA AAGGGGGATG TATGGCCATA


AAAGGTCTTG AGCAGGCCGT


TGAAAACCTC AGCCGTATCA GCAAAACGGC


GGTGCCTGGT GCCGCCGCAA


TGGCCATTAA CCGCGTTGCT TCATCCGCGA


TATCGCAGTC GGCGTCACAG


GTTGCCCGTG AGACAAAGGT ACGCCGGAAA


CTGGTAAAGG AAAGGGCCAG


GCTGAAAAGG GCCACGGTCA AAAATCCGCA


GGCCAGAATC AAAGTTAACC


GGGGGGATTT GCCCGTAATC AAGCTGGGTA


ATGCGCGGGT TGTCCTTTCG


CGCCGCAGGC GTCGTAAAAA GGGGCAGCGT


TCATCCCTGA AAGGTGGCGG


CAGCGTGCTT GTGGTGGGTA ACCGTCGTAT


TCCCGGCGCG TTTATTCAGC


AACTGAAAAA TGGCCGGTGG CATGTCATGC


AGCGTGTGGC TGGGAAAAAC


CGTTACCCCA TTGATGTGGT GAAAATCCCG


ATGGCGGTGC CGCTGACCAC


GGCGTTTAAA CAAAATATTG AGCGGATACG


GCGTGAACGT CTTCCGAAAG


AGCTGGGCTA TGCGCTGCAG CATCAACTGA


GGATGGTAAT AAAGCGATGA


AACATACTGA ACTCCGTGCA GCCGTACTGG


ATGCACTGGA GAAGCATGAC


ACCGGGGCGA CGTTTTTTGA TGGTCGCCCC


GCTGTTTTTG ATGAGGCGGA


TTTTCCGGCA GTTGCCGTTT ATCTCACCGG


CGCTGAATAC ACGGGCGAAG


AGCTGGACAG CGATACCTGG CAGGCGGAGC


TGCATATCGA AGTTTTCCTG


CCTGCTCAGG TGCCGGATTC AGAGCTGGAT


GCGTGGATGG AGTCCCGGAT


TTATCCGGTG ATGAGCGATA TCCCGGCACT


GTCAGATTTG ATCACCAGTA


TGGTGGCCAG CGGCTATGAC TACCGGCGCG


ACGATGATGC GGGCTTGTGG


AGTTCAGCCG ATCTGACTTA TGTCATTACC


TATGAAATGT GAGGACGCTA


TGCCTGTACC AAATCCTACA ATGCCGGTGA


AAGGTGCCGG GACCACCCTG


TGGGTTTATA AGGGGAGCGG TGACCCTTAC


GCGAATCCGC TTTCAGACGT


TGACTGGTCG CGTCTGGCAA AAGTTAAAGA


CCTGACGCCC GGCGAACTGA


CCGCTGAGTC CTATGACGAC AGCTATCTCG


ATGATGAAGA TGCAGACTGG


ACTGCGACCG GGCAGGGGCA GAAATCTGCC


GGAGATACCA GCTTCACGCT


GGCGTGGATG CCCGGAGAGC AGGGGCAGCA


GGCGCTGCTG GCGTGGTTTA


ATGAAGGCGA TACCCGTGCC TATAAAATCC


GCTTCCCGAA CGGCACGGTC


GATGTGTTCC GTGGCTGGGT CAGCAGTATC


GGTAAGGCGG TGACGGCGAA


GGAAGTGATC ACCCGCACGG TGAAAGTCAC


CAATGTGGGA CGTCCGTCGA


TGGCAGAAGA TCGCAGCACG GTAACAGCGG


CAACCGGCAT GACCGTGACG


CCTGCCAGCA CCTCGGTGGT GAAAGGGCAG


AGCACCACGC TGACCGTGGC


CTTCCAGCCG GAGGGCGTAA CCGACAAGAG


CTTTCGTGCG GTGTCTGCGG


ATAAAACAAA AGCCACCGTG TCGGTCAGTG


GTATGACCAT CACCGTGAAC


GGCGTTGCTG CAGGCAAGGT CAACATTCCG


GTTGTATCCG GTAATGGTGA


GTTTGCTGCG GTTGCAGAAA TTACCGTCAC


CGCCAGTTAA TCCGGAGAGT


CAGCGATGTT CCTGAAAACC GAATCATTTG


AACATAACGG TGTGACCGTC


ACGCTTTCTG AACTGTCAGC CCTGCAGCGC


ATTGAGCATC TCGCCCTGAT


GAAACGGCAG GCAGAACAGG CGGAGTCAGA


CAGCAACCGG AAGTTTACTG


TGGAAGACGC CATCAGAACC GGCGCGTTTC


TGGTGGCGAT GTCCCTGTGG


CATAACCATC CGCAGAAGAC GCAGATGCCG


TCCATGAATG AAGCCGTTAA


ACAGATTGAG CAGGAAGTGC TTACCACCTG


GCCCACGGAG GCAATTTCTC


ATGCTGAAAA CGTGGTGTAC CGGCTGTCTG


GTATGTATGA GTTTGTGGTG


AATAATGCCC CTGAACAGAC AGAGGACGCC


GGGCCCGCAG AGCCTGTTTC


TGCGGGAAAG TGTTCGACGG TGAGCTGAGT


TTTGCCCTGA AACTGGCGCG


TGAGATGGGG CGACCCGACT GGCGTGCCAT


GCTTGCCGGG ATGTCATCCA


CGGAGTATGC CGACTGGCAC CGCTTTTACA


GTACCCATTA TTTTCATGAT


GTTCTGCTGG ATATGCACTT TTCCGGGCTG


ACGTACACCG TGCTCAGCCT


GTTTTTCAGC GATCCGGATA TGCATCCGCT


GGATTTCAGT CTGCTGAACC


GGCGCGAGGC TGACGAAGAG CCTGAAGATG


ATGTGCTGAT GCAGAAAGCG


GCAGGGCTTG CCGGAGGTGT CCGCTTTGGC


CCGGACGGGA ATGAAGTTAT


CCCCGCTTCC CCGGATGTGG CGGACATGAC


GGAGGATGAC GTAATGCTGA


TGACAGTATC AGAAGGGATC GCAGGAGGAG


TCCGGTATGG CTGAACCGGT


AGGCGATCTG GTCGTTGATT TGAGTCTGGA


TGCGGCCAGA TTTGACGAGC


AGATGGCCAG AGTCAGGCGT CATTTTTCTG


GTACGGAAAG TGATGCGAAA


AAAACAGCGG CAGTCGTTGA ACAGTCGCTG


AGCCGACAGG CGCTGGCTGC


ACAGAAAGCG GGGATTTCCG TCGGGCAGTA


TAAAGCCGCC ATGCGTATGC


TGCCTGCACA GTTCACCGAC GTGGCCACGC


AGCTTGCAGG CGGGCAAAGT


CCGTGGCTGA TCCTGCTGCA ACAGGGGGGG


CAGGTGAAGG ACTCCTTCGG


CGGGATGATC CCCATGTTCA GGGGGCTTGC


CGGTGCGATC ACCCTGCCGA


TGGTGGGGGC CACCTCGCTG GCGGTGGCGA 


CCGGTGCGCT GGCGTATGCC


TGGTATCAGG GCAACTCAAC CCTGTCCGAT


TTCAACAAAA CGCTGGTCCT


TTCCGGCAAT CAGGCGGGAC TGACGGCAGA


TCGTATGCTG GTCCTGTCCA


GAGCCGGGCA GGCGGCAGGG CTGACGTTTA


ACCAGACCAG CGAGTCACTC


AGCGCACTGG TTAAGGCGGG GGTAAGCGGT


GAGGCTCAGA TTGCGTCCAT


CAGCCAGAGT GTGGCGCGTT TCTCCTCTGC


ATCCGGCGTG GAGGTGGACA


AGGTCGCTGA AGCCTTCGGG AAGCTGACCA


CAGACCCGAC GTCGGGGCTG


ACGGCGATGG CTCGCCAGTT CCATAACGTG


TCGGCGGAGC AGATTGCGTA


TGTTGCTCAG TTGCAGCGTT CCGGCGATGA


AGCCGGGGCA TTGCAGGCGG


CGAACGAGGC CGCAACGAAA GGGTTTGATG


ACCAGACCCG CCGCCTGAAA


GAGAACATGG GCACGCTGGA GACCTGGGCA


GACAGGACTG CGCGGGCATT


CAAATCCATG TGGGATGCGG TGCTGGATAT


TGGTCGTCCT GATACCGCGC


AGGAGATGCT GATTAAGGCA GAGGCTGCGT


ATAAGAAAGC AGACGACATC


TGGAATCTGC GCAAGGATGA TTATTTTGTT


AACGATGAAG CGCGGGCGCG


TTACTGGGAT GATCGTGAAA AGGCCCGTCT


TGCGCTTGAA GCCGCCCGAA


AGAAGGCTGA GCAGCAGACT CAACAGGACA


AAAATGCGCA GCAGCAGAGC


GATACCGAAG CGTCACGGCT GAAATATACC


GAAGAGGCGC AGAAGGCTTA


CGAACGGCTG CAGACGCCGC TGGAGAAATA


TACCGCCCGT CAGGAAGAAC


TGAACAAGGC ACTGAAAGAC GGGAAAATCC


TGCAGGCGGA TTACAACACG


CTGATGGCGG CGGCGAAAAA GGATTATGAA


GCGACGCTGA AAAAGCCGAA


ACAGTCCAGC GTGAAGGTGT CTGCGGGCGA


TCGTCAGGAA GACAGTGCTC


ATGCTGCCCT GCTGACGCTT CAGGCAGAAC


TCCGGACGCT GGAGAAGCAT


GCCGGAGCAA ATGAGAAAAT CAGCCAGCAG


CGCCGGGATT TGTGGAAGGC


GGAGAGTCAG TTCGCGGTAC TGGAGGAGGC


GGCGCAACGT CGCCAGCTGT


CTGCACAGGA GAAATCCCTG CTGGCGCATA


AAGATGAGAC GCTGGAGTAC


AAACGCCAGC TGGCTGCACT TGGCGACAAG GTTAC













Fragment 3 (positions 12910-22346 of phage lambda)


