METHOD

Information

  • Patent Application
  • 20240240245
  • Publication Number
    20240240245
  • Date Filed
    May 22, 2020
    6 years ago
  • Date Published
    July 18, 2024
    a year ago
Abstract
Provided herein is a method of loading a motor protein onto a polynucleotide adapter. Also provided are polynucleotide adapters and kits comprising such adapters. The adapters find use in characterising analytes such as polynucleotides in methods in which the polynucleotide moves in respect of a nanopore.
Description
REFERENCE TO A SEQUENCE LISTING SUBMITTED AS A TEXT FILE VIA EFS-WEB

This application contains a Sequence Listing which has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Aug. 9, 2022 is named 0036670120US00-SUBSEQ-LJG and is 39,682 bytes in size.


FIELD

The present invention relates to methods of loading motor proteins onto polynucleotide adapters, to methods of characterising polynucleotides using the novel methods, and to novel polynucleotide adapters.


BACKGROUND

Nanopore sensing is an approach to analyte detection and characterization that relies on the observation of individual binding or interaction events between the analyte molecules and an ion conducting channel. Nanopore sensors can be created by placing a single pore of nanometre dimensions in an electrically insulating membrane and measuring voltage-driven ion currents through the pore in the presence of analyte molecules. The presence of an analyte inside or near the nanopore will alter the ionic flow through the pore, resulting in altered ionic or electric currents being measured over the channel. The identity of an analyte is revealed through its distinctive current signature, notably the duration and extent of current blocks and the variance of current levels during its interaction time with the pore.


Polynucleotides are important analytes for sensing in this manner. Nanopore sensing of polynucleotide analytes can reveal the identity and perform single molecule counting of the sensed analytes, but can also provide information on their composition such as their nucleotide sequence, as well as the presence of characteristics such as base modifications, oxidation, reduction, decarboxylation, deamination and more. Nanopore sensing has the potential to allow rapid and cheap polynucleotide sequencing, providing single molecule sequence reads of polynucleotides of tens to tens of thousands bases length.


Two of the essential components of polymer characterization using nanopore sensing are (1) the control of polymer movement through the pore and (2) the discrimination of the composing building blocks as the polymer is moved through the pore. During nanopore sensing of analytes such as polynucleotides, it is important to control the movement of the polynucleotide with respect to the pore. Uncontrolled movement can prevent or impede accurate characterisation of the polynucleotides. For example, accurately distinguishing each nucleotide in a homopolymeric polynucleotide is problematic when the movement of the polynucleotide with respect to the pore is not controlled.


To address this problem, it is known to use a motor protein to control the movement of a polymer such as a polynucleotide whilst it is characterised. Suitable motor proteins include polynucleotide-handling enzymes such as helicases, exonucleases, topoisomerases and the like. The motor protein processes the polynucleotide in a controlled manner. The motor protein can thus be used to control the movement of a polymer such as a polynucleotide with respect to the pore.


Whilst the use of motor proteins has allowed significant improvements to be achieved in the processing of polynucleotides for characterisation by nanopore sensing, technical challenges remain. One issue concerns ensuring that the motor protein is in the correct position with respect to the polynucleotide sequence to be determined prior to the start of the characterisation. For example, if the motor protein has already begun to process the polynucleotide prior to the start of the characterisation then the portion of the polynucleotide that has been processed prior to the start of the characterisation may not be accurately determined.


To address this, it is known to “stall” the motor protein on a polynucleotide adapter prior to the characterisation. The motor protein does not process the target polynucleotide until the characterisation is begun. In this way, improved characterisation of the target polynucleotide is possible.


One method known in the art is to stall a motor protein such as a helicase on a molecular adapter using a spacer. The spacer is a portion of the adapter which impedes the movement of the motor protein (e.g. helicase) onto the target polynucleotide to be characterised. In the absence of an external force, the movement of the motor protein (helicase) onto the target polynucleotide is prevented. However, under the influence of an external force, which can for example be provided by passing the target polynucleotide through a nanopore, the motor protein can move onto the target polynucleotide and thereby control the movement of the target polynucleotide with respect to the pore. Such methods are described in WO 2014/135838, the entire contents of which are incorporated by reference.


Whilst methods of stalling motor proteins have led to significant benefits, it has been recognised that the efficiency of such systems could be improved if the turnover of “fuel” molecules (e.g. cofactors required for polynucleotide processing) by the stalled motor protein could be reduced. Accordingly, there is a need for improved methods for loading polynucleotides onto molecular adapters which address this.


SUMMARY

The disclosure relates to a method of loading a motor protein onto a polynucleotide adapter. The methods comprise providing a polynucleotide adapter comprising a spacer. The polynucleotide adapter is contacted with a motor protein causing the motor protein to progress onto the spacer. A blocking moiety is bound to the polynucleotide adapter. Binding the blocking moiety to the polynucleotide adapter prevents the motor protein from moving off the spacer. Preventing the motor protein from moving off the spacer may have beneficial effects, such as reducing the rate at which the motor protein turns over fuel molecules compared to when the motor protein is bound to a polynucleotide.


Accordingly, provided herein is a method of loading a motor protein onto a polynucleotide adapter, the method comprising:

    • i) providing a polynucleotide adapter comprising a spacer;
    • ii) contacting the polynucleotide adapter with a motor protein; and
    • iii) positioning the motor protein on the spacer;


      wherein a blocking moiety bound to the polynucleotide adapter prevents the motor protein from moving off the spacer.


In some embodiments, the method comprises:

    • i) providing a polynucleotide adapter comprising a spacer and a blocking moiety bound to the polynucleotide adapter;
    • ii) contacting the polynucleotide adapter with a motor protein; and
    • iii) positioning the motor protein on the spacer;


      wherein the blocking moiety prevents the motor protein from moving off the spacer.


Also provided is a method of loading a motor protein onto a polynucleotide adapter, the method comprising:

    • i) providing a polynucleotide adapter comprising a spacer;
    • ii) contacting the polynucleotide adapter with a motor protein;
    • iii) causing the motor protein to progress onto the spacer; and
    • iv) binding a blocking moiety to the polynucleotide adapter, wherein the blocking moiety prevents the motor protein from moving off the spacer.


In one embodiment, the method comprises

    • i) providing a polynucleotide adapter comprising a loading site connected to a spacer;
    • ii) contacting the loading site with a motor protein;
    • iii) causing the motor protein to progress from the loading site onto the spacer; and
    • iv) binding a blocking moiety to the polynucleotide adapter, wherein the blocking moiety prevents the motor protein from moving off the spacer and onto the loading site.


In one embodiment, step (ii) of the method comprises contacting the loading site with a motor protein, wherein the motor protein engages with the loading site; and step (iv) of the method comprises binding a blocking moiety to the polynucleotide adapter, wherein the blocking moiety prevents the motor protein from moving off the spacer and re-engaging with the loading site.


In one embodiment, the polynucleotide adapter comprises a loading site connected to a spacer and wherein the motor protein binds to the loading site of the polynucleotide adapter.


In some embodiments, causing the motor protein to progress onto the spacer comprises applying a physical or chemical force to the motor protein. In one embodiment, causing the motor protein to progress onto the spacer may comprise contacting the motor protein with one or more fuel molecules. In one embodiment, the polynucleotide adapter comprises a loading site connected to a spacer; the motor protein is a first motor protein and causing the first motor protein to progress from the loading site onto the spacer comprises loading a second motor protein onto the loading site