GTATCAGGAG CGCCTGAACG CGCTGGCGCA





GCAGGCGGAT AAATTCGCAC





AGCAGCAACG GGCAAAACGG GCCGCCATTG





ATGCGAAAAG CCGGGGGCTG





ACTGACCGGC AGGCAGAACG GGAAGCCACG





GAACAGCGCC TGAAGGAACA





GTATGGCGAT AATCCGCTGG CGCTGAATAA





CGTCATGTCA GAGCAGAAAA





AGACCTGGGC GGCTGAAGAC CAGCTTCGCG





GGAACTGGAT GGCAGGCCTG





AAGTCCGGCT GGAGTGAGTG GGAAGAGAGC





GCCACGGACA GTATGTCGCA





GGTAAAAAGT GCAGCCACGC AGACCTTTGA





TGGTATTGCA CAGAATATGG





CGGCGATGCT GACCGGCAGT GAGCAGAACT





GGCGCAGCTT CACCCGTTCC





GTGCTGTCCA TGATGACAGA AATTCTGCTT





AAGCAGGCAA TGGTGGGGAT





TGTCGGGAGT ATCGGCAGCG CCATTGGCGG





GGCTGTTGGT GGCGGCGCAT





CCGCGTCAGG CGGTACAGCC ATTCAGGCCG





CTGCGGCGAA ATTCCATTTT





GCAACCGGAG GATTTACGGG AACCGGCGGC





AAATATGAGC CAGCGGGGAT





TGTTCACCGT GGTGAGTTTG TCTTCACGAA





GGAGGCAACC AGCCGGATTG





GCGTGGGGAA TCTTTACCGG CTGATGCGCG





GCTATGCCAC CGGCGGTTAT





GTCGGTACAC CGGGCAGCAT GGCAGACAGC





CGGTCGCAGG CGTCCGGGAC





GTTTGAGCAG AATAACCATG TGGTGATTAA





CAACGACGGC ACGAACGGGC





AGATAGGTCC GGCTGCTCTG AAGGCGGTGT





ATGACATGGC CCGCAAGGGT





GCCCGTGATG AAATTCAGAC ACAGATGCGT





GATGGTGGCC TGTTCTCCGG





AGGTGGACGA TGAAGACCTT CCGCTGGAAA





GTGAAACCCG GTATGGATGT





GGCTTCGGTC CCTTCTGTAA GAAAGGTGCG





CTTTGGTGAT GGCTATTCTC





AGCGAGCGCC TGCCGGGCTG AATGCCAACC





TGAAAACGTA CAGCGTGACG





CTTTCTGTCC CCCGTGAGGA GGCCACGGTA





CTGGAGTCGT TTCTGGAAGA





GCACGGGGGC TGGAAATCCT TTCTGTGGAC





GCCGCCTTAT GAGTGGCGGC





AGATAAAGGT GACCTGCGCA AAATGGTCGT





CGCGGGTCAG TATGCTGCGT





GTTGAGTTCA GCGCAGAGTT TGAACAGGTG





GTGAACTGAT GCAGGATATC





CGGCAGGAAA CACTGAATGA ATGCACCCGT





GCGGAGCAGT CGGCCAGCGT





GGTGCTCTGG GAAATCGACC TGACAGAGGT





CGGTGGAGAA CGTTATTTTT





TCTGTAATGA GCAGAACGAA AAAGGTGAGC





CGGTCACCTG GCAGGGGCGA





CAGTATCAGC CGTATCCCAT TCAGGGGAGC





GGTTTTGAAC TGAATGGCAA





AGGCACCAGT ACGCGCCCCA CGCTGACGGT





TTCTAACCTG TACGGTATGG





TCACCGGGAT GGCGGAAGAT ATGCAGAGTC





TGGTCGGCGG AACGGTGGTC





CGGCGTAAGG TTTACGCCCG TTTTCTGGAT





GCGGTGAACT TCGTCAACGG





AAACAGTTAC GCCGATCCGG AGCAGGAGGT





GATCAGCCGC TGGCGCATTG





AGCAGTGCAG CGAACTGAGC GCGGTGAGTG





CCTCCTTTGT ACTGTCCACG





CCGACGGAAA CGGATGGCGC TGTTTTTCCG





GGACGTATCA TGCTGGCCAA





CACCTGCACC TGGACCTATC GCGGTGACGA





GTGCGGTTAT AGCGGTCCGG





CTGTCGCGGA TGAATATGAC CAGCCAACGT





CCGATATCAC GAAGGATAAA





TGCAGCAAAT GCCTGAGCGG TTGTAAGTTC





CGCAATAACG TCGGCAACTT





TGGCGGCTTC CTTTCCATTA ACAAACTTTC





GCAGTAAATC CCATGACACA





GACAGAATCA GCGATTCTGG CGCACGCCCG





GCGATGTGCG CCAGCGGAGT





CGTGCGGCTT CGTGGTAAGC ACGCCGGAGG





GGGAAAGATA TTTCCCCTGC





GTGAATATCT CCGGTGAGCC GGAGGCTATT





TCCGTATGTC GCCGGAAGAC





TGGCTGCAGG CAGAAATGCA GGGTGAGATT





GTGGCGCTGG TCCACAGCCA





CCCCGGTGGT CTGCCCTGGC TGAGTGAGGC





CGACCGGCGG CTGCAGGTGC





AGAGTGATTT GCCGTGGTGG CTGGTCTGCC





GGGGGACGAT TCATAAGTTC





CGCTGTGTGC CGCATCTCAC CGGGCGGCGC





TTTGAGCACG GTGTGACGGA





CTGTTACACA CTGTTCCGGG ATGCTTATCA





TCTGGCGGGG ATTGAGATGC





CGGACTTTCA TCGTGAGGAT GACTGGTGGC





GTAACGGCCA GAATCTCTAT





CTGGATAATC TGGAGGCGAC GGGGCTGTAT





CAGGTGCCGT TGTCAGCGGC





ACAGCCGGGC GATGTGCTGC TGTGCTGTTT





TGGTTCATCA GTGCCGAATC





ACGCCGCAAT TTACTGCGGC GACGGCGAGC





TGCTGCACCA TATTCCTGAA





CAACTGAGCA AACGAGAGAG GTACACCGAC





AAATGGCAGC GACGCACACA





CTCCCTCTGG CGTCACCGGG CATGGCGCGC





ATCTGCCTTT ACGGGGATTT





ACAACGATTT GGTCGCCGCA TCGACCTTCG





TGTGAAAACG GGGGCTGAAG





CCATCCGGGC ACTGGCCACA CAGCTCCCGG





CGTTTCGTCA GAAACTGAGC





GACGGCTGGT ATCAGGTACG GATTGCCGGG





CGGGACGTCA GCACGTCCGG





GTTAACGGCG CAGTTACATG AGACTCTGCC 





TGATGGCGCT GTAATTCATA





TTGTTCCCAG AGTCGCCGGG GCCAAGTCAG





GTGGCGTATT CCAGATTGTC





CTGGGGGCTG CCGCCATTGC CGGATCATTC





TTTACCGCCG GAGCCACCCT





TGCAGCATGG GGGGCAGCCA TTGGGGCCGG





TGGTATGACC GGCATCCTGT





TTTCTCTCGG TGCCAGTATG GTGCTCGGTG





GTGTGGCGCA GATGCTGGCA





CCGAAAGCCA GAACTCCCCG TATACAGACA





ACGGATAACG GTAAGCAGAA





CACCTATTTC TCCTCACTGG ATAACATGGT





TGCCCAGGGC AATGTTCTGC





CTGTTCTGTA CGGGGAAATG CGCGTGGGGT





CACGCGTGGT TTCTCAGGAG





ATCAGCACGG CAGACGAAGG GGACGGTGGT





CAGGTTGTGG TGATTGGTCG





CTGATGCAAA ATGTTTTATG TGAAACCGCC





TGCGGGCGGT TTTGTCATTT





ATGGAGCGTG AGGAATGGGT AAAGGAAGCA





GTAAGGGGCA TACCCCGCGC





GAAGCGAAGG ACAACCTGAA GTCCACGCAG





TTGCTGAGTG TGATCGATGC





CATCAGCGAA GGGCCGATTG AAGGTCCGGT 





GGATGGCTTA AAAAGCGTGC





TGCTGAACAG TACGCCGGTG CTGGACACTG





AGGGGAATAC CAACATATCC





GGTGTCACGG TGGTGTTCCG GGCTGGTGAG





CAGGAGCAGA CTCCGCCGGA





GGGATTTGAA TCCTCCGGCT CCGAGACGGT





GCTGGGTACG GAAGTGAAAT





ATGACACGCC GATCACCCGC ACCATTACGT





CTGCAAACAT CGACCGTCTG





CGCTTTACCT TCGGTGTACA GGCACTGGTG





GAAACCACCT CAAAGGGTGA





CAGGAATCCG TCGGAAGTCC GCCTGCTGGT





TCAGATACAA CGTAACGGTG





GCTGGGTGAC GGAAAAAGAC ATCACCATTA





AGGGCAAAAC CACCTCGCAG





TATCTGGCCT CGGTGGTGAT GGGTAACCTG





CCGCCGCGCC CGTTTAATAT





CCGGATGCGC AGGATGACGC CGGACAGCAC





CACAGACCAG CTGCAGAACA





AAACGCTCTG GTCGTCATAC ACTGAAATCA





TCGATGTGAA ACAGTGCTAC





CCGAACACGG CACTGGTCGG CGTGCAGGTG





GACTCGGAGC AGTTCGGCAG





CCAGCAGGTG AGCCGTAATT ATCATCTGCG





CGGGCGTATT CTGCAGGTGC





CGTCGAACTA TAACCCGCAG ACGCGGCAAT





ACAGCGGTAT CTGGGACGGA





ACGTTTAAAC CGGCATACAG CAACAACATG





GCCTGGTGTC TGTGGGATAT





GCTGACCCAT CCGCGCTACG GCATGGGGAA





ACGTCTTGGT GCGGCGGATG





TGGATAAATG GGCGCTGTAT GTCATCGGCC





AGTACTGCGA CCAGTCAGTG





CCGGACGGCT TTGGCGGCAC GGAGCCGCGC





ATCACCTGTA ATGCGTACCT





GACCACACAG CGTAAGGCGT GGGATGTGCT





CAGCGATTTC TGCTCGGCGA





TGCGCTGTAT GCCGGTATGG AACGGGCAGA





CGCTGACGTT CGTGCAGGAC





CGACCGTCGG ATAAGACGTG GACCTATAAC





CGCAGTAATG TGGTGATGCC





GGATGATGGC GCGCCGTTCC GCTACAGCTT





CAGCGCCCTG AAGGACCGCC





ATAATGCCGT TGAGGTGAAC TGGATTGACC





CGAACAACGG CTGGGAGACG





GCGACAGAGC TTGTTGAAGA TACGCAGGCC





ATTGCCCGTT ACGGTCGTAA





TGTTACGAAG ATGGATGCCT TTGGCTGTAC





CAGCCGGGGG CAGGCACACC





GCGCCGGGCT GTGGCTGATT AAAACAGAAC





TGCTGGAAAC GCAGACCGTG





GATTTCAGCG TCGGCGCAGA AGGGCTTCGC





CATGTACCGG GCGATGTTAT





TGAAATCTGC GATGATGACT ATGCCGGTAT





CAGCACCGGT GGTCGTGTGC





TGGCGGTGAA CAGCCAGACC CGGACGCTGA





CGCTCGACCG TGAAATCACG





CTGCCATCCT CCGGTACCGC GCTGATAAGC





CTGGTTGACG GAAGTGGCAA





TCCGGTCAGC GTGGAGGTTC AGTCCGTCAC





CGACGGCGTG AAGGTAAAAG





TGAGCCGTGT TCCTGACGGT GTTGCTGAAT





ACAGCGTATG GGAGCTGAAG





CTGCCGACGC TGCGCCAGCG ACTGTTCCGC





TGCGTGAGTA TCCGTGAGAA





CGACGACGGC ACGTATGCCA TCACCGCCGT





GCAGCATGTG CCGGAAAAAG





AGGCCATCGT GGATAACGGG GCGCACTTTG





ACGGCGAACA GAGTGGCACG





GTGAATGGTG TCACGCCGCC AGCGGTGCAG





CACCTGACCG CAGAAGTCAC





TGCAGACAGC GGGGAATATC AGGTGCTGGC





GCGATGGGAC ACACCGAAGG





TGGTGAAGGG CGTGAGTTTC CTGCTCCGTC





TGACCGTAAC AGCGGACGAC





GGCAGTGAGC GGCTGGTCAG CACGGCCCGG





ACGACGGAAA CCACATACCG





CTTCACGCAA CTGGCGCTGG GGAACTACAG





GCTGACAGTC CGGGCGGTAA





ATGCGTGGGG GCAGCAGGGC GATCCGGCGT





CGGTATCGTT CCGGATTGCC





GCACCGGCAG CACCGTCGAG GATTGAGCTG





ACGCCGGGCT ATTTTCAGAT





AACCGCCACG CCGCATCTTG CCGTTTATGA





CCCGACGGTA CAGTTTGAGT





TCTGGTTCTC GGAAAAGCAG ATTGCGGATA





TCAGACAGGT TGAAACCAGC





ACGCGTTATC TTGGTACGGC GCTGTACTGG





ATAGCCGCCA GTATCAATAT





CAAACCGGGC CATGATTATT ACTTTTATAT





CCGCAGTGTG AACACCGTTG





GCAAATCGGC ATTCGTGGAG GCCGTCGGTC





GGGCGAGCGA TGATGCGGAA





GGTTACCTGG ATTTTTTCAA AGGCAAGATA





ACCGAATCCC ATCTCGGCAA





GGAGCTGCTG GAAAAAGTCG AGCTGACGGA





GGATAACGCC AGCAGACTGG





AGGAGTTTTC GAAAGAGTGG AAGGATGCCA





GTGATAAGTG GAATGCCATG





TGGGCTGTCA AAATTGAGCA GACCAAAGAC





GGCAAACATT ATGTCGCGGG





TATTGGCCTC AGCATGGAGG ACACGGAGGA





AGGCAAACTG AGCCAGTTTC





TGGTTGCCGC CAATCGTATC GCATTTATTG





ACCCGGCAAA CGGGAATGAA





ACGCCGATGT TTGTGGCGCA GGGCAACCAG





ATATTCATGA ACGACGTGTT





CCTGAAGCGC CTGACGGCCC CCACCATTAC





CAGCGGCGGC AATCCTCCGG





CCTTTTCCCT GACACCGGAC GGAAAGCTGA





CCGCTAAAAA TGCGGATATC





AGTGGCAGTG TGAATGCGAA CTCCGGGACG





CTCAGTAATG TGACGATAGC





TGAAAACTGT ACGATAAACG GTACGCTGAG





GGCGGAAAAA ATCGTCGGGG





ACATTGTAAA GGCGGCGAGC GCGGCTTTTC





CGCGCCAGCG TGAAAGCAGT





GTGGACTGGC CGTCAGGTAC CCGTACTGTC





ACCGTGACCG ATGACCATCC





TTTTGATCGC CAGATAGTGG TGCTTCCGCT





GACGTTTCGC GGAAGTAAGC





GTACTGTCAG CGGCAGGACA ACGTATTCGA





TGTGTTATCT GAAAGTACTG





ATGAACGGTG CGGTGATTTA TGATGGCGCG





GCGAACGAGG CGGTACAGGT





GTTCTCCCGT ATTGTTGACA TGCCAGCGGG





TCGGGGAAAC GTGATCCTGA





CGTTCACGCT TACGTCCACA CGGCATTCGG 





CAGATATTCC GCCGTATACG





TTTGCCAGCG ATGTGCAGGT TATGGTGATT





AAGAAACAGG CGCTGGGCAT





CAGCGTGGTC TGAGTGTGTT ACAGAGGTTC





GTCCGGGAAC GGGCGTTTTA





TTATAAAACA GTGAGAGGTG AACGATGCGT





AATGTGTGTA TTGCCGTTGC





TGTCTTTGCC GCACTTGCGG TGACAGTCAC





TCCGGCCCGT GCGGAAGGTG





GACATGGTAC GTTTACGGTG GGCTATTTTC





AAGTGAAACC GGGTACATTG





CCGTCGTTGT CGGGCGGGGA TACCGGTGTG





AGTCATCTGA AAGGGATTAA





CGTGAAGTAC CGTTATGAGC TGACGGACAG





TGTGGGGGTG ATGGCTTCCC





TGGGGTTCGC CGCGTCGAAA AAGAGCAGCA





CAGTGATGAC CGGGGAGGAT





ACGTTTCACT ATGAGAGCCT GCGTGGACGT





TATGTGAGCG TGATGGCCGG





ACCGGTTTTA CAAATCAGTA AGCAGGTCAG





TGCGTACGCC ATGGCCGGAG





TGGCTCACAG TCGGTGGTCC GGCAGTACAA





TGGATTACCG TAAGACGGAA





ATCACTCCCG GGTATATGAA AGAGACGACC





ACTGCCAGGG ACGAAAGTGC





AATGCGGCAT ACCTCAGTGG CGTGGAGTGC





AGGTATACAG ATTAATCCGG





CAGCGTCCGT CGTTGTTGAT ATTGCTTATG





AAGGCTCCGG CAGTGGCGAC





TGGCGTACTG ACGGATTCAT CGTTGGGGTC





GGTTATAAAT TCTGATTAGC





CAGGTAACAC AGTGTTATGA CAGCCCGCCG





GAACCGGTGG GCTTTTTTGT





GGGGTGAATA TGGCAGTAAA GATTTCAGGA





GTCCTGAAAG ACGGCACAGG





AAAACCGGTA CAGAACTGCA CCATTCAGCT





GAAAGCCAGA CGTAACAGCA





CCACGGTGGT GGTGAACACG GTGGGCTCAG





AGAATCCGGA TGAAGCCGGG





CGTTACAGCA TGGATGTGGA GTACGGTCAG





TACAGTGTCA TCCTGCAGGT





TGACGGTTTT CCACCATCGC ACGCCGGGAC





CATCACCGTG TATGAAGATT





CACAACCGGG GACGCTGAAT GATTTTCTCT





GTGCCATGAC GGAGGATGAT





GCCCGGCCGG AGGTGCTGCG TCGTCTTGAA





CTGATGGTGG AAGAGGTGGC





GCGTAACGCG TCCGTGGTGG CACAGAGTAC





GGCAGACGCG AAGAAATCAG





CCGGCGATGC CAGTGCATCA GCTGCTCAGG





TCGCGGCCCT TGTGACTGAT





GCAACTGACT CAGCACGCGC CGCCAGCACG





TCCGCCGGAC AGGCTGCATC





GTCAGCTCAG GAAGCGTCCT CCGGCGCAGA





AGCGGCATCA GCAAAGGCCA





CTGAAGCGGA AAAAAGTGCC GCAGCCGCAG





AGTCCTCAAA AAACGCGGCG





GCCACCAGTG CCGGTGCGGC GAAAACGTCA





GAAACGAATG CTGCAGCGTC





ACAACAATCA GCCGCCACGT CTGCCTCCAC





CGCGGCCACG AAAGCGTCAG





AGGCCGCCAC TTCAGCACGA GATGCGGTGG





CCTCAAAAGA GGCAGCAAAA





TCATCAGAAA CGAACGCATC ATCAAGTGCC





GGTCGTGCAG CTTCCTCGGC





AACGGCGGCA GAAAATTCTG CCAGGGCGGC





AAAAACGTCC GAGACGAATG





CCAGGTCATC TGAAACAGCA GCGGAACGGA





GCGCCTCTGC CGCGGCAGAC





GCAAAAACAG CGGCGGCGGG GAGTGCGTCA





ACGGCATCCA CGAAGGCGAC





AGAGGCTGCG GGAAGTGCGG TATCAGCATC





GCAGAGCAAA AGTGCGGCAG





AAGCGGCGGC AATACGTGCA AAAAATTCGG





CAAAACGTGC AGAAGATATA





GCTTCAGCTG TCGCGCTTGA GGATGCGGAC





ACAACGAGAA AGGGGATAGT





GCAGCTCAGC AGTGCAACCA ACAGCACGTC





TGAAACGCTT GCTGCAACGC





CAAAGGCGGT TAAGGTGGTA ATGGATGAAA





CGAACAGAAA AGCCCACTGG





ACAGTCCGGC ACTGACCGGA ACGCCAACAG





CACCAACCGC GCTCAGGGGA





ACAAACAATA CCCAGATTGC GAACACCGCT





TTTGTACTGG CCGCGATTGC





AGATGTTATC GACGCGTCAC CTGACGCACT





GAATACGCTG AATGAACTGG





CCGCAGCGCT CGGGAATGAT CCAGATTTTG





CTACCACCAT GACTAACGCG





CTTGCGGGTA AACAACCGAA GAATGCGACA





CTGACGGCGC TGGCAGGGCT





TTCCACGGCG AAAAATAAAT TACCGTATTT





TGCGGAAAAT GATGCCGCCA





GCCTGACTGA ACTGACTCAG GTTGGCAGGG





ATATTCTGGC AAAAAATTCC





GTTGCAGATG TTCTTGAATA CCTTGGGGCC





GGTGAGAATT CGGCCTTTCC





GGCAGGTGCG CCGATCCCGT GGCCATCAGA





TATCGTTCCG TCTGGCTACG





TCCTGATGCA GGGGCAGGCG TTTGACAAAT





CAGCCTACCC AAAACTTGCT





GTCGCGTATC CATCGGGTGT GCTTCCTGAT





ATGCGAGGCT GGACAATCAA





GGGGAAACCC GCCAGCGGTC GTGCTGTATT





GTCTCAGGAA CAGGATGGAA





TTAAGTCGCA CACCCACAGT GCCAGTGCAT





CCGGTACGGA TTTGGGGACG





AAAACCACAT CGTCGTTTGA TTACGGGACG





AAAACAACAG GCAGTTTCGA





TTACGGCACC AAATCGACGA ATAACACGGG





GGCTCATGCT CACAGTCTGA





GCGGTTCAAC AGGGGCCGCG GGTGCTCATG





CCCACACAAG TGGTTTAAGG





ATGAACAGTT CTGGCTGGAG TCAGTATGGA





ACAGCAACCA TTACAGGAAG





TTTATCCACA GTTAAAGGAA CCAGCACACA





GGGTATTGCT TATTTATCGA





AAACGGACAG TCAGGGCAGC CACAGTCACT





CATTGTCCGG TACAGCCGTG





AGTGCCGGTG CACATGCGCA TACAGTTGGT





ATTGGTGCGC ACCAGCATCC





GGTTGTTATC GGTGCTCATG CCCATTCTTT





CAGTATTGGT TCACACGGAC





ACACCATCAC CGTTAACGCT GCGGGTAACG





CGGAAAACAC CGTCAAAAAC





ATTGCATTTA ACTATATTGT GAGGCTTGCA





TAATGGCATT CAGAATGAGT





GAACAACCAC GGACCATAAA AATTTATAAT





CTGCTGGCCG GAACTAATGA





ATTTATTGGT GAAGGTGACG CATATATTCC





GCCTCATACC GGTCTGCCTG





CAAACAGTAC CGATATTGCA CCGCCAGATA





TTCCGGCTGG CTTTGTGGCT





GTTTTCAACA GTGATGAGGC ATCGTGGCAT





CTCGTTGAAG ACCATCGGGG





TAAAACCGTC TATGACGTGG CTTCCGGCGA





CGCGTTATTT ATTTCTGAAC





TCGGTCCGTT ACCGGAAAAT TTTACCTGGT





TATCGCCGGG AGGGGAATAT





CAGAAGTGGA ACGGCACAGC CTGGGTGAAG





GATACGGAAG CAGAAAAACT





GTTCCG













Fragment 4 (positions 22350-27972 of phage lambda)


GATCCGGGAG GCGGAAGAAA CAAAAAAAAG





CCTGATGCAG GTAGCCAGTG





AGCATATTGC GCCGCTTCAG GATGCTGCAG





ATCTGGAAAT TGCAACGAAG





GAAGAAACCT CGTTGCTGGA AGCCTGGAAG





AAGTATCGGG TGTTGCTGAA





CCGTGTTGAT ACATCAACTG CACCTGATAT





TGAGTGGCCT GCTGTCCCTG





TTATGGAGTA ATCGTTTTGT GATATGCCGC





AGAAACGTTG TATGAAATAA





CGTTCTGCGG TTAGTTAGTA TATTGTAAAG





CTGAGTATTG GTTTATTTGG





CGATTATTAT CTTCAGGAGA ATAATGGAAG





TTCTATGACT CAATTGTTCA





TAGTGTTTAC ATCACCGCCA ATTGCTTTTA





AGACTGAACG CATGAAATAT





GGTTTTTCGT CATGTTTTGA GTCTGCTGTT





GATATTTCTA AAGTCGGTTT





TTTTTCTTCG TTTTCTCTAA CTATTTTCCA





TGAAATACAT TTTTGATTAT





TATTTGAATC AATTCCAATT ACCTGAAGTC





TTTCATCTAT AATTGGCATT





GTATGTATTG GTTTATTGGA GTAGATGCTT





GCTTTTCTGA GCCATAGCTC





TGATATCCAA ATGAAGCCAT AGGCATTTGT





TATTTTGGCT CTGTCAGCTG





CATAACGCCA AAAAATATAT TTATCTGCTT





GATCTTCAAA TGTTGTATTG





ATTAAATCAA TTGGATGGAA TTGTTTATCA





TAAAAAATTA ATGTTTGAAT





GTGATAACCG TCCTTTAAAA AAGTCGTTTC





TGCAAGCTTG GCTGTATAGT





CAACTAACTC TTCTGTCGAA GTGATATTTT





TAGGCTTATC TACCAGTTTT





AGACGCTCTT TAATATCTTC AGGAATTATT





TTATTGTCAT ATTGTATCAT





GCTAAATGAC AATTTGCTTA TGGAGTAATC





TTTTAATTTT AAATAAGTTA





TTCTCCTGGC TTCATCAAAT AAAGAGTCGA





ATGATGTTGG CGAAATCACA





TCGTCACCCA TTGGATTGTT TATTTGTATG





CCAAGAGAGT TACAGCAGTT





ATACATTCTG CCATAGATTA TAGCTAAGGC





ATGTAATAAT TCGTAATCTT





TTAGCGTATT AGCGACCCAT CGTCTTTCTG





ATTTAATAAT AGATGATTCA





GTTAAATATG AAGGTAATTT CTTTTGTGCA





AGTCTGACTA ACTTTTTTAT





ACCAATGTTT AACATACTTT CATTTGTAAT





AAACTCAATG TCATTTTCTT





CAATGTAAGA TGAAATAAGA GTAGCCTTTG





CCTCGCTATA CATTTCTAAA





TCGCCTTGTT TTTCTATCGT ATTGCGAGAA





TTTTTAGCCC AAGCCATTAA





TGGATCATTT TTCCATTTTT CAATAACATT





ATTGTTATAC CAAATGTCAT





ATCCTATAAT CTGGTTTTTG TTTTTTTGAA





TAATAAATGT TACTGTTCTT





GCGGTTTGGA GGAATTGATT CAAATTCAAG





CGAAATAATT CAGGGTCAAA





ATATGTATCA ATGCAGCATT TGAGCAAGTG





CGATAAATCT TTAAGTCTTC





TTTCCCATGG TTTTTTAGTC ATAAAACTCT





CCATTTTGAT AGGTTGCATG





CTAGATGCTG ATATATTTTA GAGGTGATAA





AATTAACTGC TTAACTGTCA





ATGTAATACA AGTTGTTTGA TCTTTGCAAT





GATTCTTATC AGAAACCATA





TAGTAAATTA GTTACACAGG AAATTTTTAA





TATTATTATT ATCATTCATT





ATGTATTAAA ATTAGAGTTG TGGCTTGGCT





CTGCTAACAC GTTGCTCATA





GGAGATATGG TAGAGCCGCA GACACGTCGT





ATGCAGGAAC GTGCTGCGGC





TGGCTGGTGA ACTTCCGATA GTGCGGGTGT





TGAATGATTT CCAGTTGCTA





CCGATTTTAC ATATTTTTTG CATGAGAGAA





TTTGTACCAC CTCCCACCGA





CCATCTATGA CTGTACGCCA CTGTCCCTAG





GACTGCTATG TGCCGGAGCG





GACATTACAA ACGTCCTTCT CGGTGCATGC





CACTGTTGCC AATGACCTGC





CTAGGAATTG GTTAGCAAGT TACTACCGGA





TTTTGTAAAA ACAGCCCTCC





TCATATAAAA AGTATTCGTT CACTTCCGAT





AAGCGTCGTA ATTTTCTATC





TTTCATCATA TTCTAGATCC CTCTGAAAAA





ATCTTCCGAG TTTGCTAGGC





ACTGATACAT AACTCTTTTC CAATAATTGG





GGAAGTCATT CAAATCTATA





ATAGGTTTCA GATTTGCTTC AATAAATTCT





GACTGTAGCT GCTGAAACGT





TGCGGTTGAA CTATATTTCC TTATAACTTT





TACGAAAGAG TTTCTTTGAG





TAATCACTTC ACTCAAGTGC TTCCCTGCCT





CCAAACGATA CCTGTTAGCA





ATATTTAATA GCTTGAAATG ATGAAGAGCT





CTGTGTTTGT CTTCCTGCCT





CCAGTTCGCC GGGCATTCAA CATAAAAACT





GATAGCACCC GGAGTTCCGG





AAACGAAATT TGCATATACC CATTGCTCAC





GAAAAAAAAT GTCCTTGTCG





ATATAGGGAT GAATCGCTTG GTGTACCTCA





TCTACTGCGA AAACTTGACC





TTTCTCTCCC ATATTGCAGT CGCGGCACGA





TGGAACTAAA TTAATAGGCA





TCACCGAAAA TTCAGGATAA TGTGCAATAG





GAAGAAAATG ATCTATATTT





TTTGTCTGTC CTATATCACC ACAAAATGGA





CATTTTTCAC CTGATGAAAC





AAGCATGTCA TCGTAATATG TTCTAGCGGG





TTTGTTTTTA TCTCGGAGAT





TATTTTCATA AAGCTTTTCT AATTTAACCT





TTGTCAGGTT ACCAACTACT





AAGGTTGTAG GCTCAAGAGG GTGTGTCCTG





TCGTAGGTAA ATAACTGACC





TGTCGAGCTT AATATTCTAT ATTGTTGTTC





TTTCTGCAAA AAAGTGGGGA





AGTGAGTAAT GAAATTATTT CTAACATTTA





TCTGCATCAT ACCTTCCGAG





CATTTATTAA GCATTTCGCT ATAAGTTCTC





GCTGGAAGAG GTAGTTTTTT





CATTGTACTT TACCTTCATC TCTGTTCATT





ATCATCGCTT TTAAAACGGT





TCGACCTTCT AATCCTATCT GACCATTATA





ATTTTTTAGA ATGGTTTCAT





AAGAAAGCTC TGAATCAACG GACTGCGATA





ATAAGTGGTG GTATCCAGAA





TTTGTCACTT CAAGTAAAAA CACCTCACGA





GTTAAAACAC CTAAGTTCTC





ACCGAATGTC TCAATATCCG GACGGATAAT





ATTTATTGCT TCTCTTGACC





GTAGGACTTT CCACATGCAG GATTTTGGAA





CCTCTTGCAG TACTACTGGG





GAATGAGTTG CAATTATTGC TACACCATTG





CGTGCATCGA GTAAGTCGCT





TAATGTTCGT AAAAAAGCAG AGAGCAAAGG





TGGATGCAGA TGAACCTCTG





GTTCATCGAA TAAAACTAAT GACTTTTCGC





CAACGACATC TACTAATCTT





GTGATAGTAA ATAAAACAAT TGCATGTCCA





GAGCTCATTC GAAGCAGATA





TTTCTGGATA TTGTCATAAA ACAATTTAGT





GAATTTATCA TCGTCCACTT





GAATCTGTGG TTCATTACGT CTTAACTCTT





CATATTTAGA AATGAGGCTG





ATGAGTTCCA TATTTGAAAA GTTTTCATCA





CTACTTAGTT TTTTGATAGC





TTCAAGCCAG AGTTGTCTTT TTCTATCTAC





TCTCATACAA CCAATAAATG





CTGAAATGAA TTCTAAGCGG AGATCGCCTA





GTGATTTTAA ACTATTGCTG





GCAGCATTCT TGAGTCCAAT ATAAAAGTAT





TGTGTACCTT TTGCTGGGTC





AGGTTGTTCT TTAGGAGGAG TAAAAGGATC





AAATGCACTA AACGAAACTG





AAACAAGCGA TCGAAAATAT CCCTTTGGGA





TTCTTGACTC GATAAGTCTA





TTATTTTCAG AGAAAAAATA TTCATTGTTT





TCTGGGTTGG TGATTGCACC





AATCATTCCA TTCAAAATTG TTGTTTTACC





ACACCCATTC CGCCCGATAA





AAGCATGAAT GTTCGTGCTG GGCATAGAAT





TAACCGTCAC CTCAAAAGGT





ATAGTTAAAT CACTGAATCC GGGAGCACTT





TTTCTATTAA ATGAAAAGTG





GAAATCTGAC AATTCTGGCA AACCATTTAA





CACACGTGCG AACTGTCCAT





GAATTTCTGA AAGAGTTACC CCTCTAAGTA





ATGAGGTGTT AAGGACGCTT





TCATTTTCAA TGTCGGCTAA TCGATTTGGC





CATACTACTA AATCCTGAAT





AGCTTTAAGA AGGTTATGTT TAAAACCATC





GCTTAATTTG CTGAGATTAA





CATAGTAGTC AATGCTTTCA CCTAAGGAAA





AAAACATTTC AGGGAGTTGA





CTGAATTTTT TATCTATTAA TGAATAAGTG





CTTACTTCTT CTTTTTGACC





TACAAAACCA ATTTTAACAT TTCCGATATC





GCATTTTTCA CCATGCTCAT





CAAAGACAGT AAGATAAAAC ATTGTAACAA





AGGAATAGTC ATTCCAACCA





TCTGCTCGTA GGAATGCCTT ATTTTTTTCT





ACTGCAGGAA TATACCCGCC





TCTTTCAATA ACACTAAACT CCAACATATA





GTAACCCTTA ATTTTATTAA





AATAACCGCA ATTTATTTGG CGGCAACACA





GGATCTCTCT TTTAAGTTAC





TCTCTATTAC ATACGTTTTC CATCTAAAAA





TTAGTAGTAT TGAACTTAAC





GGGGCATCGT ATTGTAGTTT TCCATATTTA





GCTTTCTGCT TCCTTTTGGA





TAACCCACTG TTATTCATGT TGCATGGTGC





ACTGTTTATA CCAACGATAT





AGTCTATTAA TGCATATATA GTATCGCCGA





ACGATTAGCT CTTCAGGCTT





CTGAAGAAGC GTTTCAAGTA CTAATAAGCC





GATAGATAGC CACGGACTTC





GTAGCCATTT TTCATAAGTG TTAACTTCCG





CTCCTCGCTC ATAACAGACA





TTCACTACAG TTATGGCGGA AAGGTATGCA





TGCTGGGTGT GGGGAAGTCG





TGAAAGAAAA GAAGTCAGCT GCGTCGTTTG





ACATCACTGC TATCTTCTTA





CTGGTTATGC AGGTCGTAGT GGGTGGCACA





CAAAGCTTTG CACTGGATTG





CGAGGCTTTG TGCTTCTCTG GAGTGCGACA





GGTTTGATGA CAAAAAATTA





GCGCAAGAAG ACAAAAATCA CCTTGCGCTA





ATGCTCTGTT ACAGGTCACT





AATACCATCT AAGTAGTTGA TTCATAGTGA





CTGCATATGT TGTGTTTTAC





AGTATTATGT AGTCTGTTTT TTATGCAAAA





TCTAATTTAA TATATTGATA





TTTATATCAT TTTACGTTTC TCGTTCAGCT





TTTTTATACT AAGTTGGCAT





TATAAAAAAG CATTGCTTAT CAATTTGTTG





CAACGAACAG GTCACTATCA





GTCAAAATAA AATCATTATT TGATTTCAAT





TTTGTCCCAC TCCCTGCCTC





TGTCATCACG ATACTGTGAT GCCATGGTGT





CCGACTTATG CCCGAGAAGA





TGTTGAGCAA ACTTATCGCT TATCTGCTTC





TCATAGAGTC TTGCAGACAA





ACTGCGCAAC TCGTGAAAGG TAGGCG













Fragment 5 (positions 27976-34499 of phage lambda)


GATCCCCTTC GAAGGAAAGA CCTGATGCTT





TTCGTGCGCG CATAAAATAC





CTTGATACTG TGCCGGATGA AAGCGGTTCG





CGACGAGTAG ATGCAATTAT





GGTTTCTCCG CCAAGAATCT CTTTGCATTT





ATCAAGTGTT TCCTTCATTG





ATATTCCGAG AGCATCAATA TGCAATGCTG





TTGGGATGGC AATTTTTACG





CCTGTTTTGC TTTGCTCGAC ATAAAGATAT





CCATCTACGA TATCAGACCA





CTTCATTTCG CATAAATCAC CAACTCGTTG





CCCGGTAACA ACAGCCAGTT





CCATTGCAAG TCTGAGCCAA CATGGTGATG





ATTCTGCTGC TTGATAAATT





TTCAGGTATT CGTCAGCCGT AAGTCTTGAT





CTCCTTACCT CTGATTTTGC





TGCGCGAGTG GCAGCGACAT GGTTTGTTGT





TATATGGCCT TCAGCTATTG





CCTCTCGGAA TGCATCGCTC AGTGTTGATC





TGATTAACTT GGCTGACGCC





GCCTTGCCCT CGTCTATGTA TCCATTGAGC





ATTGCCGCAA TTTCTTTTGT





GGTGATGTCT TCAAGTGGAG CATCAGGCAG





ACCCCTCCTT ATTGCTTTAA





TTTTGCTCAT GTAATTTATG AGTGTCTTCT





GCTTGATTCC TCTGCTGGCC





AGGATTTTTT CGTAGCGATC AAGCCATGAA





TGTAACGTAA CGGAATTATC





ACTGTTGATT CTCGCTGTCA GAGGCTTGTG





TTTGTGTCCT GAAAATAACT





CAATGTTGGC CTGTATAGCT TCAGTGATTG





CGATTCGCCT GTCTCTGCCT





AATCCAAACT CTTTACCCGT CCTTGGGTCC





CTGTAGCAGT AATATCCATT





GTTTCTTATA TAAAGGTTAG GGGGTAAATC





CCGGCGCTCA TGACTTCGCC





TTCTTCCCAT TTCTGATCCT CTTCAAAAGG





CCACCTGTTA CTGGTCGATT





TAAGTCAACC TTTACCGCTG ATTCGTGGAA





CAGATACTCT CTTCCATCCT





TAACCGGAGG TGGGAATATC CTGCATTCCC





GAACCCATCG ACGAACTGTT





TCAAGGCTTC TTGGACGTCG CTGGCGTGCG





TTCCACTCCT GAAGTGTCAA





GTACATCGCA AAGTCTCCGC AATTACACGC





AAGAAAAAAC CGCCATCAGG





CGGCTTGGTG TTCTTTCAGT TCTTCAATTC





GAATATTGGT TACGTCTGCA





TGTGCTATCT GCGCCCATAT CATCCAGTGG





TCGTAGCAGT CGTTGATGTT





CTCCGCTTCG ATAACTCTGT TGAATGGCTC





TCCATTCCAT TCTCCTGTGA





CTCGGAAGTG CATTTATCAT CTCCATAAAA





CAAAACCCGC CGTAGCGAGT





TCAGATAAAA TAAATCCCCG CGAGTGCGAG





GATTGTTATG TAATATTGGG





TTTAATCATC TATATGTTTT GTACAGAGAG





GGCAAGTATC GTTTCCACCG





TACTCGTGAT AATAATTTTG CACGGTATCA





GTCATTTCTC GCACATTGCA





GAATGGGGAT TTGTCTTCAT TAGACTTATA





AACCTTCATG GAATATTTGT





ATGCCGACTC TATATCTATA CCTTCATCTA





CATAAACACC TTCGTGATGT





CTGCATGGAG ACAAGACACC GGATCTGCAC





AACATTGATA ACGCCCAATC





TTTTTGCTCA GACTCTAACT CATTGATACT





CATTTATAAA CTCCTTGCAA





TGTATGTCGT TTCAGCTAAA CGGTATCAGC





AATGTTTATG TAAAGAAACA





GTAAGATAAT ACTCAACCCG ATGTTTGAGT





ACGGTCATCA TCTGACACTA





CAGACTCTGG CATCGCTGTG AAGACGACGC





GAAATTCAGC ATTTTCACAA





GCGTTATCTT TTACAAAACC GATCTCACTC





TCCTTTGATG CGAATGCCAG





CGTCAGACAT CATATGCAGA TACTCACCTG





CATCCTGAAC CCATTGACCT





CCAACCCCGT AATAGCGATG CGTAATGATG





TCGATAGTTA CTAACGGGTC





TTGTTCGATT AACTGCCGCA GAAACTCTTC





CAGGTCACCA GTGCAGTGCT





TGATAACAGG AGTCTTCCCA GGATGGCGAA





CAACAAGAAA CTGGTTTCCG





TCTTCACGGA CTTCGTTGCT TTCCAGTTTA





GCAATACGCT TACTCCCATC





CGAGATAACA CCTTCGTAAT ACTCACGCTG





CTCGTTGAGT TTTGATTTTG





CTGTTTCAAG CTCAACACGC AGTTTCCCTA





CTGTTAGCGC AATATCCTCG





TTCTCCTGGT CGCGGCGTTT GATGTATTGC





TGGTTTCTTT CCCGTTCATC





CAGCAGTTCC AGCACAATCG ATGGTGTTAC





CAATTCATGG AAAAGGTCTG





CGTCAAATCC CCAGTCGTCA TGCATTGCCT





GCTCTGCCGC TTCACGCAGT





GCCTGAGAGT TAATTTCGCT CACTTCGAAC





CTCTCTGTTT ACTGATAAGT





TCCAGATCCT CCTGGCAACT TGCACAAGTC





CGACAACCCT GAACGACCAG





GCGTCTTCGT TCATCTATCG GATCGCCACA





CTCACAACAA TGAGTGGCAG





ATATAGCCTG GTGGTTCAGG CGGCGCATTT





TTATTGCTGT GTTGCGCTGT





AATTCTTCTA TTTCTGATGC TGAATCAATG





ATGTCTGCCA TCTTTCATTA





ATCCCTGAAC TGTTGGTTAA TACGCTTGAG





GGTGAATGCG AATAATAAAA





AAGGAGCCTG TAGCTCCCTG ATGATTTTGC





TTTTCATGTT CATCGTTCCT





TAAAGACGCC GTTTAACATG CCGATTGCCA





GGCTTAAATG AGTCGGTGTG





AATCCCATCA GCGTTACCGT TTCGCGGTGC





TTCTTCAGTA CGCTACGGCA





AATGTCATCG ACGTTTTTAT CCGGAAACTG





CTGTCTGGCT TTTTTTGATT





TCAGAATTAG CCTGACGGGC AATGCTGCGA





AGGGCGTTTT CCTGCTGAGG





TGTCATTGAA CAAGTCCCAT GTCGGCAAGC





ATAAGCACAC AGAATATGAA





GCCCGCTGCC AGAAAAATGC ATTCCGTGGT





TGTCATACCT GGTTTCTCTC





ATCTGCTTCT GCTTTCGCCA CCATCATTTC





CAGCTTTTGT GAAAGGGATG





CGGCTAACGT ATGAAATTCT TCGTCTGTTT





CTACTGGTAT TGGCACAAAC





CTGATTCCAA TTTGAGCAAG GCTATGTGCC





ATCTCGATAC TCGTTCTTAA





CTCAACAGAA GATGCTTTGT GCATACAGCC





CCTCGTTTAT TATTTATCTC





CTCAGCCAGC CGCTGTGCTT TCAGTGGATT





TCGGATAACA GAAAGGCCGG





GAAATACCCA GCCTCGCTTT GTAACGGAGT





AGACGAAAGT GATTGCGCCT





ACCCGGATAT TATCGTGAGG ATGCGTCATC





GCCATTGCTC CCCAAATACA





AAACCAATTT CAGCCAGTGC CTCGTCCATT





TTTTCGATGA ACTCCGGCAC





GATCTCGTCA AAACTCGCCA TGTACTTTTC





ATCCCGCTCA ATCACGACAT





AATGCAGGCC TTCACGCTTC ATACGCGGGT





CATAGTTGGC AAAGTACCAG





GCATTTTTTC GCGTCACCCA CATGCTGTAC





TGCACCTGGG CCATGTAAGC





TGACTTTATG GCCTCGAAAC CACCGAGCCG





GAACTTCATG AAATCCCGGG





AGGTAAACGG GCATTTCAGT TCAAGGCCGT





TGCCGTCACT GCATAAACCA





TCGGGAGAGC AGGCGGTACG CATACTTTCG





TCGCGATAGA TGATCGGGGA





TTCAGTAACA TTCACGCCGG AAGTGAATTC





AAACAGGGTT CTGGCGTCGT





TCTCGTACTG TTTTCCCCAG GCCAGTGCTT





TAGCGTTAAC TTCCGGAGCC





ACACCGGTGC AAACCTCAGC AAGCAGGGTG





TGGAAGTAGG ACATTTTCAT





GTCAGGCCAC TTCTTTCCGG AGCGGGGTTT





TGCTATCACG TTGTGAACTT





CTGAAGCGGT GATGACGCCG AGCCGTAATT





TGTGCCACGC ATCATCCCCC





TGTTCGACAG CTCTCACATC GATCCCGGTA





CGCTGCAGGA TAATGTCCGG





TGTCATGCTG CCACCTTCTG CTCTGCGGCT





TTCTGTTTCA GGAATCCAAG





AGCTTTTACT GCTTCGGCCT GTGTCAGTTC





TGACGATGCA CGAATGTCGC





GGCGAAATAT CTGGGAACAG AGCGGCAATA





AGTCGTCATC CCATGTTTTA





TCCAGGGCGA TCAGCAGAGT GTTAATCTCC





TGCATGGTTT CATCGTTAAC





CGGAGTGATG TCGCGTTCCG GCTGACGTTC





TGCAGTGTAT GCAGTATTTT





CGACAATGCG CTCGGCTTCA TCCTTGTCAT





AGATACCAGC AAATCCGAAG





GCCAGACGGG CACACTGAAT CATGGCTTTA





TGACGTAACA TCCGTTTGGG





ATGCGACTGC CACGGCCCCG TGATTTCTCT





GCCTTCGCGA GTTTTGAATG





GTTCGCGGCG GCATTCATCC ATCCATTCGG





TAACGCAGAT CGGATGATTA





CGGTCCTTGC GGTAAATCCG GCATGTACAG





GATTCATTGT CCTGCTCAAA





GTCCATGCCA TCAAACTGCT GGTTTTCATT





GATGATGCGG GACCAGCCAT





CAACGCCCAC CACCGGAACG ATGCCATTCT





GCTTATCAGG AAAGGCGTAA





ATTTCTTTCG TCCACGGATT AAGGCCGTAC





TGGTTGGCAA CGATCAGTAA





TGCGATGAAC TGCGCATCGC TGGCATCACC





TTTAAATGCC GTCTGGCGAA





GAGTGGTGAT CAGTTCCTGT GGGTCGACAG





AATCCATGCC GACACGTTCA





GCCAGCTTCC CAGCCAGCGT TGCGAGTGCA





GTACTCATTC GTTTTATACC





TCTGAATCAA TATCAACCTG GTGGTGAGCA





ATGGTTTCAA CCATGTACCG





GATGTGTTCT GCCATGCGCT CCTGAAACTC





AACATCGTCA TCAAACGCAC





GGGTAATGGA TTTTTTGCTG GCCCCGTGGC





GTTGCAAATG ATCGATGCAT





AGCGATTCAA ACAGGTGCTG GGGCAGGCCT





TTTTCCATGT CGTCTGCCAG





TTCTGCCTCT TTCTCTTCAC GGGCGAGCTG





CTGGTAGTGA CGCGCCCAGC





TCTGAGCCTC AAGACGATCC TGAATGTAAT





AAGCGTTCAT GGCTGAACTC





CTGAAATAGC TGTGAAAATA TCGCCCGCGA





AATGCCGGGC TGATTAGGAA





AACAGGAAAG GGGGTTAGTG AATGCTTTTG





CTTGATCTCA GTTTCAGTAT





TAATATCCAT TTTTTATAAG CGTCGACGGC





TTCACGAAAC ATCTTTTCAT





CGCCAATAAA AGTGGCGATA GTGAATTTAG





TCTGGATAGC CATAAGTGTT





TGATCCATTC TTTGGGACTC CTGGCTGATT





AAGTATGTCG ATAAGGCGTT





TCCATCCGTC ACGTAATTTA CGGGTGATTC





GTTCAAGTAA AGATTCGGAA





GGGCAGCCAG CAACAGGCCA CCCTGCAATG





GCATATTGCA TGGTGTGCTC





CTTATTTATA CATAACGAAA AACGCCTCGA





GTGAAGCGTT ATTGGTATGC





GGTAAAACCG CACTCAGGCG GCCTTGATAG





TCATATCATC TGAATCAAAT





ATTCCTGATG TATCGATATC GGTAATTCTT





ATTCCTTCGC TACCATCCAT





TGGAGGCCAT CCTTCCTGAC CATTTCCATC





ATTCCAGTCG AACTCACACA





CAACACCATA TGCATTTAAG TCGCTTGAAA





TTGCTATAAG CAGAGCATGT





TGCGCCAGCA TGATTAATAC AGCATTTAAT





ACAGAGCCGT GTTTATTGAG





TCGGTATTCA GAGTCTGACC AGAAATTATT





AATCTGGTGA AGTTTTTCCT





CTGTCATTAC GTCATGGTCG ATTTCAATTT





CTATTGATGC TTTCCAGTCG





TAATCAATGA TGTATTTTTT GATGTTTGAC





ATCTGTTCAT ATCCTCACAG





ATAAAAAATC GCCCTCACAC TGGAGGGCAA





AGAAGATTTC CAATAATCAG





AACAAGTCGG CTCCTGTTTA GTTACGAGCG





ACATTGCTCC GTGTATTCAC





TCGTTGGAAT GAATACACAG TGCAGTGTTT





ATTCTGTTAT TTATGCCAAA





AATAAAGGCC ACTATCAGGC AGCTTTGTTG





TTCTGTTTAC CAAGTTCTCT





GGCAATCATT GCCGTCGTTC GTATTGCCCA





TTTATCGACA TATTTCCCAT





CTTCCATTAC AGGAAACATT TCTTCAGGCT





TAACCATGCA TTCCGATTGC





AGCTTGCATC CATTGCATCG CTTGAATTGT





CCACACCATT GATTTTTATC





AATAGTCGTA GTCATACGGA TAGTCCTGGT





ATTGTTCCAT CACATCCTGA





GGATGCTCTT CGAACTCTTC AAATTCTTCT





TCCATATATC ACCTTAAATA





GTGGATTGCG GTAGTAAAGA TTGTGCCTGT





CTTTTAACCA CATCAGGCTC





GGTGGTTCTC GTGTACCCCT ACAGCGAGAA





ATCGGATAAA CTATTACAAC





CCCTACAGTT TGATGAGTAT AGAAATG













Fragment 6 (positions 34503-41732 of phage lambda)


GATCCACTCG TTATTCTCGG ACGAGTGTTC





AGTAATGAAC CTCTGGAGAG





AACCATGTAT ATGATCGTTA TCTGGGTTGG





ACTTCTGCTT TTAAGCCCAG





ATAACTGGCC TGAATATGTT AATGAGAGAA





TCGGTATTCC TCATGTGTGG





CATGTTTTCG TCTTTGCTCT TGCATTTTCG





CTAGCAATTA ATGTGCATCG





ATTATCAGCT ATTGCCAGCG CCAGATATAA





GCGATTTAAG CTAAGAAAAC





GCATTAAGAT GCAAAACGAT AAAGTGCGAT





CAGTAATTCA AAACCTTACA





GAAGAGCAAT CTATGGTTTT GTGCGCAGCC





CTTAATGAAG GCAGGAAGTA





TGTGGTTACA TCAAAACAAT TCCCATACAT





TAGTGAGTTG ATTGAGCTTG





GTGTGTTGAA CAAAACTTTT TCCCGATGGA





ATGGAAAGCA TATATTATTC





CCTATTGAGG ATATTTACTG GACTGAATTA





GTTGCCAGCT ATGATCCATA





TAATATTGAG ATAAAGCCAA GGCCAATATC





TAAGTAACTA GATAAGAGGA





ATCGATTTTC CCTTAATTTT CTGGCGTCCA





CTGCATGTTA TGCCGCGTTC





GCCAGGCTTG CTGTACCATG TGCGCTGATT





CTTGCGCTCA ATACGTTGCA





GGTTGCTTTC AATCTGTTTG TGGTATTCAG





CCAGCACTGT AAGGTCTATC





GGATTTAGTG CGCTTTCTAC TCGTGATTTC





GGTTTGCGAT TCAGCGAGAG





AATAGGGCGG TTAACTGGTT TTGCGCTTAC





CCCAACCAAC AGGGGATTTG





CTGCTTTCCA TTGAGCCTGT TTCTCTGCGC





GACGTTCGCG GCGGCGTGTT





TGTGCATCCA TCTGGATTCT CCTGTCAGTT





AGCTTTGGTG GTGTGTGGCA





GTTGTAGTCC TGAACGAAAA CCCCCCGCGA





TTGGCACATT GGCAGCTAAT





CCGGAATCGC ACTTACGGCC AATGCTTCGT





TTCGTATCAC ACACCCCAAA





GCCTTCTGCT TTGAATGCTG CCCTTCTTCA





GGGCTTAATT TTTAAGAGCG





TCACCTTCAT GGTGGTCAGT GCGTCCTGCT





GATGTGCTCA GTATCACCGC





CAGTGGTATT TATGTCAACA CCGCCAGAGA





TAATTTATCA CCGCAGATGG





TTATCTGTAT GTTTTTTATA TGAATTTATT





TTTTGCAGGG GGGCATTGTT





TGGTAGGTGA GAGATCTGAA TTGCTATGTT





TAGTGAGTTG TATCTATTTA





TTTTTCAATA AATACAATTG GTTATGTGTT





TTGGGGGCGA TCGTGAGGCA





AAGAAAACCC GGCGCTGAGG CCGGGTTATT





CTTGTTCTCT GGTCAAATTA





TATAGTTGGA AAACAAGGAT GCATATATGA





ATGAACGATG CAGAGGCAAT





GCCGATGGCG ATAGTGGGTA TCATGTAGCC





GCTTATGCTG GAAAGAAGCA





ATAACCCGCA GAAAAACAAA GCTCCAAGCT





CAACAAAACT AAGGGCATAG





ACAATAACTA CCGATGTCAT ATACCCATAC





TCTCTAATCT TGGCCAGTCG





GCGCGTTCTG CTTCCGATTA GAAACGTCAA





GGCAGCAATC AGGATTGCAA





TCATGGTTCC TGCATATGAT GACAATGTCG





CCCCAAGACC ATCTCTATGA





GCTGAAAAAG AAACACCAGG AATGTAGTGG





CGGAAAAGGA GATAGCAAAT





GCTTACGATA ACGTAAGGAA TTATTACTAT





GTAAACACCA GGCATGATTC





TGTTCCGCAT AATTACTCCT GATAATTAAT





CCTTAACTTT GCCCACCTGC





CTTTTAAAAC ATTCCAGTAT ATCACTTTTC





ATTCTTGCGT AGCAATATGC





CATCTCTTCA GCTATCTCAG CATTGGTGAC





CTTGTTCAGA GGCGCTGAGA





GATGGCCTTT TTCTGATAGA TAATGTTCTG





TTAAAATATC TCCGGCCTCA





TCTTTTGCCC GCAGGCTAAT GTCTGAAAAT





TGAGGTGACG GGTTAAAAAT





AATATCCTTG GCAACCTTTT TTATATCCCT





TTTAAATTTT GGCTTAATGA





CTATATCCAA TGAGTCAAAA AGCTCCCCTT





CAATATCTGT TGCCCCTAAG





ACCTTTAATA TATCGCCAAA TACAGGTAGC





TTGGCTTCTA CCTTCACCGT





TGTTCGGCCG ATGAAATGCA TATGCATAAC





ATCGTCTTTG GTGGTTCCCC





TCATCAGTGG CTCTATCTGA ACGCGCTCTC





CACTGCTTAA TGACATTCCT





TTCCCGATTA AAAAATCTGT CAGATCGGAT





GTGGTCGGCC CGAAAACAGT





TCTGGCAAAA CCAATGGTGT CGCCTTCAAC





AAACAAAAAA GATGGGAATC





CCAATGATTC GTCATCTGCG AGGCTGTTCT





TAATATCTTC AACTGAAGCT





TTAGAGCGAT TTATCTTCTG AACCAGACTC





TTGTCATTTG TTTTGGTAAA





GAGAAAAGTT TTTCCATCGA TTTTATGAAT





ATACAAATAA TTGGAGCCAA





CCTGCAGGTG ATGATTATCA GCCAGCAGAG





AATTAAGGAA AACAGACAGG





TTTATTGAGC GCTTATCTTT CCCTTTATTT





TTGCTGCGGT AAGTCGCATA





AAAACCATTC TTCATAATTC AATCCATTTA





CTATGTTATG TTCTGAGGGG





AGTGAAAATT CCCCTAATTC GATGAAGATT





CTTGCTCAAT TGTTATCAGC





TATGCGCCGA CCAGAACACC TTGCCGATCA





GCCAAACGTC TCTTCAGGCC





ACTGACTAGC GATAACTTTC CCCACAACGG





AACAACTCTC ATTGCATGGG





ATCATTGGGT ACTGTGGGTT TAGTGGTTGT





AAAAACACCT GACCGCTATC





CCTGATCAGT TTCTTGAAGG TAAACTCATC





ACCCCCAAGT CTGGCTATGC





AGAAATCACC TGGCTCAACA GCCTGCTCAG





GGTCAACGAG AATTAACATT





CCGTCAGGAA AGCTTGGCTT GGAGCCTGTT





GGTGCGGTCA TGGAATTACC





TTCAACCTCA AGCCAGAATG CAGAATCACT





GGCTTTTTTG GTTGTGCTTA





CCCATCTCTC CGCATCACCT TTGGTAAAGG





TTCTAAGCTT AGGTGAGAAC





ATCCCTGCCT GAACATGAGA AAAAACAGGG





TACTCATACT CACTTCTAAG





TGACGGCTGC ATACTAACCG CTTCATACAT





CTCGTAGATT TCTCTGGCGA





TTGAAGGGCT AAATTCTTCA ACGCTAACTT





TGAGAATTTT TGTAAGCAAT





GCGGCGTTAT AAGCATTTAA TGCATTGATG





CCATTAAATA AAGCACCAAC





GCCTGACTGC CCCATCCCCA TCTTGTCTGC





GACAGATTCC TGGGATAAGC





CAAGTTCATT TTTCTTTTTT TCATAAATTG





CTTTAAGGCG ACGTGCGTCC





TCAAGCTGCT CTTGTGTTAA TGGTTTCTTT





TTTGTGCTCA TACGTTAAAT





CTATCACCGC AAGGGATAAA TATCTAACAC





CGTGCGTGTT GACTATTTTA





CCTCTGGCGG TGATAATGGT TGCATGTACT





AAGGAGGTTG TATGGAACAA





CGCATAACCC TGAAAGATTA TGCAATGCGC





TTTGGGCAAA CCAAGACAGC





TAAAGATCTC GGCGTATATC AAAGCGCGAT





CAACAAGGCC ATTCATGCAG





GCCGAAAGAT TTTTTTAACT ATAAACGCTG





ATGGAAGCGT TTATGCGGAA





GAGGTAAAGC CCTTCCCGAG TAACAAAAAA





ACAACAGCAT AAATAACCCC





GCTCTTACAC ATTCCAGCCC TGAAAAAGGG





CATCAAATTA AACCACACCT





ATGGTGTATG CATTTATTTG CATACATTCA





ATCAATTGTT ATCTAAGGAA





ATACTTACAT ATGGTTCGTG CAAACAAACG





CAACGAGGCT CTACGAATCG





AGAGTGCGTT GCTTAACAAA ATCGCAATGC





TTGGAACTGA GAAGACAGCG





GAAGCTGTGG GCGTTGATAA GTCGCAGATC





AGCAGGTGGA AGAGGGACTG





GATTCCAAAG TTCTCAATGC TGCTTGCTGT





TCTTGAATGG GGGGTCGTTG





ACGACGACAT GGCTCGATTG GCGCGACAAG





TTGCTGCGAT TCTCACCAAT





AAAAAACGCC CGGCGGCAAC CGAGCGTTCT





GAACAAATCC AGATGGAGTT





CTGAGGTCAT TACTGGATCT ATCAACAGGA





GTCATTATGA CAAATACAGC





AAAAATACTC AACTTCGGCA GAGGTAACTT





TGCCGGACAG GAGCGTAATG





TGGCAGATCT CGATGATGGT TACGCCAGAC





TATCAAATAT GCTGCTTGAG





GCTTATTCGG GCGCAGATCT GACCAAGCGA





CAGTTTAAAG TGCTGCTTGC





CATTCTGCGT AAAACCTATG GGTGGAATAA





ACCAATGGAC AGAATCACCG





ATTCTCAACT TAGCGAGATT ACAAAGTTAC





CTGTCAAACG GTGCAATGAA





GCCAAGTTAG AACTCGTCAG AATGAATATT





ATCAAGCAGC AAGGCGGCAT





GTTTGGACCA AATAAAAACA TCTCAGAATG





GTGCATCCCT CAAAACGAGG





GAAAATCCCC TAAAACGAGG GATAAAACAT





CCCTCAAATT GGGGGATTGC





TATCCCTCAA AACAGGGGGA CACAAAAGAC





ACTATTACAA AAGAAAAAAG





AAAAGATTAT TCGTCAGAGA ATTCTGGCGA





ATCCTCTGAC CAGCCAGAAA





ACGACCTTTC TGTGGTGAAA CCGGATGCTG





CAATTCAGAG CGGCAGCAAG





TGGGGGACAG CAGAAGACCT GACCGCCGCA





GAGTGGATGT TTGACATGGT





GAAGACTATC GCACCATCAG CCAGAAAACC





GAATTTTGCT GGGTGGGCTA





ACGATATCCG CCTGATGCGT GAACGTGACG





GACGTAACCA CCGCGACATG





TGTGTGCTGT TCCGCTGGGC ATGCCAGGAC





AACTTCTGGT CCGGTAACGT





GCTGAGCCCG GCCAAACTCC GCGATAAGTG





GACCCAACTC GAAATCAACC





GTAACAAGCA ACAGGCAGGC GTGACAGCCA





GCAAACCAAA ACTCGACCTG





ACAAACACAG ACTGGATTTA CGGGGTGGAT





CTATGAAAAA CATCGCCGCA





CAGATGGTTA ACTTTGACCG TGAGCAGATG





CGTCGGATCG CCAACAACAT





GCCGGAACAG TACGACGAAA AGCCGCAGGT





ACAGCAGGTA GCGCAGATCA





TCAACGGTGT GTTCAGCCAG TTACTGGCAA





CTTTCCCGGC GAGCCTGGCT





AACCGTGACC AGAACGAAGT GAACGAAATC





CGTCGCCAGT GGGTTCTGGC





TTTTCGGGAA AACGGGATCA CCACGATGGA





ACAGGTTAAC GCAGGAATGC





GCGTAGCCCG TCGGCAGAAT CGACCATTTC





TGCCATCACC CGGGCAGTTT





GTTGCATGGT GCCGGGAAGA AGCATCCGTT





ACCGCCGGAC TGCCAAACGT





CAGCGAGCTG GTTGATATGG TTTACGAGTA





TTGCCGGAAG CGAGGCCTGT





ATCCGGATGC GGAGTCTTAT CCGTGGAAAT





CAAACGCGCA CTACTGGCTG





GTTACCAACC TGTATCAGAA CATGCGGGCC





AATGCGCTTA CTGATGCGGA





ATTACGCCGT AAGGCCGCAG ATGAGCTTGT





CCATATGACT GCGAGAATTA





ACCGTGGTGA GGCGATCCCT GAACCAGTAA





AACAACTTCC TGTCATGGGC





GGTAGACCTC TAAATCGTGC ACAGGCTCTG





GCGAAGATCG CAGAAATCAA





AGCTAAGTTC GGACTGAAAG GAGCAAGTGT





ATGACGGGCA AAGAGGCAAT





TATTCATTAC CTGGGGACGC ATAATAGCTT





CTGTGCGCCG GACGTTGCCG





CGCTAACAGG CGCAACAGTA ACCAGCATAA





ATCAGGCCGC GGCTAAAATG





GCACGGGCAG GTCTTCTGGT TATCGAAGGT





AAGGTCTGGC GAACGGTGTA





TTACCGGTTT GCTACCAGGG AAGAACGGGA





AGGAAAGATG AGCACGAACC





TGGTTTTTAA GGAGTGTCGC CAGAGTGCCG





CGATGAAACG GGTATTGGCG





GTATATGGAG TTAAAAGATG ACCATCTACA





TTACTGAGCT AATAACAGGC





CTGCTGGTAA TCGCAGGCCT TTTTATTTGG





GGGAGAGGGA AGTCATGAAA





AAACTAACCT TTGAAATTCG ATCTCCAGCA





CATCAGCAAA ACGCTATTCA





CGCAGTACAG CAAATCCTTC CAGACCCAAC





CAAACCAATC GTAGTAACCA





TTCAGGAACG CAACCGCAGC TTAGACCAAA





ACAGGAAGCT ATGGGCCTGC





TTAGGTGACG TCTCTCGTCA GGTTGAATGG





CATGGTCGCT GGCTGGATGC





AGAAAGCTGG AAGTGTGTGT TTACCGCAGC





ATTAAAGCAG CAGGATGTTG





TTCCTAACCT TGCCGGGAAT GGCTTTGTGG





TAATAGGCCA GTCAACCAGC





AGGATGCGTG TAGGCGAATT TGCGGAGCTA





TTAGAGCTTA TACAGGCATT





CGGTACAGAG CGTGGCGTTA AGTGGTCAGA





CGAAGCGAGA CTGGCTCTGG





AGTGGAAAGC GAGATGGGGA GACAGGGCTG





CATGATAAAT GTCGTTAGTT





TCTCCGGTGG CAGGACGTCA GCATATTTGC





TCTGGCTAAT GGAGCAAAAG





CGACGGGCAG GTAAAGACGT GCATTACGTT





TTCATGGATA CAGGTTGTGA





ACATCCAATG ACATATCGGT TTGTCAGGGA





AGTTGTGAAG TTCTGGGATA





TACCGCTCAC CGTATTGCAG GTTGATATCA





ACCCGGAGCT TGGACAGCCA





AATGGTTATA CGGTATGGGA ACCAAAGGAT





ATTCAGACGC GAATGCCTGT





TCTGAAGCCA TTTATCGATA TGGTAAAGAA





ATATGGCACT CCATACGTCG





GCGGCGCGTT CTGCACTGAC AGATTAAAAC





TCGTTCCCTT CACCAAATAC





TGTGATGACC ATTTCGGGCG AGGGAATTAC





ACCACGTGGA TTGGCATCAG





AGCTGATGAA CCGAAGCGGC TAAAGCCAAA





GCCTGGAATC AGATATCTTG





CTGAACTGTC AGACTTTGAG AAGGAAGATA





TCCTCGCATG GTGGAAGCAA





CAACCATTCG ATTTGCAAAT ACCGGAACAT





CTCGGTAACT GCATATTCTG





CATTAAAAAA TCAACGCAAA AAATCGGACT





TGCCTGCAAA GATGAGGAGG





GATTGCAGCG TGTTTTTAAT GAGGTCATCA CGG













Fragment 7 (positions 41736-48502 of phage lambda)


GATCCCATGT GCGTGACGGA CATCGGGAAA





CGCCAAAGGA GATTATGTAC





CGAGGAAGAA TGTCGCTGGA CGGTATCGCG





AAAATGTATT CAGAAAATGA





TTATCAAGCC CTGTATCAGG ACATGGTACG





AGCTAAAAGA TTCGATACCG





GCTCTTGTTC TGAGTCATGC GAAATATTTG





GAGGGCAGCT TGATTTCGAC





TTCGGGAGGG AAGCTGCATG ATGCGATGTT





ATCGGTGCGG TGAATGCAAA





GAAGATAACC GCTTCCGACC AAATCAACCT





TACTGGAATC GATGGTGTCT





CCGGTGTGAA AGAACACCAA CAGGGGTGTT





ACCACTACCG CAGGAAAAGG





AGGACGTGTG GCGAGACAGC GACGAAGTAT





CACCGACATA ATCTGCGAAA





ACTGCAAATA CCTTCCAACG AAACGCACCA





GAAATAAACC CAAGCCAATC





CCAAAAGAAT CTGACGTAAA AACCTTCAAC





TACACGGCTC ACCTGTGGGA





TATCCGGTGG CTAAGACGTC GTGCGAGGAA





AACAAGGTGA TTGACCAAAA





TCGAAGTTAC GAACAAGAAA GCGTCGAGCG





AGCTTTAACG TGCGCTAACT





GCGGTCAGAA GCTGCATGTG CTGGAAGTTC





ACGTGTGTGA GCACTGCTGC





GCAGAACTGA TGAGCGATCC GAATAGCTCG





ATGCACGAGG AAGAAGATGA





TGGCTAAACC AGCGCGAAGA CGATGTAAAA





ACGATGAATG CCGGGAATGG





TTTCACCCTG CATTCGCTAA TCAGTGGTGG





TGCTCTCCAG AGTGTGGAAC





CAAGATAGCA CTCGAACGAC GAAGTAAAGA





ACGCGAAAAA GCGGAAAAAG





CAGCAGAGAA GAAACGACGA CGAGAGGAGC





AGAAACAGAA AGATAAACTT





AAGATTCGAA AACTCGCCTT AAAGCCCCGC





AGTTACTGGA TTAAACAAGC





CCAACAAGCC GTAAACGCCT TCATCAGAGA





AAGAGACCGC GACTTACCAT





GTATCTCGTG CGGAACGCTC ACGTCTGCTC





AGTGGGATGC CGGACATTAC





CGGACAACTG CTGCGGCACC TCAACTCCGA





TTTAATGAAC GCAATATTCA





CAAGCAATGC GTGGTGTGCA ACCAGCACAA





AAGCGGAAAT CTCGTTCCGT





ATCGCGTCGA ACTGATTAGC CGCATCGGGC





AGGAAGCAGT AGACGAAATC





GAATCAAACC ATAACCGCCA TCGCTGGACT





ATCGAAGAGT GCAAGGCGAT





CAAGGCAGAG TACCAACAGA AACTCAAAGA





CCTGCGAAAT AGCAGAAGTG





AGGCCGCATG ACGTTCTCAG TAAAAACCAT





TCCAGACATG CTCGTTGAAA





CATACGGAAA TCAGACAGAA GTAGCACGCA





GACTGAAATG TAGTCGCGGT





ACGGTCAGAA AATACGTTGA TGATAAAGAC





GGGAAAATGC ACGCCATCGT





CAACGACGTT CTCATGGTTC ATCGCGGATG





GAGTGAAAGA GATGCGCTAT





TACGAAAAAA TTGATGGCAG CAAATACCGA





AATATTTGGG TAGTTGGCGA





TCTGCACGGA TGCTACACGA ACCTGATGAA





CAAACTGGAT ACGATTGGAT





TCGACAACAA AAAAGACCTG CTTATCTCGG





TGGGCGATTT GGTTGATCGT





GGTGCAGAGA ACGTTGAATG CCTGGAATTA





ATCACATTCC CCTGGTTCAG





AGCTGTACGT GGAAACCATG AGCAAATGAT





GATTGATGGC TTATCAGAGC





GTGGAAACGT TAATCACTGG CTGCTTAATG





GCGGTGGCTG GTTCTTTAAT





CTCGATTACG ACAAAGAAAT TCTGGCTAAA





GCTCTTGCCC ATAAAGCAGA





TGAACTTCCG TTAATCATCG AACTGGTGAG





CAAAGATAAA AAATATGTTA





TCTGCCACGC CGATTATCCC TTTGACGAAT





ACGAGTTTGG AAAGCCAGTT





GATCATCAGC AGGTAATCTG GAACCGCGAA





CGAATCAGCA ACTCACAAAA





CGGGATCGTG AAAGAAATCA AAGGCGCGGA





CACGTTCATC TTTGGTCATA





CGCCAGCAGT GAAACCACTC AAGTTTGCCA





ACCAAATGTA TATCGATACC





GGCGCAGTGT TCTGCGGAAA CCTAACATTG





ATTCAGGTAC AGGGAGAAGG





CGCATGAGAC TCGAAAGCGT AGCTAAATTT





CATTCGCCAA AAAGCCCGAT





GATGAGCGAC TCACCACGGG CCACGGCTTC





TGACTCTCTT TCCGGTACTG





ATGTGATGGC TGCTATGGGG ATGGCGCAAT





CACAAGCCGG ATTCGGTATG





GCTGCATTCT GCGGTAAGCA CGAACTCAGC





CAGAACGACA AACAAAAGGC





TATCAACTAT CTGATGCAAT TTGCACACAA





GGTATCGGGG AAATACCGTG





GTGTGGCAAA GCTTGAAGGA AATACTAAGG





CAAAGGTACT GCAAGTGCTC





GCAACATTCG CTTATGCGGA TTATTGCCGT





AGTGCCGCGA CGCCGGGGGC





AAGATGCAGA GATTGCCATG GTACAGGCCG





TGCGGTTGAT ATTGCCAAAA





CAGAGCTGTG GGGGAGAGTT GTCGAGAAAG





AGTGCGGAAG ATGCAAAGGC





GTCGGCTATT CAAGGATGCC AGCAAGCGCA





GCATATCGCG CTGTGACGAT





GCTAATCCCA AACCTTACCC AACCCACCTG





GTCACGCACT GTTAAGCCGC





TGTATGACGC TCTGGTGGTG CAATGCCACA





AAGAAGAGTC AATCGCAGAC





AACATTTTGA ATGCGGTCAC ACGTTAGCAG





CATGATTGCC ACGGATGGCA





ACATATTAAC GGCATGATAT TGACTTATTG





AATAAAATTG GGTAAATTTG





ACTCAACGAT GGGTTAATTC GCTCGTTGTG





GTAGTGAGAT GAAAAGAGGC





GGCGCTTACT ACCGATTCCG CCTAGTTGGT





CACTTCGACG TATCGTCTGG





AACTCCAACC ATCGCAGGCA GAGAGGTCTG





CAAAATGCAA TCCCGAAACA





GTTCGCAGGT AATAGTTAGA GCCTGCATAA





CGGTTTCGGG ATTTTTTATA





TCTGCACAAC AGGTAAGAGC ATTGAGTCGA





TAATCGTGAA GAGTCGGCGA





GCCTGGTTAG CCAGTGCTCT TTCCGTTGTG





CTGAATTAAG CGAATACCGG





AAGCAGAACC GGATCACCAA ATGCGTACAG





GCGTCATCGC CGCCCAGCAA





CAGCACAACC CAAACTGAGC CGTAGCCACT





GTCTGTCCTG AATTCATTAG





TAATAGTTAC GCTGCGGCCT TTTACACATG





ACCTTCGTGA AAGCGGGTGG





CAGGAGGTCG CGCTAACAAC CTCCTGCCGT





TTTGCCCGTG CATATCGGTC





ACGAACAAAT CTGATTACTA AACACAGTAG





CCTGGATTTG TTCTATCAGT





AATCGACCTT ATTCCTAATT AAATAGAGCA





AATCCCCTTA TTGGGGGTAA





GACATGAAGA TGCCAGAAAA ACATGACCTG





TTGGCCGCCA TTCTCGCGGC





AAAGGAACAA GGCATCGGGG CAATCCTTGC





GTTTGCAATG GCGTACCTTC





GCGGCAGATA TAATGGCGGT GCGTTTACAA





AAACAGTAAT CGACGCAACG





ATGTGCGCCA TTATCGCCTA GTTCATTCGT





GACCTTCTCG ACTTCGCCGG





ACTAAGTAGC AATCTCGCTT ATATAACGAG





CGTGTTTATC GGCTACATCG





GTACTGACTC GATTGGTTCG CTTATCAAAC





GCTTCGCTGC TAAAAAAGCC





GGAGTAGAAG ATGGTAGAAA TCAATAATCA





ACGTAAGGCG TTCCTCGATA





TGCTGGCGTG GTCGGAGGGA ACTGATAACG





GACGTCAGAA AACCAGAAAT





CATGGTTATG ACGTCATTGT AGGCGGAGAG





CTATTTACTG ATTACTCCGA





TCACCCTCGC AAACTTGTCA CGCTAAACCC





AAAACTCAAA TCAACAGGCG





CCGGACGCTA CCAGCTTCTT TCCCGTTGGT





GGGATGCCTA CCGCAAGCAG





CTTGGCCTGA AAGACTTCTC TCCGAAAAGT





CAGGACGCTG TGGCATTGCA





GCAGATTAAG GAGCGTGGCG CTTTACCTAT





GATTGATCGT GGTGATATCC





GTCAGGCAAT CGACCGTTGC AGCAATATCT





GGGCTTCACT GCCGGGCGCT





GGTTATGGTC AGTTCGAGCA TAAGGCTGAC





AGCCTGATTG CAAAATTCAA





AGAAGCGGGC GGAACGGTCA GAGAGATTGA





TGTATGAGCA GAGTCACCGC





GATTATCTCC GCTCTGGTTA TCTGCATCAT





CGTCTGCCTG TCATGGGCTG





TTAATCATTA CCGTGATAAC GCCATTACCT





ACAAAGCCCA GCGCGACAAA





AATGCCAGAG AACTGAAGCT GGCGAACGCG





GCAATTACTG ACATGCAGAT





GCGTCAGCGT GATGTTGCTG CGCTCGATGC





AAAATACACG AAGGAGTTAG





CTGATGCTAA AGCTGAAAAT GATGCTCTGC





GTGATGATGT TGCCGCTGGT





CGTCGTCGGT TGCACATCAA AGCAGTCTGT





CAGTCAGTGC GTGAAGCCAC





CACCGCCTCC GGCGTGGATA ATGCAGCCTC





CCCCCGACTG GCAGACACCG





CTGAACGGGA TTATTTCACC CTCAGAGAGA





GGCTGATCAC TATGCAAAAA





CAACTGGAAG GAACCCAGAA GTATATTAAT





GAGCAGTGCA GATAGAGTTG





CCCATATCGA TGGGCAACTC ATGCAATTAT





TGTGAGCAAT ACACACGCGC





TTCCAGCGGA GTATAAATGC CTAAAGTAAT





AAAACCGAGC AATCCATTTA





CGAATGTTTG CTGGGTTTCT GTTTTAACAA





CATTTTCTGC GCCGCCACAA





ATTTTGGCTG CATCGACAGT TTTCTTCTGC





CCAATTCCAG AAACGAAGAA





ATGATGGGTG ATGGTTTCCT TTGGTGCTAC





TGCTGCCGGT TTGTTTTGAA





CAGTAAACGT CTGTTGAGCA CATCCTGTAA





TAAGCAGGGC CAGCGCAGTA





GCGAGTAGCA TTTTTTTCAT GGTGTTATTC





CCGATGCTTT TTGAAGTTCG





CAGAATCGTA TGTGTAGAAA ATTAAACAAA





CCCTAAACAA TGAGTTGAAA





TTTCATATTG TTAATATTTA TTAATGTATG





TCAGGTGCGA TGAATCGTCA





TTGTATTCCC GGATTAACTA TGTCCACAGC





CCTGACGGGG AACTTCTCTG





CGGGAGTGTC CGGGAATAAT TAAAACGATG





CACACAGGGT TTAGCGCGTA





CACGTATTGC ATTATGCCAA CGCCCCGGTG





CTGACACGGA AGAAACCGGA





CGTTATGATT TAGCGTGGAA AGATTTGTGT





AGTGTTCTGA ATGCTCTCAG





TAAATAGTAA TGAATTATCA AAGGTATAGT





AATATCTTTT ATGTTCATGG





ATATTTGTAA CCCATCGGAA AACTCCTGCT





TTAGCAAGAT TTTCCCTGTA





TTGCTGAAAT GTGATTTCTC TTGATTTCAA





CCTATCATAG GACGTTTCTA





TAAGATGCGT GTTTCTTGAG AATTTAACAT





TTACAACCTT TTTAAGTCCT





TTTATTAACA CGGTGTTATC GTTTTCTAAC





ACGATGTGAA TATTATCTGT





GGCTAGATAG TAAATATAAT GTGAGACGTT





GTGACGTTTT AGTTCAGAAT





AAAACAATTC ACAGTCTAAA TCTTTTCGCA





CTTGATCGAA TATTTCTTTA





AAAATGGCAA CCTGAGCCAT TGGTAAAACC





TTCCATGTGA TACGAGGGCG





CGTAGTTTGC ATTATCGTTT TTATCGTTTC





AATCTGGTCT GACCTCCTTG





TGTTTTGTTG ATGATTTATG TCAAATATTA





GGAATGTTTT CACTTAATAG





TATTGGTTGC GTAACAAAGT GCGGTCCTGC





TGGCATTCTG GAGGGAAATA





CAACCGACAG ATGTATGTAA GGCCAACGTG





CTCAAATCTT CATACAGAAA





GATTTGAAGT AATATTTTAA CCGCTAGATG





AAGAGCAAGC GCATGGAGCG





ACAAAATGAA TAAAGAACAA TCTGCTGATG





ATCCCTCCGT GGATCTGATT





CGTGTAAAAA ATATGCTTAA TAGCACCATT





TCTATGAGTT ACCCTGATGT





TGTAATTGCA TGTATAGAAC ATAAGGTGTC





TCTGGAAGCA TTCAGAGCAA





TTGAGGCAGC GTTGGTGAAG CACGATAATA





ATATGAAGGA TTATTCCCTG





GTGGTTGACT GATCACCATA ACTGCTAATC





ATTCAAACTA TTTAGTCTGT





GACAGAGCCA ACACGCAGTC TGTCACTGTC





AGGAAAGTGG TAAAACTGCA





ACTCAATTAC TGCAATGCCC TCGTAATTAA





GTGAATTTAC AATATCGTCC





TGTTCGGAGG GAAGAACGCG GGATGTTCAT





TCTTCATCAC TTTTAATTGA





TGTATATGCT CTCTTTTCTG ACGTTAGTCT





CCGACGGCAG GCTTCAATGA





CCCAGGCTGA GAAATTCCCG GACCCTTTTT





GCTCAAGAGC GATGTTAATT





TGTTCAATCA TTTGGTTAGG AAAGCGGATG





TTGCGGGTTG TTGTTCTGCG





GGTTCTGTTC TTCGTTGACA TGAGGTTGCC





CCGTATTCAG TGTCGCTGAT





TTGTATTGTC TGAAGTTGTT TTTACGTTAA





GTTGATGCAG ATCAATTAAT





ACGATACCTG CGTCATAATT GATTATTTGA





CGTGGTTTGA TGGCCTCCAC





GCACGTTGTG ATATGTAGAT GATAATCATT





ATCACTTTAC GGGTCCTTTC





CGGTGATCCG ACAGGTTACG






Sequences of Enzyme Components Used

The tag may be left on to permit purification of a Cas-polynucleotide target complex, or removed by TEV cleavage.










>Spy_Cas9_wild-type: wild-type Cas9 from Streptococcuspyogenes bearing



C-terminal Strep (II) tag


MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGET





AEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERH





PIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDL





NPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGE





KKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLF





LAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYK





EIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFD





NGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAW





MTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYN





ELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEI





SGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKT





YAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQL





IHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRH





KPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLY





LYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNV





PSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQIT





KHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHD





AYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMN





FFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQT





GGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSV





KELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAG





ELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEF





SKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRK





RYTSTKEVLDATLIHOSITGLYETRIDLSQLGGDGGSENLYFQGGSWSHPQFEKGGGSWSHPQFEK














>Spy_Cas9_D10A: Cas9 nickase from Streptococcuspyogenes bearing C-



terminal Strep (II) tag


MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGET





AEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERH





PIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDL





NPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGE





KKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLF





LAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYK





EIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFD





NGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAW





MTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYN





ELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEI





SGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKT





YAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQL





IHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRH





KPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLY





LYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNV





PSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQIT





KHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHD





AYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMN





FFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQT





GGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSV





KELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAG





ELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEF





SKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRK





RYTSTKEVLDATLIHOSITGLYETRIDLSQLGGDGGSENLYFQGGSWSHPQFEKGGGSWSHPQFEK














>Spy_Cas9_H840A: Cas9 nickase from Streptococcuspyogenes bearing C-



terminal Strep (II) tag


MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGET





AEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERH





PIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDL





NPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGE





KKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLF





LAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYK





EIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFD





NGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAW





MTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYN





ELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEI





SGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKT





YAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQL





IHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRH





KPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLY





LYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNV





PSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQIT





KHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHD





AYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMN





FFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQT





GGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSV





KELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAG





ELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEF





SKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRK





RYTSTKEVLDATLIHOSITGLYETRIDLSQLGGDGGSENLYFQGGSWSHFQFEKGGGSWSHPQFEK














>Spy_Cas9_D10A_H840A: dead Cas9 (‘dCas9’) from Streptococcuspyogenes



bearing C-terminal Strep (II) tag


Purified as ONLP11836.


MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGET





AEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERH





PIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDL





NPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGE





KKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLF





LAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYK





EIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFD





NGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAW





MTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYN





ELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEI





SGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKT





YAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQL





IHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRH





KPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLY





LYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNV





PSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQIT





KHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHD





AYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMN





FFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQT





GGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSV





KELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAG





ELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEF





SKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRK





RYTSTKEVLDATLIHOSITGLYETRIDLSQLGGDGGSENLYFQGGSWSHPQFEKGGGSWSHPQFEK














SK007 adapter comprises the below three sequences hybridised together




/5SpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3/







/iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3/







/iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3/







/iSpC3//iSpC3//iSpC3/GGCGTCTGCTTGGGTGTTTAACCTTTT







TTTTTT/iSp18//iSp18//iSp18//iSp18/AATGTACTTCGTTCAGT







TACGTATTGCT







/5Phos/GCAATAGGTAACTGAACGAAGT/iBNA-A//iBNA-meC/




/iBNA-A//iBNA-T//iBNA-T/TTTGAGGCGAGCGGTCAA







/5BNA-G//iBNA-G//iBNA-T//iBNA-T//iBNA-A/AACACCCAAGCAGACG




CCTT






Sequence SK43



/5//CholTEG/TTGACCGCTCGCCTC







Example 4

This Example describes a method for detection of a fragment containing a specific 20 nt target DNA polynucleotide sequence (“target”) from a mixture by direct detection of a target/probe complex, wherein the target DNA contacts CRISPR-Cas probe. In this Example, the “target” is positively identified by the unique signal given by the target/probe complex interacting with the Nanopore. In this case the pore is only big enough to admit a single strand of DNA (FIG. 14).


Materials and Methods

A 3.6 kb length of lambda DNA which was end repaired and dA tailed at both ends was ligated to SK007 adapter without helicase (ONLA 16389, top+ONLA19936, bottom+ONLA19750, blocker). This was then purified using SPRI beads as follows: 0.4 volume equivalents of AMPure XP SPRI magnetic beads (Beckman Coulter) were added to the mixture and the resultant mixture agitated for 5 min at 21° C. The magnetic beads were pelleted using a magnetic separator, the supernatant aspirated, and 100 μl of 50 mM Tris-Cl, 2.5 M NaCl, 20% PEG 8,000 (pH 7.5 at 25° C.) added to the beads while still on the rack, turning the pellet through 360° to wash the pellet on the rack. The beads were immediately pelleted once more and the supernatant aspirated, after which the tube was removed from the rack and 45 μl of a buffer containing of 25 mM Tris-Cl, 20 mM NaCl (pH 7.5 at 25° C.) was added to the beads to elute the DNA by incubation for 5 min at 21° C. The beads were pelleted using the magnetic separator, and the eluate retained. This is the “double-Y 3.6 kb”.


CRISPR RNA (“crRNA”) AR148 which has a sequence targeting a region the 3.6 kb lambda used previously, was hybridised with tracrRNA by annealing to 40 μM “Alt-R™” tracrRNA (purchased from IDT) in 10 mM Tris-Cl (pH 8.0), 1 mM EDTA, 100 mM NaCl from 65° C. to 25° C. at 1.0° C. per minute, resulting in a complex known as a “guide RNA”. CRISPR-dCas9 complexes were formed by incubating 100 nM “guide RNA” with 100 nM dCas9 (ONLP11836) in Cas9 binding buffer (20 mM HEPES-NaOH, 100 mM NaCl, 5 mM MgCl2, 0.1 mM EDTA, pH 6.5 at 25° C.) for 10 minutes at 21° C., yielding 100 nM of “CRISPR-dCas9 complex”.


0.5 μg of double-Y 3.6 kb was incubated with 50 μL of CRISPR-dCas9 complex for at least 10 minutes at 20° C. To this was then added 65 μL of 2× c17 buffer (1M KCl, 50 mM HEPES, pH8), 12.5 μL of ELB and di water to make the final volume up to 150 μL. This is the “chip sample”.


Electrical measurements were acquired from single CsgG nanopores inserted in block co-polymer in buffer at 37° C. (25 mM HEPES-KOH, 150 mM potassium ferrocyanide (11), 150 mM potassium ferricyanide (III), pH 8.0). After achieving a single pore inserted in the block co-polymer, buffer (2 mL, 25 mM HEPES-KOH, 150 mM potassium ferrocyanide (II), 150 mM potassium ferricyanide (III), pH 8.0) was flowed through the system to remove any excess CsgG nanopores. All subsequent steps were performed at 34° C. The cis compartment was equilibrated with 500 μl of 25 mM HEPES (pH 8.0), 500 mM KCl (known as “c17”), with 10 mins between each wash. 150 μl of chip sample was then added to the chip and data recorded at 100 mV at 34° C.


Results

When a CRISPR-dCas9 complex is not present, or when the CRISPR-dCas9 complex does not have a crRNA sequence that is present in the double-Y 3.6 kb, the signal obtained is characteristic of events at 60-80 pA that typically last <0.5s. FIGS. 33 and 34 show double-Y 3.6 kb without a CRISPR-dCas9 complex bound to it translocating through the pore.


When CRISPR-dCas9 complex is present but double-Y 3.6 kb is not, there are no events observed.


When a double-Y 3.6 kb is bound to a CRISPR-dCas9 complex which has a crRNA sequence that is found in the double-Y 3.6 kb as described above, the signal is dominated by long blocks at ˜60 pA. These blocks typically last for <<10s. Sometimes these events spontaneously return to the open pore current. These events have the same characteristic profile as those described above but have a new long static level in between the two Y-adapters.



FIGS. 14, FIG. 35 and FIG. 36 show the DNA translocating through the pore until the CRISPR-dCas9 complex reaches the pore, at which point the double-Y 3.6 kb pauses until the CRISPR-dCas9 complex is displaced by the force of the pore acting on it, at which point the double-Y 3.6 kb continues to translocate.


Example 5

This Example describes a method for detection of a fragment containing a specific 20 nucleotide target DNA polynucleotide sequence (“target”) from a mixture by direct detection of a target/probe complex, wherein the target DNA contacts CRISPR-Cas probe. In this example, the “target” is positively identified by the unique signal given by the target/probe complex interacting with the nanopore. In this case the pore is big enough to admit double stranded DNA with the probe attached (see FIG. 12).


Materials and Methods

A 3.6 kb length of lambda DNA was prepared and purified. This is the 3.6 kb.


CRISPR RNA (“crRNA”) AR148 which has a sequence targeting a region the 3.6 kb, was hybridised with tracrRNA by annealing to 40 μM “Alt-R™” tracrRNA (purchased from IDT) in 10 mM Tris-Cl (pH 8.0), 1 mM EDTA, 100 mM NaCl from 65° C. to 25° C. at 1.0° C. per minute, resulting in a complex known as a “guide RNA”. CRISPR-dCas9 complexes were formed by incubating 200 nM “guide RNA” with 200 nM dCas9 (ONLP11836) in Cas9 binding buffer (20 mM HEPES-NaOH, 100 mM NaCl, 5 mM MgCl2, 0.1 mM EDTA, pH 6.5 at 25° C.), for 10 minutes at 21° C., yielding 200 nM of CRISPR-dCas9 complex.


0.5 μg of 3.6 kb was incubated with 25 μL of CRISPR-dCas9 complex for at least 10 minutes at 20° C. To this was then added 25 μL of 2× 1M buffer (2M KCl, 50 mM HEPES, pH8). This is the chip sample.


Electrical measurements were acquired from a single 15 nm diameter SiN ALD pore formed by dielectric breakdown (but any pore with a diameter of >10 nM could have been used, for example solid state, protein, DNA origami or any other material). The cis and trans were at 1M KCl while the voltage was varied. After a period of pore characterisation with no sample, the volume of the cis compartment was replaced with the chip sample and measurements carried out at different voltages at 20° C.


Results

When a CRISPR-dCas9 complex is not present, or when the CRISPR-dCas9 complex does not have a crRNA sequence that is complementary to a DNA sequence in the 3.6 kb, the signal obtained is of a short lived current deflection as the 3.6 kb passes through the pore (FIG. 37). When a 3.6 kb is bound to a CRISPR-dCas9 complex which has a crRNA sequence that is complementary to a DNA sequence found in the 3.6 kb, as described above, the signal now has an additional sublevel that represents the CRISPR-dCas9 complex passing through the pore (FIG. 38). Where multiple CRISPR-dCas9 complexes are bound to the DNA, each complex causes a separate deflection to the current (FIG. 39). When the dCas is modified or decorated the signal changes as each complex passes through the pore (FIG. 40). The changes in signal positions of the current deflections caused by the complexes can be used to provide information about the polynucleotide (e.g. DNA).










Sequence information










AR148
AltR-CCGACCACGCCAGCAUAUCG-AltR






ONLA16389
/5SpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3/



/iSpC3/



/iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3/



/iSpC3/



/iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3//iSpC3/



/iSpC3/



GGCGTCTGCTTGGGTGTTTAACCTTTTTTTTTT/iSp18//iSp18//iSp18//iSp18/AA



TGTACTTCGTTCAGTTACGTATTGCT





ONLA19936
/5Phos/GCAATACGTAACTGAACGAAGT/iBNA-A//iBNA-MeC//iBNA-A//iBNA-



T//iBNA-T/TTTGAGGCGAGCGGTCAA





ONLA19750
/5BNA-G//iBNA-G//iBNA-T//iBNA-T//iBNA-A/AACACCCAAGCAGACGCCTT





AltR tracr
Purchased from IDT


Tether
/5Chol-TEG/TT/iSp18//iSp18//iSp18//iSp18/TTGACCGCTCGCCTC





3.6 kb
GCCATCAGATTGTGTTTGTTAGTCGCTGCCATCAGATTGTGTTTGTTAGTCGCTTTTTTTTTT



TGGAATTTTTTTTTTGGAATTTTTTTTTTGCGCTAACAACCTCCTGCCGTTTTGCCCGTGCATATCGGTC



ACGAACAAATCTGATTACTAAACACAGTAGCCTGGATTTGTTCTATCAGTAATCGACCTTATTCCTAATT



AAATAGAGCAAATCCCCTTATTGGGGGTAAGACATGAAGATGCCAGAAAAACATGACCTGTTGGCCGCCA



TTCTCGCGGCAAAGGAACAAGGCATCGGGGCAATCCTTGCGTTTGCAATGGCGTACCTTCGCGGCAGATA



TAATGGCGGTGCGTTTACAAAAACAGTAATCGACGCAACGATGTGCGCCATTATCGCCTAGTTCATTCGT



GACCTTCTCGACTTCGCCGGACTAAGTAGCAATCTCGCTTATATAACGAGCGTGTTTATCGGCTACATCG



GTACTGACTCGATTGGTTCGCTTATCAAACGCTTCGCTGCTAAAAAAGCCGGAGTAGAAGATGGTAGAAA



TCAATAATCAACGTAAGGCGTTCCTCGATATGCTGGCGTGGTCGGAGGGAACTGATAACGGACGTCAGAA



AACCAGAAATCATGGTTATGACGTCATTGTAGGCGGAGAGCTATTTACTGATTACTCCGATCACCCTCGC



AAACTTGTCACGCTAAACCCAAAACTCAAATCAACAGGCGCCGGACGCTACCAGCTTCTTTCCCGTTGGT



GGGATGCCTACCGCAAGCAGCTTGGCCTGAAAGACTTCTCTCCGAAAAGTCAGGACGCTGTGGCATTGCA



GCAGATTAAGGAGCGTGGCGCTTTACCTATGATTGATCGTGGTGATATCCGTCAGGCAATCGACCGTTGC



AGCAATATCTGGGCTTCACTGCCGGGCGCTGGTTATGGTCAGTTCGAGCATAAGGCTGACAGCCTGATTG



CAAAATTCAAAGAAGCGGGCGGAACGGTCAGAGAGATTGATGTATGAGCAGAGTCACCGCGATTATCTCC



GCTCTGGTTATCTGCATCATCGTCTGCCTGTCATGGGCTGTTAATCATTACCGTGATAACGCCATTACCT



ACAAAGCCCAGCGCGACAAAAATGCCAGAGAACTGAAGCTGGCGAACGCGGCAATTACTGACATGCAGAT



GCGTCAGCGTGATGTTGCTGCGCTCGATGCAAAATACACGAAGGAGTTAGCTGATGCTAAAGCTGAAAAT



GATGCTCTGCGTGATGATGTTGCCGCTGGTCGTCGTCGGTTGCACATCAAAGCAGTCTGTCAGTCAGTGC



GTGAAGCCACCACCGCCTCCGGCGTGGATAATGCAGCCTCCCCCCGACTGGCAGACACCGCTGAACGGGA



TTATTTCACCCTCAGAGAGAGGCTGATCACTATGCAAAAACAACTGGAAGGAACCCAGAAGTATATTAAT



GAGCAGTGCAGATAGAGTTGCCCATATCGATGGGCAACTCATGCAATTATTGTGAGCAATACACACGCGC



TTCCAGCGGAGTATAAATGCCTAAAGTAATAAAACCGAGCAATCCATTTACGAATGTTTGCTGGGTTTCT



GTTTTAACAACATTTTCTGCGCCGCCACAAATTTTGGCTGCATCGACAGTTTTCTTCTGCCCAATTCCAG



AAACGAAGAAATGATGGGTGATGGTTTCCTTTGGTGCTACTGCTGCCGGTTTGTTTTGAACAGTAAACGT



CTGTTGAGCACATCCTGTAATAAGCAGGGCCAGCGCAGTAGCGAGTAGCATTTTTTTCATGGTGTTATTC



CCGATGCTTTTTGAAGTTCGCAGAATCGTATGTGTAGAAAATTAAACAAACCCTAAACAATGAGTTGAAA



TTTCATATTGTTAATATTTATTAATGTATGTCAGGTGCGATGAATCGTCATTGTATTCCCGGATTAACTA



TGTCCACAGCCCTGACGGGGAACTTCTCTGCGGGAGTGTCCGGGAATAATTAAAACGATGCACACAGGGT



TTAGCGCGTACACGTATTGCATTATGCCAACGCCCCGGTGCTGACACGGAAGAAACCGGACGTTATGATT



TAGCGTGGAAAGATTTGTGTAGTGTTCTGAATGCTCTCAGTAAATAGTAATGAATTATCAAAGGTATAGT



AATATCTTTTATGTTCATGGATATTTGTAACCCATCGGAAAACTCCTGCTTTAGCAAGATTTTCCCTGTA



TTGCTGAAATGTGATTTCTCTTGATTTCAACCTATCATAGGACGTTTCTATAAGATGCGTGTTTCTTGAG



AATTTAACATTTACAACCTTTTTAAGTCCTTTTATTAACACGGTGTTATCGTTTTCTAACACGATGTGAA



TATTATCTGTGGCTAGATAGTAAATATAATGTGAGACGTTGTGACGTTTTAGTTCAGAATAAAACAATTC



ACAGTCTAAATCTTTTCGCACTTGATCGAATATTTCTTTAAAAATGGCAACCTGAGCCATTGGTAAAACC



TTCCATGTGATACGAGGGCGCGTAGTTTGCATTATCGTTTTTATCGTTTCAATCTGGTCTGACCTCCTTG



TGTTTTGTTGATGATTTATGTCAAATATTAGGAATGTTTTCACTTAATAGTATTGGTTGCGTAACAAAGT



GCGGTCCTGCTGGCATTCTGGAGGGAAATACAACCGACAGATGTATGTAAGGCCAACGTGCTCAAATCTT



CATACAGAAAGATTTGAAGTAATATTTTAACCGCTAGATGAAGAGCAAGCGCATGGAGCGACAAAATGAA



TAAAGAACAATCTGCTGATGATCCCTCCGTGGATCTGATTCGTGTAAAAAATATGCTTAATAGCACCATT



TCTATGAGTTACCCTGATGTTGTAATTGCATGTATAGAACATAAGGTGTCTCTGGAAGCATTCAGAGCAA



TTGAGGCAGCGTTGGTGAAGCACGATAATAATATGAAGGATTATTCCCTGGTGGTTGACTGATCACCATA



ACTGCTAATCATTCAAACTATTTAGTCTGTGACAGAGCCAACACGCAGTCTGTCACTGTCAGGAAAGTGG



TAAAACTGCAACTCAATTACTGCAATGCCCTCGTAATTAAGTGAATTTACAATATCGTCCTGTTCGGAGG



GAAGAACGCGGGATGTTCATTCTTCATCACTTTTAATTGATGTATATGCTCTCTTTTCTGACGTTAGTCT



CCGACGGCAGGCTTCAATGACCCAGGCTGAGAAATTCCCGGACCCTTTTTGCTCAAGAGCGATGTTAATT



TGTTCAATCATTTGGTTAGGAAAGCGGATGTTGCGGGTTGTTGTTCTGCGGGTTCTGTTCTTCGTTGACA



TGAGGTTGCCCCGTATTCAGTGTCGCTGATTTGTATTGTCTGAAGTTGTTTTTACGTTAAGTTGATGCAG



ATCAATTAATACGATACCTGCGTCATAATTGATTATTTGACGTGGTTTGATGGCCTCCACGCACGTTGTG



ATATGTAGATGATAATCATTATCACTTTACGGGTCCTTTCCGGTGAAAAAAAAGGTACCAAAAAAAACAT



CGTCGTGAGTAGTGAACCGTAAGC






Example 6

This Example describes a method for the detection of a specific polynucleotide in a complex background by nanopore sequencing following the enrichment of the target molecule. In this Example, the target DNA molecule is identified primarily by its sequence. The target molecule is separated from the background by means of a ‘pulldown’ via a capture moiety on the dCas9 molecule. The dCas9 binds preferably to the target molecule by means of a crRNA directed against the ribosomal 16S (rrs) genes of Escherichia coli. ‘Off-target’ effects are reduced by applying a thermal and salt stress to the bound dCas9 protein, coupled with a SPRI purification step to remove excess, unbound dCas9 before subsequent purification on a capture bead surface. The target DNA molecule is adapted for nanopore sequencing, and the dCas9 remains bound to its target until displaced by the enzyme loaded on the adapter.


The dCas9 carries a tracrRNA molecule bearing a 5′ DNA extension (sequence a of FIG. 41) that enables capture of the target molecule on a bead-capture oligonucleotide conjugate that bears a DNA sequence complementary to this extension (sequence a′ of FIG. 41). In this Example, the capture oligonucleotide is linked to the bead via a biotin moiety. In this Example, the non-target DNA is washed away, and target molecules remain bound to the bead. The target molecule is then adapted for nanopore sequencing by ligation to either or both of its free, dA-tailed ends, while the dCas9-target molecule is bound to the bead. The entire bead-target-RNP assembly is then delivered to a flowcell for sequencing. The assembly is brought to the wells of the flowcell by the application of a magnetic field placed underneath the flowcell, or can be allowed to settle by gravity. Sequencing is initiated by flowing an oligonucleotide cholesterol tether, which hybridizes to the adaptor ends, over the beads, which tethers the beads to the membrane. Alternatively, the cholesterol tether can be introduced into the membrane during a ‘flush’ step, before the bead-target conjugate is added to the flowcell.


Methods

An E. coli whole-genome library, ONLA18816 (NCBI Reference Sequence: NC_000913.3), was prepared by random fragmentation of E. coli high-molecular weight genomic DNA to a median size of ˜5.9 kb using a Covaris gTube following the manufacturer's instructions. This library was then end-repaired and dA-tailed using an NEB Ultra II kit, per the manufacturer's instructions. Following end-repair and dA-tailing, the fragmented genomic DNA was subjected to 0.4×SPRI purification and eluted from the SPRI beads in 0.1×TE.


200 nM DNA-extended tracrRNA (AR363) was added to a buffer containing 25 mM HEPES-NaOH (pH 8.0), 150 mM NaCl and 1 mM MgCl2 (known as dCas9 binding buffer). The tracrRNA was heated to 90° C. for 2 min and snap-cooled on wet ice, after which 100 nM dCas9 (ONLP12326) was added and the reaction incubated for 10 min at room temperature (˜21° C.). 250 nM crRNA (AR400) was then added to the reaction and incubated for a further 10 min at room temperature (˜21° C.). The final volume was 50 μL. This mixture was known as ribonucleotide-protein complexes (RNPs).


To form dCas9-target complexes, 500 ng (˜1.2 μL) of the genomic DNA from above (ONLA18816) was added to the RNPs and incubated for 20 min at room temperature. The mixture was then incubated at 55° C. for 5 min to remove dCas9 not bound to its intended target. The mixture was subjected to 1×SPRI purification as follows: 51 μL AMPure XP beads were added to the mixture, mixed by gentle resuspension, and incubated for 10 min at room temperature. The beads were pelleted using a magnetic separator, and washed twice with ˜250 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2.5 M NaCl, 20% (w/v) PEG-8000, and eluted by incubating the SPRI beads with 12.5 μL of a buffer comprising 40 mM CAPS (pH 10.0), 40 mM KCl for 5 min. The beads were pelleted once more and the supernatant, known as ‘SPRI eluate’, retained.


50 μg Solulink ‘Nanolink’ streptavidin magnetic beads (5 μL) were incubated with 2.5 μL of AR364 capture oligo in ˜120 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2 M NaCl, 1 mM EDTA, 0.05% (v/v) Tween-20 for ˜1 h with agitation. Unbound oligonucleotide was removed by washing the beads twice with the same buffer, pelleting the beads using a magnetic separator. This conjugate was known as ‘capture beads’.


dCas9-bound target molecules were bound to capture beads by incubating 12.5 μL of SPRI eluate with 10 μg capture beads (1 μL) and 65 μL Dynabeads kilobaseBINDER Binding Solution (Thermo Scientific Cat. #60101) for 20 min with agitation. The beads were subsequently washed three times with a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 150 mM NaCl. 1 mM EDTA, and once with a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 20 mM NaCl. Following this step, the beads were pelleted and the supernatant removed. This sample was known as ‘bead-target complex’.


Enzyme-loaded adaptors (tube ‘AMX D’) from Oxford Nanopore Technologies' 1D Sequencing Kit by Ligation (SQK-LSK108) were ligated to the bead-target complex by resuspending the pelleted beads from above with a ligation mix comprising 12.5 μL 2×LAQA1 buffer (a gift from New England Biolabs, Inc.). 7 μL nuclease-free water, 5 μL AMX 1D (part of SQK-LSK108), and 0.5 μL T4 DNA Ligase (NEB Cat. #M0202). The beads were incubated in the ligation mix with agitation for 10 min, pelleted, and washed once with ˜125 μL of a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 150 mM NaCl, 1 mM EDTA to remove free, unligated adapter. Following the wash, the beads were pelleted once more, and resuspended in 50 μL of RBF (a component of SQK-LSK108), diluted to Ix according to the manufacturer's instructions. This mixture was known as the loading sample.



FIG. 41 shows the expected appearance of the dCas9-crRNA-tracrRNA-target-bead conjugate, also known here as the loading sample.


An Oxford Nanopore MinION flowcell was primed with 800 μL 1×RBF containing 50 nM tether oligo pipetted via its inlet port, followed by a pause of 10 min, then 200 μL of the same mixture pipetted via its inlet port with the SpotON port open. The entire 50 μL of the loading sample was pipetted dropwise into the SpotON port and the fluid allowed to wick into the flowcell. MinION data collection was initiated immediately, and data were collected and analysed according to standard customer protocols.


Results


FIG. 42 shows data collected over a 6-hour sequencing run using the above protocol using an Oxford Nanopore Technologies MinION flowcell running the standard baseline sequencing script with MinKNOW 1.7.14 software. The single crRNA probe used in this pulldown, AR400, is expected to direct dCas9 to each of the seven 16S ribosomal gene sites listed in FIG. 42D, with one position, identified as position vii, bearing a single mismatch at position −2 relative to the PAM site, and another, identified as peak I, bearing a single mismatch at position −6 relative to the PAM site. Of the ˜4.6 Mb genome, ˜35 kb (˜0.76%) of the input DNA (7× the median read length, 5.9 kb) could be considered target. 92,942 sequencing reads were obtained from this run and placed through a standard basecalling and alignment analysis workflow. 85,126 reads could be mapped to the E. coli MG1655 genome (NC_000913.3), of which 62,943 (73.9%) mapped to within 3 median read lengths of each expected probe hybridisation position. Pileup of the sequencing reads yielded a coverage depth of 9,000-10,000× for each of positions i, ii, iii, iv, v and vi.


Materials
DNA and Oligonucleotides













Component



name
Sequence (Oligos are IDT codes)








E.coli

NCBI Reference Sequence: NC_000913.3


genomic



DNA, str.



K-12,



substr.



MG1655 as



ONLA18816






AR363
TACATTTAAGACCCTAATAT/iSp18/mA*mG*mCmAmUmAmGmCmA



rArGrUrUrArArArArUrArArGrGrCrUrArGrUrCrCrGrUrUrA



rUrCrArAmCmUmUmGmAmAmAmAmAmGmUmGmGmCmAmCmCmGmAmG



mUmCmGmGmUmGmCmU*mU*mU





AR364
/5Phos/ATATTAGGGTCTTAAATGTA/iSp18//iSp18//iSp18//3BioTEG/





Tether oligo
/5CholTEG/TT/iSp18//iSp18//iSp18//iSp18/TTGACCGCTCGCCTC





AR400
‘Alt-R’ Cas9 crRNA from Integrated DNA Technologies, Inc:



/AltR1/agaccaaagagggggacctt/AltR2/









Proteins










ONLP12326: S. pyogenes Cas9 D10A/H840A, C-terminal



Twin-Strep-tag with TEV-cleavable linker; bold, bracketed


shows the portion cleaved by TEV:


MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGET





AEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERH





PIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDL





NPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGE





KKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLF





LAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYK





EIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFD





NGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAW





MTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYN





ELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEI





SGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKT





YAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQL





IHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRH





KPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLY





LYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNV





PSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQIT





KHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHD





AYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMN





FFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQT





GGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSV





KELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAG





ELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEF





SKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRK





RYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDGGSENLYFQ[GSGGSAWSHPQFEK






GGGSGGGSGGGSAWSHPQFEK]







Example 7

This Example describes a method for the detection of a specific polynucleotide in a complex background by nanopore sequencing, following the enrichment of the target molecule. In this Example, the target DNA molecule is identified primarily by its sequence. The target molecule is separated from the background by means of a ‘pulldown’ via a capture moiety on the dCas9 molecule. The dCas9 binds preferably to the target molecule by means of acrRNA directed against the ribosomal 16S (rrs) genes of Escherichia coli. ‘Off-target’ effects are minimized by applying a thermal and salt stress to the dCas9 protein, followed by the purification and elution of dCas9-target complexes on a capture surface specific to the tracrRNA, and the transfer of the dCas9-target complexes to a second specific capture surface specific to the crRNA. The release of the target from the first ‘purification’ bead is effected by the phenomenon known as toehold displacement. The target DNA molecule is adapted for nanopore sequencing, and the dCas9 remains bound to its target until displaced by the enzyme loaded on the adapter.


The crRNA also bears a 3′ DNA extension used for capture of the target molecule on a bead, column or surface (sequence d of FIG. 44). The dCas9 also carries a tracrRNA molecule bearing a 5′ DNA extension (sequence a⋅c of FIG. 44) that enables capture of the target molecule on a ‘purification’ bead, column or surface. The target is first separated from non-target DNA by capture on beads bearing an oligonucleotide complementary to the DNA extension of the tracrRNA. Non-target DNA is washed away during this step. The target molecule is eluted from the bead by toehold displacement, via the addition of an oligonucleotide that competes for the binding to the bead with the DNA-extended tracrRNA molecule. Following elution of the target molecule, the target is bound to a second ‘delivery’ bead via the DNA extension on the crRNA. The target molecule is then adapted for nanopore sequencing by ligation to either or both of its free, dA-tailed ends, while the dCas9-target molecule is still bound to the bead. The entire bead-target-RNP assembly is then delivered to a flowcell for sequencing. The assembly is brought to the wells of the flowcell by the application of a magnetic field placed underneath the flowcell, or can be allowed to settle by gravity. Sequencing is initiated by flowing an oligonucleotide cholesterol tether, which hybridizes to the adaptor ends, over the beads, which tethers the beads to the membrane. Alternatively, the cholesterol tether can be introduced into the membrane during a ‘flush’ step, before the bead-target conjugate is added to the flowcell.


Methods

An E. coli whole-genome library, ONLA18816, was prepared by random fragmentation of E. coli high-molecular weight genomic DNA to a median size of ˜7 kb using a Covaris gTube, following the manufacturer's instructions. This library was then end-repaired and dA-tailed using an NEB Ultra II kit, per the manufacturer's instructions. The end-repaired, dA-tailed, fragmented genomic DNA was subjected to 0.4×SPRI purification and eluted from the SPRI beads in 0.1×TE.


200 nM DNA-extended tracrRNA (AR363) was added to a buffer containing 25 mM HEPES-NaOH (pH 8.0), 150 mM NaCl and 1 mM MgCl2 (known as dCas9 binding buffer, BB). The tracrRNA was heated to 90° C. for 2 min and snap-cooled on wet ice, after which 100 nM dCas9 (ONLP12326) was added and the reaction incubated for 10 min at room temperature (˜21° C.). 250 nM crRNA bearing a 3′ DNA extension (AR191) was then added to the reaction and incubated for a further 10 min at room temperature (−21° C.). The final volume was 50 μL. This mixture was known as ribonucleotide-protein complexes (RNPs).


To form dCas9-target complexes, 500 ng (˜1.2 μL) of the genomic DNA from above (ONLA18816) was added to the RNPs and incubated for 20 min at room temperature. The mixture was then incubated at 55° C. for 5 min to remove dCas9 not bound to its intended target. The mixture was subjected to 1×SPRI purification as follows: 51 μL AMPure XP beads were added to the mixture, mixed by gentle resuspension, and incubated for 10 min at room temperature. The beads were pelleted using a magnetic separator, and washed twice with ˜250 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2.5 M NaCl, 20% (w/v) PEG-8000, and eluted by incubating the SPRI beads with 12.5 μL of a buffer comprising 40 mM CAPS (pH 10.0), 40 mM KCl for 5 min. The beads were pelleted once more and the supernatant, known as ‘SPRI eluate’, retained.


50 μg Solulink ‘Nanolink’ streptavidin magnetic beads (5 μL) were incubated with 2.5 μL of AR667 capture oligo (comprising sequences a′-b′, and a 3′ biotin moiety) in a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2 M NaCl, 1 mM EDTA, 0.05% (v/v) Tween-20 for ˜1 h with agitation. Unbound oligonucleotide was removed by washing the beads twice with the same buffer, pelleting the beads using a magnetic separator. This conjugate was known as ‘purification beads’.


Oligonucleotides AR 132 and AR196 were hybridised using a PCR thermocycler by incubating 40 μM of each oligonucleotide in standard TE Buffer (10 mM Tris-Cl, 1 mM EDTA, pH 8.0)+200 mM NaCl, heating at 95° C. for 2 min, and cooling slowly to 25° C. over ˜2 h. 12.5 μL of this duplex DNA, bearing an overhang complementary to the DNA extension of the crRNA sequence, were incubated with 50 μg Solulink ‘Nanolink’ streptavidin magnetic beads (5 μL) in ˜120 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2 M NaCl, 1 mM EDTA, 0.05% (v/v) Tween-20 for ˜1 h with agitation. Unbound oligonucleotide was removed by washing the beads twice with the same buffer, pelleting the beads using a magnetic separator at each wash step. This conjugate was known as ‘delivery beads’.


dCas9-bound target molecules were bound to purification beads by incubating 12.5 μL of SPRI eluate with 50 μg purification beads and 67.5 μL Dynabeads kilobaseBINDER Binding Solution (Thermo Scientific Cat. #60101) for 20 min at room temperature with agitation. The beads were washed three times with a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 150 mM NaCl, 1 mM EDTA, and once with a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.). 20 mM NaCl. Following this step, the beads were pelleted and the supernatant removed. This sample was known as ‘purification bead-target complex’.


Following immobilisation of the target DNA-RNP complex, target DNA was eluted from the purification bead by the addition of 20 μL of a buffer containing 25 μM oligonucleotide AR668, bearing sequences a⋅b from FIG. 44. 20 mM Tris-Cl (pH 8.0), and 100 mM NaCl, for 10 min at room temperature, with gentle agitation. The eluate was retained as ‘purification bead eluate’.


The purification bead eluate was then immobilised on delivery beads by incubating the 20 μL of purification bead eluate with 1 μL of delivery beads, and 105 μL Dynabeads kilobaseBINDER Binding Solution (Thermo Scientific Cat. #60101) for 20 min with agitation. The beads were subsequently washed three times with a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 150 mM NaCl, 1 mM EDTA, and once with a buffer containing 50 mM Tris-Ci (pH 8.0 at 4° C.). 20 mM NaCl. Following this step, the beads were pelleted and the supernatant removed. This sample was known as ‘delivery bead-target complex’.


Enzyme-loaded adaptors (tube ‘AMX 1D’) from Oxford Nanopore Technologies' 1D Sequencing Kit by Ligation (SQK-LSK108) were ligated to the bead-target complex by resuspending the pelleted beads from above with a ligation mix comprising 12.5 μL 2×LAQA1 buffer (a gift from New England Biolabs, Inc.), 7 μL nuclease-free water, 5 μL AMX 1D (part of SQK-LSK108), and 0.5 μL T4 DNA Ligase (NEB Cat. #M0202). The beads were incubated in the ligation mix with agitation for 10 min, pelleted, and washed once with ˜125 μL of a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 150 mM NaCl, 1 mM EDTA. Following the wash, the beads were pelleted once more, and resuspended in 50 μL of RBF (a component of SQK-LSK108), diluted to 1× according to the manufacturer's instructions. This mixture was known as the loading sample.



FIG. 44 shows the sequential series of steps described in this example required to elute a target-bound dCas9 molecule from the purification bead using a toehold displacement oligonucleotide, and transfer to a second delivery bead for loading on an Oxford Nanopore MinION flow-cell.


An Oxford Nanopore MinION flowcell was primed with 800 μL 1×RBF containing 50 nM tether oligo pipetted via its inlet port, followed by a pause of 10 min, then 200 μL of the same mixture pipetted via its inlet port with the SpotON port open. The entire 50 μL of the loading sample was pipetted dropwise into the SpotON port and the fluid allowed to wick into the flowcell. MinION data collection was initiated immediately, and data were collected and analysed according to standard customer protocols.


Results


FIG. 45 shows the combinatorial effect of the heat stress, SPRI purification, purification bead binding, toehold displacement, and capture bead binding on the enrichment of E. coli 16S gene target from non-target E. coli DNA. The results are summarized in the Table below, which shows the % of reads on target.

















Heat
SPRI
Toehold
% on target







A
No
No
No
10.7%


B
No
Yes
No
29.5%


C
Yes
No
No
26.4%


D
Yes
Yes
No
48.4%


E
No
No
Yes
21.4%


F
No
Yes
Yes
30.0%


G
Yes
No
Yes
50.2%


H
Yes
Yes
Yes
76.1%









Specifically, FIG. 45, H demonstrates the additive effect of all three enrichment methods. The data of FIG. 45, H were collected over a 6-hour sequencing run using the above protocol using an Oxford Nanopore Technologies MinION flowcell running the standard baseline sequencing script with MinKNOW 1.7.14 software. The single crRNA probe used in this pulldown, AR191, is expected to direct dCas9 to each of the seven 16S ribosomal gene sites listed in FIG. 42D, with one position, identified as position vii, bearing a single mismatch at position −2 relative to the PAM site, and another, identified as peak I, bearing a single mismatch at position −6 relative to the PAM site. Of the ˜4.6 Mb genome, ˜36 kb (˜0.78%) of the input DNA (7× the median read length, 5.1 kb) could be considered target.


10,482 sequencing reads were obtained from this run and placed through a standard basecalling and alignment analysis workflow. 9,245 reads could be mapped to the E. coli MG1655 genome (NC_000913.3), of which 7,975 (76.1%) mapped to within 3 median read lengths of each expected probe hybridisation position. Pileup of the sequencing reads yielded a coverage depth of >1,000× for each of positions i, ii, iii, iv, v and vi.


Materials
DNA and Oligonucleotides













Component



name
Sequence (Oligos are IDT codes)








E.coli

NCBI Reference Sequence: NC_000913.3


genomic



DNA, str.



K-12,



substr.



MG1655 as



ONLA18816






AR363
TACATTTAAGACCCTAATAT/iSp18/mA*mG*mCmAmUmAmGmCmA



rArGrUrUrArArArArUrArArGrGrCrUrArGrUrCrCrGrUrUrA



rUrCrArAmCmUmUmGmAmAmAmAmAmGmUmGmGmCmAmCmCmGmAmG



mUmCmGmGmUmGmCmU*mU*mU





AR667
ATATTAGGGTCTTAAATAGCTCAGAAAAGAGTCATTGCA/iSp18//iSp18//iSp18//



3BioTEG/





AR668
TGCAATGACTCTTTTCTGA/iBNA-meC//iBNA-G//iBNA-T//iBNA-A//iBNA-



T//iBNA-T//iBNA-T/AAGACCCTAA/iBNA-T//iBNA-A/T





AR132
/5Phos/CGATCGTTCCGATCAGAACACAAAGATGTATTGCT





AR196
/5Phos/TGTTCTGATCGGAACGATCG/iSp18//iSp18//iSp18//3BioTEG/





Tether
/5CholTEG/TT/iSp18//iSp18//iSp18//iSp18/TTGACCGCTCGCCTC


oligo






AR191
/5Phos/rArGrArCrCrArArArGrArGrGrGrGrGrArCrCrU



rUrGrUrUrUrUrArGrArGrCrUrArUrGrCrUAGCAATACATCTTTG









Proteins

ONLP12326: S. pyogenes Cas9 D10A/H840A. C-terminal Twin-Strep-tag with TEV-cleavable linker; bold, bracketed shows the portion cleaved by TEV (sequence above).


Example 8

This Example describes a method for the detection of a specific polynucleotide in a complex background by nanopore sequencing, following the enrichment of the target molecule. In this Example, the target DNA molecule is identified primarily by its sequence. The target molecule is separated from the background by means of a ‘pulldown’ via a capture moiety on the dCas9 molecule. The dCas9 binds preferably to the target molecule by means of acrRNA directed against the ribosomal 16S (rrs) genes of Escherichia coli. The binding of off-target, i.e., mismatched, regions, is reduced by substituting dCas9 with an otherwise wild-type background for a mutant derivative of the dCas9 enzyme, known as ‘enhanced specificity dCas9’, and by applying a thermal and salt stress to the bound dCas9 protein, coupled with a SPRI purification step to remove excess, unbound dCas9 before subsequent purification on a capture bead surface. The target DNA molecule is adapted for nanopore sequencing, and the dCas9 remains bound to its target until displaced by the enzyme loaded on the adapter.


The dCas9 carries a tracrRNA molecule hearing a 5′ DNA extension (sequence a of FIG. 41) that enables capture of the target molecule on a bead-capture oligonucleotide conjugate that bears a DNA sequence complementary to this extension (sequence a′ of FIG. 41). In this Example, the capture oligonucleotide is linked to the bead via a biotin moiety. In this Example, the non-target DNA is washed away, and target molecules remain bound to the bead. The target molecule is then adapted for nanopore sequencing by ligation to either or both of its free, dA-tailed ends, while the dCas9-target molecule is bound to the bead. The entire bead-target-RNP assembly is then delivered to a flowcell for sequencing. The assembly is brought to the wells of the flowcell by the application of a magnetic field placed underneath the flowcell, or can be allowed to settle by gravity. Sequencing is initiated by flowing an oligonucleotide cholesterol tether, which hybridizes to the adaptor ends, over the beads, which tethers the beads to the membrane. Alternatively, the cholesterol tether can be introduced into the membrane during a ‘flush’ step, before the bead-target conjugate is added to the flowcell.


Methods

An E. coli whole-genome library, ONLA18816, was prepared by random fragmentation of E. coli high-molecular weight genomic DNA to a median size of ˜5.9 kb using a Covaris gTube, following the manufacturer's instructions. This library was then end-repaired and dA-tailed using an NEB Ultra II kit, per the manufacturer's instructions. Following end-repair and dA-tailing, the fragmented genomic DNA was subjected to 0.4×SPRI purification and eluted from the SPRI beads in 0.1×TE.


200 nM DNA-extended tracrRNA (AR363) was added to a buffer containing 25 mM HEPES-NaOH (pH 8.0), 150 mM NaCl and 1 mM MgCl2 (known as dCas9 binding buffer). The tracrRNA was heated to 90° C. for 2 min and snap-cooled on wet ice, after which 100 nM dCas9 with a wild-type (ONLP12326) or the ‘enhanced specificity’ dCas9 (ONLP12296) was added and the reaction incubated for 10 min at room temperature (−21° C.). 250 nM crRNA bearing a 3′ extension (extension not used here; AR191) was then added to the reaction and incubated for a further 10 min at room temperature (˜21° C.). The final volume was 50 μL. This mixture was known as ribonucleotide-protein complexes (RNPs).


To form dCas9-target complexes, 500 ng (˜1.2 μL) of the genomic DNA from above (ONLA18816) was added to the RNPs and incubated for 20 min at room temperature. The mixture was then incubated at 55° C. for 5 min to remove dCas9 not bound to its intended target. The mixture was subjected to 1×SPRI purification as follows: 51 μL AMPure XP beads were added to the mixture, mixed by gentle resuspension, and incubated for 10 min at room temperature. The beads were pelleted using a magnetic separator, and washed twice with −250 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2.5 M NaCl, 20% (w/v) PEG-8000, and eluted by incubating the SPRI beads with 12.5 μL of a buffer comprising 40 mM CAPS (pH 10.0), 40 mM KCl for 5 min. The beads were pelleted once more and the supernatant, known as ‘SPRI eluate’, retained.


50 μg Solulink ‘Nanolink’ streptavidin magnetic beads (5 μL) were incubated with 2.5 μL of AR364 capture oligo in ˜120 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2 M NaCl, 1 mM EDTA, 0.05% (v/v) Tween-20 for ˜1 h with agitation. Unbound oligonucleotide was removed by washing the beads twice with the same buffer, pelleting the beads using a magnetic separator. This conjugate was known as ‘capture beads’.


dCas9-bound target molecules were bound to capture beads by incubating 12.5 μL of SPRI eluate with 10 μg capture beads (1 μL) and 65 μL Dynabeads kilobaseBINDER Binding Solution (Thermo Scientific Cat. #60101) for 20 min with agitation. The beads were subsequently washed three times with a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 150 mM NaCl, 1 mM EDTA, and once with a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 20 mM NaCl. Following this step, the beads were pelleted and the supernatant removed. This sample was known as ‘bead-target complex’.


Enzyme-loaded adaptors (tube ‘AMX 1D’) from Oxford Nanopore Technologies' 1D Sequencing Kit by Ligation (SQK-LSK108) were ligated to the bead-target complex by resuspending the pelleted beads from above with a ligation mix comprising 12.5 μL 2×LAQA1 buffer (a gift from New England Biolabs, Inc.), 7 μL nuclease-free water, 5 μL AMX 1D (part of SQK-LSK108), and 0.5 μL T4 DNA Ligase (NEB Cat. #M0202). The beads were incubated in the ligation mix with agitation for 10 min, pelleted, and washed once with ˜125 μL of a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 150 mM NaCl, 1 mM EDTA to remove free, unligated adapter. Following the wash, the beads were pelleted once more, and resuspended in 50 μL of RBF (a component of SQK-LSK108), diluted to 1× according to the manufacturer's instructions. This mixture was known as the loading sample.



FIG. 41 shows the expected appearance of the dCas9-crRNA-tracrRNA-target-bead conjugate, also known here as the loading sample.


An Oxford Nanopore MinION flowcell was primed with 800 μL 1×RBF containing 50 nM tether oligo pipetted via its inlet port, followed by a pause of 10 min, then 200 μL of the same mixture pipetted via its inlet port with the SpotON port open. The entire 50 μL of the loading sample was pipetted dropwise into the SpotON port and the fluid allowed to wick into the flowcell. MinION data collection was initiated immediately, and data were collected and analysed according to standard customer protocols.


Results


FIG. 46 shows data collected over a 6-hour sequencing run using the above protocol using an Oxford Nanopore Technologies MinION flowcell running the standard baseline sequencing script with MinKNOW 1.7.14 software. The single crRNA probe used in this pulldown, AR191, is expected to direct dCas9 to each of the seven 16S ribosomal gene sites listed in FIG. 42, D, with one position, identified with letters C and D, bearing a single mismatch at position −2 relative to the PAM site. This position corresponds to peak vii as identified in FIG. 42, D. The ratio of the height of the largest peak to the mismatch peak identified as C or D was 3.33:1 and 9.45:1 for the wild-type dCas9 and ‘enhanced specificity’ dCas9 variants, respectively.


Materials
DNA and Oligonucleotides













Component



name
Sequence (Oligos are IDT codes)








E.coli

NCBI Reference Sequence: NC_000913.3


genomic



DNA, str.



K-12,



substr.



MG1655 as



ONLA18816






AR363
TACATTTAAGACCCTAATAT/iSp18/mA*mG*mCmAmUmAmGmCmA



rArGrUrUrArArArArUrArArGrGrCrUrArGrUrCrCrGrUrUrA



rUrCrArAmCmUmUmGmAmAmAmAmAmGmUmGmGmCmAmCmCmGmAmG



mUmCmGmGmUmGmCmU*mU*mU





AR364
/5Phos/ATATTAGGGTCTTAAATGTA/iSp18//iSp18//iSp18//3BioTEG/





Tether oligo
/5CholTEG/TT/iSp18//iSp18//iSp18//iSp18/TTGACCGCTCGCCTC





AR191
/5Phos/TArGrArCrCrArArArGrArGrGrGrGrGrArC



rCrUrUrGrUrUrUrUrArGrArGrCrUrArUrGrCrU



AGCAATACATCTTTG









Proteins

ONLP122%: S. pyogenes Cas9 D10A/H840A/K848A/K1003A/R 1060A, known as ‘enhanced specificity dCas9’: C-terminal Twin-Strep-tag with TEV-cleavable linker; bold, bracketed shows the portion cleaved by TEV (sequence above).


ONLP12326: S. pyogenes Cas9 D10A/H840A, C-terminal Twin-Strep-tag with TEV-cleavable linker; bold, bracketed shows the portion cleaved by TEV (sequence above).


Example 9

This Example describes a method for the detection of a specific polynucleotide in a complex background by nanopore sequencing, following the enrichment of the target molecule. In this Example, the target DNA molecule is identified primarily by its sequence, and the effects of catalytically active (‘live’, wild-type) and dead (D10A/H840A) Cas9 on read directionality bias were investigated. The directionality bias may be used to enrich for a specific read direction. The target molecule is separated from the background by means of a ‘pulldown’ via a capture moiety on the Cas9 molecule. Cas9 binds preferably to the target molecule by means of a crRNA directed against the ribosomal 16S (rrs) genes of Escherichia coli. ‘Off-target’ effects are reduced by applying a thermal and salt stress to the bound Cas9 protein, coupled with a SPRI purification step to remove excess, unbound Cas9 before subsequent purification on a capture bead surface. The target DNA molecule is adapted for nanopore sequencing, and the Cas9 remains bound to its target until displaced by the enzyme loaded on the adapter.


The Cas9 carries a tracrRNA molecule bearing a 5′ DNA extension (sequence a of FIG. 41) that enables capture of the target molecule on a bead-capture oligonucleotide conjugate that bears a DNA sequence complementary to this extension (sequence a′ of FIG. 41). In this Example, the capture oligonucleotide is linked to the bead via a biotin moiety. In this Example, the non-target DNA is washed away, and target molecules remain bound to the bead. The target molecule is then adapted for nanopore sequencing by ligation to either or both of its free, dA-tailed ends, while the Cas9-target molecule is bound to the bead. The entire bead-target-RNP assembly is then delivered to a flowcell for sequencing. The assembly is brought to the wells of the flowcell by the application of a magnetic field placed underneath the flowcell, or can be allowed to settle by gravity. Sequencing is initiated by flowing an oligonucleotide cholesterol tether, which hybridizes to the adaptor ends, over the beads, which tethers the beads to the membrane. Alternatively, the cholesterol tether can be introduced into the membrane during a ‘flush’ step, before the bead-target conjugate is added to the flowcell.


Catalytically active Cas9 would be expected to make a double-strand break at each of the target sites. If live Cas9 were to remain bound to only one side of the cut, as demonstrated by Sternberg et al., Nature 507, 62-67 (2014), then a significant directionality bias would be expected.


Methods

An E. coli whole-genome library, ONLA18816, was prepared by random fragmentation of E. coli high-molecular weight genomic DNA to a median size of ˜5.9 kb using a Covaris gTube, following the manufacturer's instructions. This library was then end-repaired and dA-tailed using an NEB Ultra II kit, per the manufacturer's instructions. Following end-repair and dA-tailing, the fragmented genomic DNA was subjected to 0.4×SPRI purification and eluted from the SPRI beads in 0.1×TE.


To form ribonucleotide-protein complexes with dead Cas9, 200 nM DNA-extended tracrRNA (AR363) was added to a buffer containing 25 mM HEPES-NaOH (pH 8.0), 150 mM NaCl and 1 mM MgCl2 (known as dCas9 binding buffer). The tracrRNA was heated to 90° C. for 2 min and snap-cooled on wet ice, after which 100 nM dCas9 (ONLP12326) was added and the reaction incubated for 10 min at room temperature (˜21° C.). 250 nM crRNA (AR400) was then added to the reaction and incubated for a further 10 min at room temperature (−21° C.). The final volume was 50 μL. This mixture was known as dead RNPs.


To form ribonucleotide-protein complexes with live Cas9, 200 nM DNA-extended tracrRNA (AR363) was added to a buffer containing 20 mM HEPES, 100 mM NaCl, 5 mM MgCl2, 0.1 mM EDTA, pH 6.5 @ 25° C., known as Cas9 cleavage buffer. The tracrRNA was heated to 90° C. for 2 min and snap-cooled on wet ice, after which 100 nM wild-type S. pyogenes Cas9 (New England Biolabs, Inc., Cat #M0386T) was added and the reaction incubated for 10 min at room temperature (˜21° C.). 250 nM crRNA (AR400) was then added to the reaction and incubated for a further 10 min at room temperature (˜21° C.). The final volume was 50 μL. This mixture was known as live RNPs.


To form Cas9-target complexes, 500 ng (˜1.2 μL) of the genomic DNA from above (ONLA18816) was added to the RNPs and incubated for 30 min at 30° C. (for dead RNPs) or for 30 min at 37° C. (for live RNPs). The mixture was then incubated at 55° C. for 5 min to remove Cas9 not bound to its intended target. The mixture was subjected to 1×SPRI purification as follows: 51 μL AMPure XP beads were added to the mixture, mixed by gentle resuspension, and incubated for 10 min at room temperature. The beads were pelleted using a magnetic separator, and washed twice with ˜250 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2.5 M NaCl, 20% (w/v) PEG-8000, and eluted by incubating the SPRI beads with 12.5 μL of a buffer comprising 40 mM CAPS (pH 10.0), 40 mM KCl for 5 min. The beads were pelleted once more and the supernatant, known as ‘SPRI eluate’, retained.


50 μg Solulink ‘Nanolink’ streptavidin magnetic beads (5 μL) were incubated with 2.5 μL of AR364 capture oligo in ˜120 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2 M NaCl. 1 mM EDTA, 0.05% (v/v) Tween-20 for ˜1 h with agitation. Unbound oligonucleotide was removed by washing the beads twice with the same buffer, pelleting the beads using a magnetic separator. This conjugate was known as ‘capture beads’.


Cas9-bound target molecules were bound to capture beads by incubating 12.5 μL of SPRI eluate with 10 μg capture beads (1 μL) and 65 μL Dynabeads kilobaseBiNDER Binding Solution (Thermo Scientific Cat. #60101) for 20 min with agitation. The beads were subsequently washed three times with a buffer containing 50 mM Tris-Ci (pH 8.0 at 4° C.), 150 mM NaCl, 1 mM EDTA, and once with a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 20 mM NaCl. Following this step, the beads were pelleted and the supernatant removed. This sample was known as ‘bead-target complex’.


Enzyme-loaded adaptors (tube ‘AMX 1D’) from Oxford Nanopore Technologies' I D Sequencing Kit by Ligation (SQK-LSK108) were ligated to the bead-target complex by resuspending the pelleted beads from above with a ligation mix comprising 12.5 μL 2×LAQA1 buffer (a gift from New England Biolabs, Inc.), 7 μL nuclease-free water, 5 μL AMX 1D (part of SQK-LSK108), and 0.5 μL T4 DNA Ligase (NEB Cat. #M0202). The beads were incubated in the ligation mix with agitation for 10 min, pelleted, and washed once with ˜125 μL of a buffer containing 50 mM Tris-Ci (pH 8.0 at 4° C.). 150 mM NaCl, 1 mM EDTA to remove free, unligated adapter. Following the wash, the beads were pelleted once more, and resuspended in 50 μL of RBF (a component of SQK-LSK108), diluted to 1× according to the manufacturer's instructions. This mixture was known as the loading sample.



FIG. 41 shows the expected appearance of the Cas9-crRNA-tracrRNA-target-bead conjugate, also known here as the loading sample.


An Oxford Nanopore MinION flowcell was primed with 800 μL 1×RBF containing 50 nM tether oligo pipetted via its inlet port, followed by a pause of 10 min, then 200 μL of the same mixture pipetted via its inlet port with the SpotON port open. The entire 50 μL of the loading sample was pipetted dropwise into the SpotON port and the fluid allowed to wick into the flowcell. MinION data collection was initiated immediately, and data were collected and analysed according to standard customer protocols.


Results


FIG. 47 shows data collected over a 6-hour sequencing run using the above protocol using an Oxford Nanopore Technologies MinION flowcell running the standard baseline sequencing script with MinKNOW 1.7.14 software, with either catalytically-dead Cas9 (‘dead’, A) or live Cas9 (‘live’, B) used in the pulldown. The single crRNA probe used in this pulldown, AR400, is expected to direct Cas9 to each of the seven 16S ribosomal gene sites listed in FIG. 42, D. An additional peak, *, is also seen, attributable to the elevated incubation temperature in this example. Coverage directionality plots for the ‘dead’ and ‘live’ Cas9, identified as C and D respectively, demonstrate the slight additional directionality bias imposed by live Cas9.


Materials
DNA and Oligonucleotides













Component



name
Sequence (Oligos are IDT codes)







E. coli
NCBI Reference Sequence: NC_000913.3


genomic



K-12,



substr.



MG1655 as



ONLA18816






AR363
TACATTTAAGACCCTAATAT/iSp18/mA*mG*mCmAmUmAmGmCmA



rUrCrArAmCmUmUmGmAmAmAmAmAmGmUmGmGmCmAmCmCmGmAmG



mUmCmGmGmUmGmCmU*mU*mU





AR364
/5Phos/ATATTAGGGTCTTAAATGTA/iSp18//iSp18//iSp18//3BioTEG/





Tether oligo
/5CholTEG/TT/iSp18//iSp18//iSp18//iSp18/TTGACCGCTCGCCTC





AR400
‘Alt-R’ Cas9 crRNA from Integrated DNA Technologies, Inc:



/AltR1/agaccaaagagggggacctt/AltR2/









Proteins

ONLP12326: S. pyogenes Cas9 D10A/H840A. C-terminal Twin-Strep-tag with TEV-cleavable linker; bold, bracketed shows the portion cleaved by TEV (sequence above).


Example 10

This Example describes a method for multiplexing the detection of a mixture of specific polynucleotides in a complex background by nanopore sequencing, following the enrichment of the target molecules. In this example, the same E. coli total genomic sample was subjected to multiple, separate enrichment dCas9 ‘pulldowns’ involving different combinations of crRNA probes. Each sample was ligated with a specific DNA barcode adapter sequence, enabling all samples to be sequenced simultaneously using the same flowcell, and identified using their barcode adapter.


Methods

An E. coli whole-genome library, ONLA18816, was prepared by random fragmentation of E. coli high-molecular weight genomic DNA to a median size of ˜5.9 kb using a Covaris gTube, following the manufacturer's instructions. This library was then end-repaired and dA-tailed using an NEB Ultra II kit, per the manufacturer's instructions. Following end-repair and dA-tailing, the fragmented genomic DNA was subjected to 0.4×SPRI purification and eluted from the SPRI beads in 0.1×TE. 500 ng of this library was then ligated to each of seven native barcode (NB) adapters, NB01, NB02, NB03, NB04, NB05, NB06 and NB07, from Oxford Nanopore Technologies' Native Barcoding Kit ID (Cat #EXP-NBD103), according to the manufacturer's instructions.


Seven samples were prepared individually, each with a different combination of crRNA probes, as follows: 220 nM DNA-extended tracrRNA (AR363) was added to a buffer containing 50 mM Tris-Cl (pH 8.0), 150 mM NaCl and 1 mM EDTA (known as dCas9-EDTA buffer). 100 nM dCas9 (ONLP12326) was added and the reaction incubated for 10 min at room temperature (˜21° C.). 200 nM crRNA (total) was then added to the reaction and incubated for a further 10 min at room temperature (˜21° C.). The final volume was 50 μL. The combinations of crRNAs were as follows: (NB01) AR398, (NB02) AR399, (NB03) AR400, (NB04) AR398 and AR399, (NB05) AR398 and AR400, (NB06) AR399 and AR400, (NB07) AR398, AR399 and AR400. These seven mixtures were known as ribonucleotide-protein complexes (RNPs).


Each of the three crRNA probes used in this example target unique regions of the E. coli chromosome, according to the table below:














crRNA
Target
Target gene locations in


probe
gene name

E.
coli chromosome (bp)








AR398
ftsK
  937,211 


AR399
csgG
1,099,778 


AR400
Seven 16S
  224,037; 2,700,448;



ribosomal
3,380,179; 3,893,622;



genes (rrs)
3,987,345; 4,118,473;




4,159,961.









To form RNP-target complexes, 500 ng of the genomic DNA carrying each barcode from above (ONLA18816) was added, separately, to each mixture of RNPs (NB01 to NB07; seven in total) and incubated for 20 min at room temperature. Each mixture was then incubated at 55° C. for 5 min to remove dCas9 not bound to its intended target. The mixtures were subjected to 1×SPRI purification as follows: ˜50 μL AMPure XP beads were added to the mixture, mixed by gentle resuspension, and incubated for 10 min at room temperature. At this point, all seven samples were combined into a single tube. The beads were pelleted using a magnetic separator, and washed twice with ˜1 mL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2.5 M NaCl, 20% (w/v) PEG-8000, and eluted by incubating the SPRI beads with 12.5 μL of a buffer comprising 40 mM CAPS (pH 10.0), 40 mM KCl for 5 min. The beads were pelleted once more and the supernatant, known as ‘SPRI eluate’, retained. 50 μg Solulink ‘Nanolink’ streptavidin magnetic beads (5 μL) were incubated with 2.5 μL of AR364 capture oligo in ˜120 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2 M NaCl, 1 mM EDTA, 0.05% (v/v) Tween-20 for ˜1 h with agitation. Unbound oligonucleotide was removed by washing the beads twice with the same buffer, pelleting the beads using a magnetic separator. This conjugate was known as ‘capture beads’.


dCas9-bound target molecules were bound to capture beads by incubating 12.5 μL of SPRI eluate with 30 μg capture beads (1 μL) and 65 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2 M NaCl, 1 mM EDTA, 0.05% (v/v) Tween-20 for 20 min with agitation. The beads were subsequently washed three times with a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 150 mM NaCl, 1 mM EDTA. Following this step, the beads were pelleted and the supernatant removed. This sample was known as ‘barcoded bead-target complexes’.


Enzyme-loaded adapter mix (tube ‘BAM’) from Oxford Nanopore Technologies' Native Barcoding Kit 1D (EXP-NBD103) was ligated to the barcoded bead-target complexes by resuspending the pelleted beads from above with a ligation mix comprising 12.5 μL 2× Blunt/TA Ligase Master Mix (New England Biolabs, Inc., Cat #M0367), 5 μL BAM (Oxford Nanopore Technologies, Ltd., kit EXP-NBD103), and 7.5 μL nuclease-free water for 10 min at room temperature, pelleted, and washed once with ˜125 μL of a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 150 mM NaCl, 1 mM EDTA to remove free, unligated adapter. Following the wash, the beads were pelleted once more, and resuspended in 50 μL of RBF (a component of SQK-LSK108), diluted to 1× according to the manufacturer's instructions. This mixture was known as the barcoded loading sample.



FIG. 48, A shows the expected appearance of the dCas9-crRNA-tracrRNA-target-bead conjugate, with ligated barcode adapter, also known here as the barcoded loading sample. The sample is similar to that shown in FIG. 41, except for the presence of a barcode adapter sequence between target and enzyme-loaded adapter, which (besides the target sequence) identifies the sample.


An Oxford Nanopore MinION flowcell was primed with 800 μL 1×RBF containing 50 nM tether oligo pipetted via its inlet port, followed by a pause of 10 min, then 200 μL of the same mixture pipetted via its inlet port with the SpotON port open. The entire 50 μL of the barcoded loading sample was pipetted dropwise into the SpotON port and the fluid allowed to wick into the flowcell. MinION data collection was initiated immediately, and data were collected and analysed according to standard customer workflows for Oxford Nanopore Technologies' Native Barcoding Kits.


Results


FIG. 48, D shows coverage plots from reads aligned to the E. coli genome, collected over a 6-hour sequencing run using the above multiplexing protocol. The sample was run on a single Oxford Nanopore Technologies MinION flowcell running the standard baseline sequencing script with MinKNOW 1.7.14 software and analysed using Oxford Nanopore Technologies workflows appropriate for the Native Barcoding Kit used.


Each barcode, NB01-NB07, is associated with the pulldown of a specific region of the E. coli sequence according to the table below. The coverage plots of FIG. 48, D show the successful deconvolution of the barcode sequence for each specific target region.
















Barcode
Probe(s)
Intended targets








NB01
AR398
ftsK



NB02
AR399
csgG



NB03
AR400
rrs genes



NB04
AR398
ftsK, csgG




AR399




NB05
AR398
ftsK, rrs genes




AR400




NB06
AR399
csgG, rrsB




AR400




NB07
AR398
ftsK, csgG, rrs genes




AR399





AR400









Materials
DNA and Oligonucleotides













Component



name
Sequence (Oligos are IDT codes)








E.coli

NCBI Reference Sequence: NC_000913.3


genomic



DNA, str.



K-12,



substr.



MG1655 as



ONLA18816






AR363
TACATTTAAGACCCTAATAT/iSp18/mA*mG*mCmAmUmAmGmCmA



rArGrUrUrArArArArUrArArGrGrCrUrArGrUrCrCrGrUrUrA



rUrCrArAmCmUmUmGmAmAmAmAmAmGmUmGmGmCmAmCmCmGmAmG



mUmCmGmGmUmGmCmU*mU*mU





AR364
/5Phos/ATATTAGGGTCTTAAATGTA/iSp18//iSp18//iSp18//3BioTEG/





Tether oligo
/5CholTEG/TT/iSp18//iSp18//iSp18//iSp18/TTGACCGCTCGCCTC





AR398
‘Alt-R’ Cas9 crRNA from Integrated DNA Technologies, Inc:



/AltR1/tagatgatcaacgtaagtag/AltR2/





AR399
‘Alt-R’ Cas9 crRNA from Integrated DNA Technologies, Inc:



/AltR1/ggatgggtggctgtttccct/AltR2/





AR400
‘Alt-R’ Cas9 crRNA from Integrated DNA Technologies, Inc:



/AltR1/agaccaaagagggggacctt/AltR2/









Proteins

ONLP12326: S. pyogenes Cas9 D10A/H840A, C-terminal Twin-Strep-tag with TEV-cleavable linker; bold, bracketed shows the portion cleaved by TEV (sequence above).


Example 11

This Example describes a method for the detection of a specific polynucleotide in a complex background by nanopore sequencing, following the enrichment of the target molecule. In this Example, the target DNA molecule is identified primarily by its sequence. The target molecule is separated from the background by means of a ‘pulldown’ via a capture moiety on the dCas9 molecule. The dCas9 binds preferably to the target molecule by means of a crRNA directed against the ribosomal 16S (rrs) genes of Escherichia coli. ‘Off-target’ effects are reduced by applying a thermal and salt stress to the bound dCas9 protein, coupled with a SPRI purification step to remove excess, unbound dCas9 before subsequent capture on a bead surface.


In this Example, the DNA analyte may be adapted in different ways while bound to the capture beads: either (1) high-molecular weight genomic DNA may be sheared, end-repaired, dA-tailed, and ligated to an adapter using appropriate ends; or (2) high-molecular weight DNA may be concomitantly sheared and adapted using a transposase system such as that employed by the Oxford Nanopore Technologies Rapid 1D Sequencing Kit (SQK-RAD003). The adapter may permit other chemistries to be performed on the captured analyte while on the bead, while excess components such as free adapters are washed away. As examples, the analyte may be adapted for Oxford Nanopore Technologies' 1D2 technology by ligating an appropriate adapter chemistry before ligating the enzyme adapter. Alternatively, adapters may be ligated that permit the amplification of the captured target by PCR, and release of the captured analyte from the bead.


Except for the example in which the captured target is released by PCR, the entire bead-target-RNP assembly is delivered to a flowcell for sequencing. The assembly is brought to the wells of the flowcell by the application of a magnetic field placed underneath the flowcell, or can be allowed to settle by gravity. Sequencing is initiated by flowing an oligonucleotide cholesterol tether, which hybridizes to the adaptor ends, over the beads, which tethers the beads to the membrane. Alternatively, the cholesterol tether can be introduced into the membrane during a ‘flush’ step, before the bead-target conjugate is added to the flowcell.


Methods

An E. coli whole-genome library, ONLA18816, is prepared by random fragmentation of E. coli high-molecular weight genomic DNA to a median size of ˜5.9 kb using a Covaris gTube, following the manufacturer's instructions. This library is end-repaired and dA-tailed using an NEB Ultra II kit, per the manufacturer's instructions. Following end-repair and dA-tailing, the fragmented genomic DNA is subjected to 0.4×SPRI purification and eluted from the SPRI beads in 0.1×TE. This sample is known as ‘dA-tailed genomic DNA’.


500 ng of the dA-tailed genomic DNA is ligated to enzyme-loaded adaptors (‘AMX 1D’) from Oxford Nanopore Technologies' 1D Sequencing Kit by Ligation (SQK-LSK108) in a comprising 12.5 μL 2× Blunt/TA Master Mix (New England Biolabs, Inc., Cat #M0367), 7.5 μL nuclease-free water and 5 μL AMX 1D (part of SQK-LSK108) for 10 min at room temperature. Following the ligation, unligated adapter is purified away by 0.4×SPRI purification and adapted library eluted from the SPRI beads in 10 mM Tris-Cl, 20 mM NaCl, pH 8.0. This sample is known as ‘pre-ligated genomic DNA’.


1 μg of an E. coli high-molecular weight genomic DNA sample is sheared and sticky-ends introduced in a single step by incubation of 1 μg DNA with 2.5 μL FRA (from the SQK-RAD003 of Oxford Nanopore Technologies, Ltd.) in a total volume of 10 μL at 30° C. for 20 min, followed by 80° C. for 1 min. 500 μL AMPure XP SPRI beads are washed five times in nuclease-free water, followed by resuspension in the original volume of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2.5 M NaCl. 20% (w/v) PEG-8000, yielding ‘washed SPRI beads’. The genomic DNA sample is subjected to purification using 0.4× ‘washed SPRI beads’, and eluted by incubating the SPRI beads with 12.5 μL of a buffer comprising 0.1×TE at room temperature for 5 min. The beads are pelleted once more and the supernatant, known as ‘transposase-fragmented genomic DNA’, retained.


200 nM DNA-extended tracrRNA (AR363) is added to a buffer containing 25 mM HEPES-NaOH (pH 8.0), 150 mM NaCl and 1 mM MgCl2 (known as dCas9 binding buffer). The tracrRNA is heated to 90° C. for 2 min and snap-cooled on wet ice, after which 100 nM dCas9 (ONLP12326) was added and the reaction incubated for 10 min at room temperature (˜2V° C.). 250 nM crRNA (AR400) is then added to the reaction and incubated for a further 10 min at room temperature (˜21° C.). The final volume was 50 μL per reaction. This mixture is known as ribonucleotide-protein complexes (RNPs).


To form dCas9-target complexes, 500 ng (˜1.2 μL) of either the transposase-fragmented genomic DNA, dA-talled genomic DNA or pre-ligated genomic DNA is added to the RNPs per reaction and incubated for 20 min at room temperature. The mixture is then incubated at 55° C. for 5 min to remove dCas9 not bound to its intended target. Each mixture is subjected to 1×SPRI purification as follows: 51 μL AMPure XP beads are added to the mixture, mixed by gentle resuspension, and incubated for 10 min at room temperature. The beads are pelleted using a magnetic separator, washed twice with ˜250 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2.5 M NaCl, 20% (w/v) PEG-8000, and eluted by incubating the SPRI beads with 12.5 μL of a buffer comprising 40 mM CAPS (pH 10.0), 40 mM KCl for 5 min. The beads were pelleted once more and the supernatant, known as ‘SPRI eluate’, retained.


50 μg Solulink ‘Nanolink’ streptavidin magnetic beads (5 μL) are incubated with 2.5 μL of AR364 capture oligo in ˜120 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2 M NaCl, 1 mM EDTA, 0.05% (v/v) Tween-20 for ˜1 h with agitation. Unbound oligonucleotide was removed by washing the beads twice with the same buffer, pelleting the beads using a magnetic separator. This conjugate was known as ‘capture beads’.


dCas9-bound target molecules (bound to transposase-fragmented genomic DNA, dA-tailed genomic DNA or pre-adapted genomic DNA) are bound to capture beads by incubating 12.5 μL of SPRI eluate with 10 μg capture beads (I p L) and 65 μL Dynabeads kilobaseBINDER Binding Solution (Thermo Scientific Cat. #60101) for 20 min with agitation. The beads are washed three times with a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 150 mM NaCl, 1 mM EDTA, and once with a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 20 mM NaCl. Following this step, the beads are pelleted and the supernatant removed. This sample is known as ‘bead-target complex’.


In one reaction, enzyme-loaded adaptors (tube ‘AMX ID’) from Oxford Nanopore Technologies' ID Sequencing Kit by Ligation (SQK-LSK108) are ligated to dA-tailed genomic DNA captured on beads by resuspending the pelleted beads from above with a ligation mix comprising 12.5 μL 2× Blunt/TA Master Mix (New England Biolabs, Inc., Cat #M0367), 7.5 μL nuclease-free water and 5 μL AMX 1D (part of SQK-LSK108) for 10 min at room temperature. This sample is known as the ‘bead-ligated 1D’ sample.


In a second reaction, the analyte is prepared for ‘ID2’ sequencing by performing two sequential ligations while the target is bound to the beads. In the first ligation reaction, the beads are resuspended in 2.5 μl 1D2 Adapter, 25 μl Blunt/TA Ligase Master Mix, and 22.5 μL nuclease-free water and incubated for 10 min at room temperature. After 10 min incubation, a further 10 μL BAM and 10 μL Blunt/TA Ligase Master Mix are added to the beads and incubated for a further 10 min at room temperature. This sample is known as the ‘1D2’ sample.


In a third reaction, the transposase-fragmented genomic DNA bound to beads is adapted for sequencing by resuspending the beads in a buffer containing 1×RBF, and 1 μL RPD (from SQK-RAD003) for 10 min. This sample is known as the ‘Rapid 1D’ sample.


Following each of the above ligations, the beads are pelleted after the ligation, washed once in 125 μL of a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 150 mM NaCl, 1 mM EDTA, and resuspended in 50 μL of RBF (from SQK-LSK108), diluted to 1× according to the manufacturer's instructions. This mixture is known as the loading sample.


For the sample containing pre-adapted genomic DNA bound to beads, the beads are washed once more in 125 μL of a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 150 mM NaCl, 1 mM EDTA, and resuspended in 50 μL of RBF (a component of SQK-LSK108), diluted to 1× according to the manufacturer's instructions. This mixture is known as the ‘pre-ligated sample’.


In a further reaction, PCR-adaptors (tube ‘PCA’) from Oxford Nanopore Technologies' Low-Input By PCR kit (SQK-LWP001) are ligated to dA-talled genomic DNA captured on beads by resuspending the pelleted beads from above with a ligation mix comprising 50 μL 2× Blunt/TA Master Mix (New England Biolabs, Inc., Cat #M0367), 30 μL nuclease-free water and 20 μL PCA for 10 min at room temperature. Following the ligation, the beads are washed in a further 125 μL of 10 mM Tris-Cl (pH 8.0), 20 mM NaCl, and resuspended in a mixture containing 50 μL LongAmp Taq 2× Master Mix (NEB Cat #M0287), 2 μL WGP primers, and 48 μL nuclease-free water. The mixture is subjected to PCR amplification, including 30 sec denaturation at 94° C., and 10 cycles of 30 sec denaturation at 94° C., 30 sec annealing at 62° C., and 500 sec extension at 65° C. This sample is subjected to 0.4×SPRI purification using AMPure XP beads pre-washed as described above. The sample is eluted from SPRI beads in 10 μL of 10 mM Tris-Cl (pH 8.0), 20 mM NaCl, for 5 min at room temperature. Following elution from the SPRI beads, 1 μL of RPD (SQK-LWP001) are added and the mixture incubated for 10 min at room temperature to ligate sequencing adapters by click chemistry. A further 35 μL of RBF, 25 μL of LLB and 5 μL nuclease-free water are also added. This sample is known as the ‘PCR’ sample.


Five Oxford Nanopore MinION flowcells are primed with 800 μL 1×RBF containing 50 nM tether oligo pipetted via its inlet port, followed by a pause of 10 min, then 200 μL of the same mixture pipetted via its inlet port with the SpotON port open. Each sample: 1D2, PCR, Rapid ID, bead-ligated, and pre-ligated, is pipetted dropwise into the SpotON port of each of the five flowcells and the fluid allowed to wick into the flowcell. MinION data collection is initiated immediately, and data are collected and analysed according to standard customer protocols.



FIG. 49 shows three example workflows for (1) the enzyme-free detection of dCas9, via the ligation of an enzyme-free adapter to the ends of a captured target analyte bound to beads; (2) the enrichment of target by the ligation of PCR adapters, followed by PCR amplification of the target, as described above, to release target from beads; and (3) the sequential ligation of 1D2 barcode adapters, followed by sequencing adapters, for high-accuracy nanopore sequencing.



FIG. 50 shows an example workflow, described in Example 11, for the rapid enrichment of target from high-molecular weight DNA, by transposase-mediated shearing of the DNA, while concomitantly adding a sticky end for adapter ligation. dCas9 is then bound to the sheared DNA, as described in Example 11; off-target effects are minimised by a stress step, and sequencing adapters ligated via click chemistry. This workflow makes use of the Oxford Nanopore Technologies SQK-RAD003 kit, with the insertion of a Cas9 binding and bead capture step between the transposase fragmentation and adapter attachment steps, as described in Example 10.


Results

The results from each of the workflows described above yield results very similar to those depicted in FIG. 42, i.e., targeted enrichment of the E. coli rrs genes from a whole-genome sample. The only differences in this example are the methods of end-preparation for attaching sequencing adapters. The ability to attach 1D2 adapters, via sequential ligation of a barcode followed by an enzyme-loaded sequencing adapter, increases the single-molecule accuracy of nanopore sequencing. The ability to attach adapters via a transposase, followed by enzyme-free ligation via click chemistry, may afford the end-user greater convenience, enabling a faster sample preparation time. The ability to attach PCR adapters may afford the end-user considerably improved sensitivity, enabling the detection of the enriched target from much lower input amounts of starting material.


The ligation of sequencing adapters while the target analyte is bound to beads enables excess adapters, which may poison the nanopore sequencing reaction by fouling the pore, or depleting nucleotide concentration, to be conveniently washed away after the ligation step


Materials
DNA and Oligonucleotides













Component



name
Sequence (Oligos are IDT codes)








E.coli

NCBI Reference Sequence: NC_000913.3


genomic



DNA, str.



K-12,



substr.



MG1655 as



ONLA18816






AR363
TACATTTAAGACCCTAATAT/iSp18/mA*mG*mCmAmUmAmGmCmA



rArGrUrUrArArArArUrArArGrGrCrUrArGrUrCrCrGrUrUrA



rUrCrArAmCmUmUmGmAmAmAmAmAmGmUmGmGmCmAmCmCmGmAmG



mUmCmGmGmUmGmCmU*mU*mU





AR364
/5Phos/ATATTAGGGTCTTAAATGTA/iSp18//iSp18//iSp18//3BioTEG/





Tether oligo
/5CholTEG/TT/iSp18//iSp18//iSp18//iSp18/TTGACCGCTCGCCTC





AR400
'Alt-R' Cas9 crRNA from Integrated DNA Technologies, Inc:



/AltR1/agaccaaagagggggacctt/AltR2/









Proteins

ONLP12326: S. pyogenes Cas9 D10A/H840A, C-terminal Twin-Strep-tag with TEV-cleavable linker; bold, bracketed shows the portion cleaved by TEV (sequence above).


Example 12

This Example describes a method for the detection of a specific polynucleotide in a complex background by nanopore sequencing, following the enrichment of the target molecule. In this example, the target DNA molecule is identified primarily by its sequence. The target molecule is separated from the background by means of a ‘pulldown’ via a capture moiety on the catalytically active (‘live’, wild-type) Cpf1 (ONLP12350) or dead (E993A or D908A) dCpf1 (ONLZ11882 or ONLZ11883). The Cpf1 or dCpf1 binds preferably to the target molecule by means of a crRNA directed against the ribosomal 16S (rrs) genes of Escherichia coli. ‘Off-target’ effects are reduced by applying a thermal and salt stress to the bound Cpf1 or dCpf1 protein, coupled with a SPRI purification step to remove excess, unbound Cpf1 or dCpf1 before subsequent capture on a bead surface.


The Cpf1 or dCpf1 carries a crRNA molecule bearing a 5′ DNA extension (AR766) that enables capture of the target molecule on a bead-capture oligonucleotide conjugate that bears a DNA sequence complementary to this extension (AR364), as depicted in figure RB12. In this Example, the capture oligonucleotide is linked to the bead via a biotin moiety. In this Example, the non-target DNA is washed away, and target molecules remain bound to the bead. The target molecule is then adapted for nanopore sequencing by ligation to either or both of its free, dA-tailed ends, while the Cpf1 target molecule is bound to the bead. The entire bead-target-RNP assembly is then delivered to a flowcell for sequencing. The assembly is brought to the wells of the flowcell by the application of a magnetic field placed underneath the flowcell, or can be allowed to settle by gravity. Sequencing is initiated by flowing an oligonucleotide cholesterol tether, which hybridizes to the adaptor ends, over the beads, which tethers the beads to the membrane. Alternatively, the cholesterol tether can be introduced into the membrane during a ‘flush’ step, before the bead-target conjugate is added to the flowcell.


Methods

An E. coli whole-genome library. ONLA18816, is prepared by random fragmentation of E. coli high-molecular weight genomic DNA to a median size of ˜5.9 kb using a Covaris gTube, following the manufacturer's instructions. This library is end-repaired and dA-tailed using an NEB Ultra II kit, per the manufacturer's instructions. Following end-repair and dA-tailing, the fragmented genomic DNA is subjected to 0.4×SPRI purification and eluted from the SPRI beads in 0.1×TE. This sample is known as ‘dA-tailed genomic DNA’.


250 nM DNA-extended crRNA (AR766) is added to a buffer containing 50 mM Tris-HCl (pH 8.0), 100 mM NaCl, 10 mM MgCl2 and 1 mM DTT (known as Cpf1 binding buffer). The crRNA is heated to 95° C. for 2 min and allowed to cool to room temperature, after which 500 nM Cpf1 (ONLP12326) is added and the reaction incubated for 20 min at room temperature (˜21° C.). This mixture is known as ribonucleotide-protein complexes (RNPs).


To form Cpf1-target complexes, 500 ng (˜1.2 μL) of the genomic DNA from above (ONLA18816) is added to the RNPs and incubated for 60 min at room temperature. The mixture is incubated at 55° C. for 5 min to remove Cpf1 not bound to its intended target. The mixture is subjected to 1×SPRI purification as follows: 51 μL AMPure XP beads are added to the mixture, mixed by gentle resuspension, and incubated for 10 min at room temperature. The beads are pelleted using a magnetic separator, and washed twice with ˜250 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2.5 M NaCl, 20% (w/v) PEG-8000, and eluted by incubating the SPRI beads with 12.5 μL of a buffer comprising 40 mM CAPS (pH 10.0), 40 mM KCl for 5 min. The beads are pelleted once more and the supernatant, known as ‘SPRI eluate’, retained.


50 μg Solulink ‘Nanolink’ streptavidin magnetic beads (5 μL) are incubated with 2.5 μL of AR364 capture oligo in ˜120 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2 M NaCl, 1 mM EDTA, 0.05% (v/v) Tween-20 for ˜1 h with agitation. Unbound oligonucleotide is removed by washing the beads twice with the same buffer, pelleting the beads using a magnetic separator. This conjugate was known as ‘capture beads’.


Cpf1 or dCpf1-bound target molecules are bound to capture beads by incubating 12.5 μL of SPRI eluate with 10 μg capture beads (1 μL) and 65 μL Dynabeads kilobaseBINDER Binding Solution (Thermo Scientific Cat. #60101) for 20 min with agitation. The beads are washed three times with a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 150 mM NaCl, 1 mM EDTA, and once with a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 20 mM NaCl. Following this step, the beads are pelleted and the supernatant removed. This sample is known as ‘bead-target complex’.


Enzyme-loaded adaptors (tube ‘AMX 1D’) from Oxford Nanopore Technologies' 1D Sequencing Kit by Ligation (SQK-LSK108) are ligated to dA-tailed genomic DNA captured on beads by resuspending the pelleted beads from above with a ligation mix comprising 12.5 μL 2× Blunt/TA Master Mix (New England Biolabs, Inc., Cat #M0367), 7.5 μL nuclease-free water and 5 μL AMX 1D (part of SQK-LSK108) for 10 min at room temperature. This sample is known as the ‘bead-ligated 1D’ sample.


The beads are pelleted after the ligation, washed once in 125 μL of a buffer containing 50 mM Tris-Cl (pH 8.0 at 4° C.), 150 mM NaCl, 1 mM EDTA, and resuspended in 50 μL of RBF (from SQK-LSK108), diluted to 1× according to the manufacturer's instructions. This mixture is known as the loading sample.


An Oxford Nanopore MinION flowcell is primed with 800 μL 1×RBF containing 50 nM tether oligo pipetted via its inlet port, followed by a pause of 10 min, then 200 μL of the same mixture pipetted via its inlet port with the SpotON port open. The loading sample is pipetted dropwise into the SpotON port of the flowcell and the fluid allowed to wick into the flowcell. MinION data collection is initiated immediately, and data are collected and analysed according to standard customer protocols.


Results

The results from the workflow described above yields results very similar to those depicted in FIG. 42 and to those depicted in FIG. 47, i.e., targeted enrichment of the E. coli rrs genes from a whole-genome sample. The live Cpf1 could impose a directionality bias. The differences in this Example are the CRISPR protein used to form the RNPs (i.e. Cpf1 or dCpf1, not Cas9 or dCas9), and the use of a single DNA-extended crRNA to form the RNPs.


The ligation of sequencing adapters while the target analyte is bound to beads enables excess adapters, which may poison the nanopore sequencing reaction by fouling the pore, or depleting nucleotide concentration, to be conveniently washed away after the ligation step.


Materials
DNA and Oligonucleotides













Component



name
Sequence (Oligos are IDT codes)








E.coli

NCBI Reference Sequence: NC_000913.3


genomic



DNA, str.



K-12,



substr.



MG1655 as



ONLA18816






AR766
TACATTTAAGACCCTAATATttttttrUrArArUrUrUrCrUrArCrUrCrUrUrGrUrArG



rArUrArUrCrArUrGrGrCrUrCrArGrArUrUrGrArArCrGrC





AR364
/5Phos/ATATTAGGGTCTTAAATGTA/iSp18//iSp18//iSp18//3BioTEG/





Tether
/5CholTEG/TT/iSp18//iSp18//iSp18//iSp18/TTGACCGCTCGCCTC


oligo









Proteins










ONLP12350: Acidaminococcus sp. Cpf1, N-terminal Twin-Strep-tag with TEV-cleavable



linker; bold, bracketed shows the portion cleaved by TEV:


[MSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKSGGGGGENLYFQ]GMTQFEGFTNLYQVSKTLRFELIPQGKTLKHI





QEQGFIEEDKARNDHYKELKPIIDRIYKTYADQCLQLVQLDWENLSAAIDSYRKEKTEETRNALIEEQATYRNAIHD





YFIGRTDNLTDAINKRHAEIYKGLFKAELFNGKVLKQLGTVTTTEHENALLRSFDKFTTYFSGFYENRKNVFSAEDI





STAIPHRIVQDNFPKFKENCHIFTRLITAVPSLREHFENVKKAIGIFVSTSIEEVFSFPFYNQLLTQTQIDLYNQLL





GGISREAGTEKIKGLNEVLNLAIQKNDETAHIIASLPHRFIPLFKQILSDRNTLSFILEEFKSDEEVIQSFCKYKTL





LRNENVLETAEALFNELNSIDLTHIFISHKKLETISSALCDHWDTLRNALYERRISELTGKITKSAKEKVQRSLKHE





DINLQEIISAAGKELSEAFKQKTSEILSHAHAALDQPLPTTLKKQEEKEILKSQLDSLLGLYHLLDWFAVDESNEVD





PEFSARLTGIKLEMEPSLSFYNKARNYATKKPYSVEKFKLNFQMPTLASGWDVNKEKNNGAILFVKNGLYYLGIMPK





QKGRYKALSFEPTEKTSEGFDKMYYDYFPDAAKMIPKCSTQLKAVTAHFQTHTTPILLSNNFIEPLEITKEIYDLNN





PEKEPKKFQTAYAKKTGDQKGYREALCKWIDFTRDFLSKYTKTTSIDLSSLRPSSQYKDLGEYYAELNPLLYHISFQ





RIAEKEIMDAVETGKLYLFQIYNKDFAKGHHGKPNLHTLYWTGLFSPENLAKTSIKLNGQAELFYRPKSRMKRMAHR





LGEKMLNKKLKDQKTPIPDTLYQELYDYVNHRLSHDLSDEARALLPNVITKEVSHEIIKDRRFTSDKFFFHVPITLN





YQAANSPSKFNQRVNAYLKEHPETPIIGIDRGERNLIYITVIDSTGKILEQRSLNTIQQFDYQKKLDNREKERVAAR





QAWSVVGTIKDLKQGYLSQVIHEIVDLMIHYQAVVVLENLNFGFKSKRTGIAEKAVYQQFEKMLIDKLNCLVLKDYP





AEKVGGVLNPYQLTDQFTSFAKMGTQSGFLFYVPAPYTSKIDPLTGFVDPFVWKTIKNHESRKHFLEGFDFLHYDVK





TGDFILHFKMNRNLSFQRGLPGFMPAWDIVFEKNETQFDAKGTPFIAGKRIVPVIENHRFTGRYRDLYPANELIALL





EEKGIVFRDGSNILPKLLENDDSHAIDTMVALIRSVLQMRNSNAATGEDYINSPVRDLNGVCFDSRFQNPEWPMDAD





ANGAYHIALKGQLLLNHLKESKDLKLONGISNQDWLAYIQELRNGSGLNDIFEAQKIEWHE














ONLZ11882: Acidaminococcus sp. Cpf1 D908A, N-terminal Twin-Strep-tag with TEV-



cleavable linker; bold, bracketed shows the portion cleaved by TEV:


[MSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKSGGGGGENLYFQ]GMTQFEGFTNLYQVSKTLRFELIPQGKTLKHI





QEQGFIEEDKARNDHYKELKPIIDRIYKTYADQCLQLVQLDWENLSAAIDSYRKEKTEETRNALIEEQATYRNAIHD





YFIGRTDNLTDAINKRHAEIYKGLFKAELFNGKVLKQLGTVTTTEHENALLRSFDKFTTYFSGFYENRKNVFSAEDI





STAIPHRIVQDNFPKFKENCHIFTRLITAVPSLREHFENVKKAIGIFVSTSIEEVFSFPFYNQLLTQTQIDLYNQLL





GGISREAGTEKIKGLNEVLNLAIQKNDETAHIIASLPHRFIPLFKQILSDRNTLSFILEEFKSDEEVIQSFCKYKTL





LRNENVLETAEALFNELNSIDLTHIFISHKKLETISSALCDHWDTLRNALYERRISELTGKITKSAKEKVQRSLKHE





DINLQEIISAAGKELSEAFKQKTSEILSHAHAALDQPLPTTLKKQEEKEILKSQLDSLLGLYHLLDWFAVDESNEVD





PEFSARLTGIKLEMEPSLSFYNKARNYATKKPYSVEKFKLNFQMPTLASGWDVNKEKNNGAILFVKNGLYYLGIMPK





QKGRYKALSFEPTEKTSEGFDKMYYDYFPDAAKMIPKCSTQLKAVTAHFQTHTTPILLSNNFIEPLEITKEIYDLNN





PEKEPKKFQTAYAKKTGDQKGYREALCKWIDFTRDFLSKYTKTTSIDLSSLRPSSQYKDLGEYYAELNPLLYHISFQ





RIAEKEIMDAVETGKLYLFQIYNKDFAKGHHGKPNLHTLYWTGLFSPENLAKTSIKLNGQAELFYRPKSRMKRMAHR





LGEKMLNKKLKDQKTPIPDTLYQELYDYVNHRLSHDLSDEARALLPNVITKEVSHEIIKDRRFTSDKFFFHVPITLN





YQAANSPSKFNQRVNAYLKEHPETPIIGIARGERNLIYITVIDSTGKILEQRSLNTIQQFDYQKKLDNREKERVAAR





QAWSVVGTIKDLKQGYLSQVIHEIVDLMIHYQAVVVLENLNFGFKSKRTGIAEKAVYQQFEKMLIDKLNCLVLKDYP





AEKVGGVLNPYQLTDQFTSFAKMGTQSGFLFYVPAPYTSKIDPLTGFVDPFVWKTIKNHESRKHFLEGFDFLHYDVK





TGDFILHFKMNRNLSFQRGLPGFMPAWDIVFEKNETQFDAKGTPFIAGKRIVPVIENHRFTGRYRDLYPANELIALL





EEKGIVFRDGSNILPKLLENDDSHAIDTMVALIRSVLQMRNSNAATGEDYINSPVRDLNGVCFDSRFQNPEWPMDAD





ANGAYHIALKGQLLLNHLKESKDLKLQNGISNQDWLAYIQELRNGSGLNDIFEAQKIEWHE














ONLZ11883: Acidaminococcus sp. Cpf1 E993A, N-terminal Twin-Strep-tag with TEV-



cleavable linker; bold, bracketed shows the portion cleaved by TEV:


[MSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKSGGGGGENLYFQ]GMTQFEGFTNLYQVSKTLRFELIPQGKTLKHI





QEQGFIEEDKARNDHYKELKPIIDRIYKTYADQCLQLVQLDWENLSAAIDSYRKEKTEETRNALIEEQATYRNAIHD





YFIGRTDNLTDAINKRHAEIYKGLFKAELFNGKVLKQLGTVTTTEHENALLRSFDKFTTYFSGFYENRKNVFSAEDI





STAIPHRIVQDNFPKFKENCHIFTRLITAVPSLREHFENVKKAIGIFVSTSIEEVFSFPFYNQLLTQTQIDLYNQLL





GGISREAGTEKIKGLNEVLNLAIQKNDETAHIIASLPHRFIPLFKQILSDRNTLSFILEEFKSDEEVIQSFCKYKTL





LRNENVLETAEALFNELNSIDLTHIFISHKKLETISSALCDHWDTLRNALYERRISELTGKITKSAKEKVQRSLKHE





DINLQEIISAAGKELSEAFKQKTSEILSHAHAALDQPLPTTLKKQEEKEILKSQLDSLLGLYHLLDWFAVDESNEVD





PEFSARLTGIKLEMEPSLSFYNKARNYATKKPYSVEKFKLNFQMPTLASGWDVNKEKNNGAILFVKNGLYYLGIMPK





QKGRYKALSFEPTEKTSEGFDKMYYDYFPDAAKMIPKCSTQLKAVTAHFQTHTTPILLSNNFIEPLEITKEIYDLNN





PEKEPKKFQTAYAKKTGDQKGYREALCKWIDFTRDFLSKYTKTTSIDLSSLRPSSQYKDLGEYYAELNPLLYHISFQ





RIAEKEIMDAVETGKLYLFQIYNKDFAKGHHGKPNLHTLYWTGLFSPENLAKTSIKLNGQAELFYRPKSRMKRMAHR





LGEKMLNKKLKDQKTPIPDTLYQELYDYVNHRLSHDLSDEARALLPNVITKEVSHEIIKDRRFTSDKFFFHVPITLN





YQAANSPSKFNQRVNAYLKEHPETPIIGIDRGERNLIYITVIDSTGKILEQRSLNTIQQFDYQKKLDNREKERVAAR





QAWSVVGTIKDLKQGYLSQVIHEIVDLMIHYQAVVVLANLNFGFKSKRTGIAEKAVYQQFEKMLIDKLNCLVLKDYP





AEKVGGVLNPYQLTDQFTSFAKMGTQSGFLFYVPAPYTSKIDPLTGFVDPFVWKTIKNHESRKHFLEGFDFLHYDVK





TGDFILHFKMNRNLSFQRGLPGFMPAWDIVFEKNETQFDAKGTPFIAGKRIVPVIENHRFTGRYRDLYPANELIALL





EEKGIVFRDGSNILPKLLENDDSHAIDTMVALIRSVLQMRNSNAATGEDYINSPVRDLNGVCFDSRFQNPEWPMDAD





ANGAYHIALKGQLLLNHLKESKDLKLQNGISNQDWLAYIQELRNGSGLNDIFEAQKIEWHE






Example 13

This Example describes a method for the rapid detection and quantitation of a specific bacteriophage lambda polynucleotide in a human background by nanopore detection. In this Example, the target DNA is contacted by one or more dCas9-RNP complex(es) carrying an affinity tag that may be used for the immobilization of the target molecule on a surface (‘immobilisation dCas9 complex(es)’), while one or more additional dCas9-RNP complexes (‘barcode Cas9 complex(es)’) contact the target DNA molecule in a second region. The ‘barcode dCas9 complexes’ carry an enzyme-loaded adapter molecule whose current signature is used to confirm that the dCas9 bound to its target. The presence of the target region is identified by the barcode, while the sensitivity of detection of the target over non-target DNA is enhanced by immobilisation on the membrane surface. Thus, both types of dCas9 complex are required to be bound to the same target molecule for the successful detection of the barcode sequence. In this example, the non-target DNA need not be washed away.


Methods

A bacteriophage lambda whole-genome library (NEB Cat #N3013) is prepared by random fragmentation of E. coli high-molecular weight genomic DNA to a median size of ˜5 kb using a Covaris gTube, following the manufacturer's instructions. A human whole-genome library is also prepared by random fragmentation of high-molecular weight genomic DNA (Sigma Aldrich, Cat #000000011691112001) to a median size of ˜5 kb using a Covaris gTube, following the manufacturer's instructions.


‘Enzyme-loaded crRNAs’ are prepared by hybridising oligonucleotides OLIGO_1, a crRNA oligonucleotide bearing a 3′ DNA extension, and OLIGO_2, a DNA adapter oligonucleotide, in a PCR machine in 10 mM Tris-Cl (pH 8.0), 1 mM EDTA, 200 mM NaCl at 40 μM of each oligonucleotide by heating to 95° C. for 2 min and slow cooling to 20° C. over ˜2 h. This annealing reaction yields a hybrid molecule with a crRNA portion, and a DNA-extended portion that is duplex and bears a 3′ dA-overhang, known as ‘crRNA adapter’. The AMX 1D enzyme adaptor from Oxford Nanopore Technologies' 1D Sequencing Kit By Ligation (SQK-LSK108) is ligated to ‘crRNA adapter’ by incubating 5 μL AMX 1D (which carries a dT-overhang) with 1 μM of ‘crRNA adapter’ (1.25 μL), 50 μL 2×NEB Blunt/TA Master Mix and 43.8 μL nuclease-free water in a total volume of ˜100 μL for 10 min at room temperature. The excess unligated material is purified away by the addition 3.8× volumes of AMPure XP SPRI beads that have been equilibrated in 50 mM Tris-Cl (pH 8.0 at 4° C.), 2.5 M NaCl, 28% (w/v) PEG-8000, eluting the ‘enzyme-loaded crRNAs’ in a buffer comprising 10 mM Tris-Cl (pH 8.0), 20 mM NaCl.


‘Cholesterol tethers’ were prepared by hybridising oligonucleotides AR131 and AR132 in a PCR machine in 10 mM Tris-Cl (pH 8.0), 1 mM EDTA, 200 mM NaCl at 40 μM of each oligonucleotide by heating to 95° C. for 2 min and slow cooling to 20° C. over ˜2 h. This annealing reaction yields a hybrid molecule with a 3′ overhang bearing complementarity to the crRNA AR140 below.


200 nM ‘Alt-R’ tracrRNA (Integrated DNA Technologies, Inc., Cat #1072532), is added to a buffer containing 25 mM HEPES-NaOH (pH 8.0), 150 mM NaCl and 1 mM MgCl2 (known as dCas9 binding buffer). The tracrRNA is heated to 90° C. for 2 min and snap-cooled on wet ice, after which 100 nM dCas9 (ONLP12326) is added and the reaction incubated for 10 min at room temperature (˜21° C.). An equimolar mix of two crRNAs is added: 125 nM AR140, bearing one 3′ DNA extension sequence, and 125 nM ‘enzyme-loaded crRNA’ from above, bearing the sequencing adapter. The incubation is continued at room temperature (˜21° C.) for 10 min. The final volume is ˜50 μL. This mixture is known as ribonucleotide-protein complexes (RNPs).


To form dCas9-target complexes, a varying amount of the bacteriophage lambda genomic DNA from above from 0 to 100 ng is mixed with a constant 1 μg (in 5 μL total) of human DNA from above, added to the RNPs and incubated for 20 min at room temperature. The mixture is subjected to 1×SPRI purification to remove excess unbound dCas9, crRNA and tracrRNA as follows: 51 μL AMPure XP beads are added to the mixture, mixed by gentle resuspension, and incubated for 10 min at room temperature. The beads are pelleted using a magnetic separator, and washed twice with ˜250 μL of a buffer comprising 50 mM Tris-Cl (pH 8.0 at 4° C.), 2.5 M NaCl, 20% (w/v) PEG-8000, and eluted by incubating the SPRI beads with 12.5 μL of 10 mM Tris-Cl (pH 8.0), 20 mM NaCl. To 12.5 μL of the eluate is added 35 μL RBF, 25 μL LLB (both components of SQK-LSK108, Oxford Nanopore Technologies) and 2.5 μL nuclease-free water. This sample is known as the ‘loading sample’.


An Oxford Nanopore MinION flowcell is primed with 800 μL 1×RBF containing 50 nM ‘cholesterol tethers’, bearing complementarity to AR134A and a cholesterol moiety, pipetted via its inlet port, followed by a pause of 10 min, then 200 μL of the same mixture pipetted via its inlet port with the SpotON port open. The entire 75 μL of the loading sample was pipetted dropwise into the SpotON port and the fluid allowed to wick into the flowcell. The flowcell is not flushed, and the quantification of target analyte over background is possible because membrane tethered analyte is captured preferentially by the nanopore. MinION data collection is initiated immediately, and data are collected and analysed by counting the number of adapter events.


Results


FIG. 52 shows, in cartoon form, the example described above. The nanopore sequencing readout is punctuated by a characteristic event L1 (which may be basecalled to yield barcode sequence b) that is dependent on the enzyme-loaded adapter C, the frequency of which is dependent on the concentration of target analyte (membrane-tethered species G, and solution species H); membrane-tethered species G is captured preferentially by nanopore J because of its proximity to the nanopore. Titration of the target analyte (bacteriophage lambda) against the constant amount of human non-target DNA yields a plot M of the frequency of event L1 against target analyte concentration. The frequency of event L1 at zero target analyte concentration (N) demonstrates the ‘false-positive’ or background rate of detection of species H captured from solution (i.e., not tethered to the surface).


Materials

DNA and oligunucleutides













Component



name
Sequence (Oligos are IDT codes)







Bacteriophage
NCBI Reference Sequence: NC_001416.1


lambda DNA






AR134A
/5Phos/rCrCrGrArCrCrArCrGrCrCrArGrCrArUrArUrCrGrGrUrUrUrUrArGrArG



rCrUrArUrGrCrUAGGTTAAACACCCAAGA





OLIGO_2
/5Phos/CTTGGGTGTTTAACCT





AR140
/5Phos/rUrGrCrArArCrGrGrUrCrGrArUrUrGrCrCrUrGrArGrUrUrUrUrArGrArG



rCrUrArUrGrCrUAGCAATACATCTTTG





AR131
/5Phos/TGTTCTGATCGGAACGATCG/iSp18//iSp18//iSp18//3CholTEG/





AR132
/5Phos/CGATCGTTCCGATCAGAACACAAAGATGTATTGCT









Proteins

ONLP12326: S. pyogenes Cas9 D10A/H840A, C-terminal Twin-Strep-tag with TEV-cleavable linker; bold, bracketed shows the portion cleaved by TEV (sequence above).

Claims
  • 1.-68. (canceled)
  • 69. A kit comprising: (a) a guide polynucleotide comprising (i) a nucleotide sequence that binds to a sequence in a target polynucleotide, (ii) a nucleotide sequence that binds to a polynucleotide guided effector protein, and (iii) an adaptor and/or an anchor, and(b) a polynucleotide-guided effector protein.
  • 70. The kit according to claim 69 further comprising a polynucleotide binding protein, a microparticle, a membrane, and/or a transmembrane pore.
  • 71.-74. (canceled)
  • 75. The kit according to claim 69, wherein the guide polynucleotide is a guide RNA.
  • 76. The kit according to claim 75, wherein the guide RNA comprises a crRNA and a tracrRNA, wherein the anchor or the adaptor is present at the 5′ end of the tracrRNA, the 3′ end of the tracrRNA, or the 3′ end of the crRNA.
  • 77. The kit according to claim 69, wherein the anchor is a polypeptide anchor or a hydrophobic anchor.
  • 78. The kit according to claim 77, wherein the hydrophobic anchor is a lipid, fatty acid, sterol, carbon nanotube, cholesterol, palmitate, or tocopherol.
  • 79. The kit according to claim 69, wherein the adaptor comprises a barcode and/or a leader sequence.
  • 80. The kit according to claim 69, wherein the polynucleotide-guided effector protein is a RNA-guided effector protein.
  • 81. The kit according to claim 80, wherein the RNA-guided effector protein is a Cas, Cpf1 or C2c2 protein.
  • 82. The kit according to claim 81, wherein the Cas protein is a Cas9 protein.
  • 83. A kit comprising: (a) a first guide polynucleotide comprising (i) a nucleotide sequence that binds to a first target sequence, (ii) a nucleotide sequence that binds to a polynucleotide guided effector protein, and (iii) an adaptor;(b) a second guide polynucleotide comprising (i) a nucleotide sequence that binds to a second target sequence, (ii) a nucleotide sequence that binds to a polynucleotide guided effector protein, and (iii) an anchor; and(c) a polynucleotide-guided effector protein.
  • 84. The kit according to claim 83, wherein the first target sequence and the second target sequence are nucleic acid sequences belonging to the same target polynucleotide.
  • 85. The kit according to claim 83, wherein the first target sequence and the second target sequence are nucleic acid sequences belonging to different target polynucleotides.
  • 86. A kit according to claim 83 further comprising a polynucleotide binding protein, a microparticle, a membrane, and/or a transmembrane pore.
  • 87. The kit according to claim 83, wherein the first guide polynucleotide and/or the second guide polynucleotide is a guide RNA.
  • 88. The kit according to claim 87, wherein the guide RNA comprises a crRNA and a tracrRNA, wherein the anchor or the adaptor is present at the 5′ end of the tracrRNA, the 3′ end of the tracrRNA, or the 3′ end of the crRNA.
  • 89. The kit according to claim 83, wherein the anchor is a polypeptide anchor or a hydrophobic anchor.
  • 90. The kit according to claim 83, wherein the adaptor comprises a barcode and/or a leader sequence.
  • 91. The kit according to claim 83, wherein the polynucleotide-guided effector protein is a RNA-guided effector protein.
  • 92. The kit according to claim 91, wherein the RNA-guided effector protein is a Cas, Cpf1 or C2c2 protein.
Priority Claims (1)
Number Date Country Kind
1616590.4 Sep 2016 GB national
RELATED APPLICATIONS

This application is a continuation of U.S. application Ser. No. 17/361,821, filed Jun. 29, 2021, which is a continuation of U.S. Application Ser. No. 16/338,399, filed Mar. 29, 2019, which is a national stage filing under 35 U.S.C. § 371 of international application number PCT/GB2017/052946, filed Sep. 29, 2017, which claims the benefit of United Kingdom application GB1616590.4, filed Sep. 29, 2016, each of which is herein incorporated by reference in its entirety.

Continuations (2)
Number Date Country
Parent 17361821 Jun 2021 US
Child 18352701 US
Parent 16338399 Mar 2019 US
Child 17361821 US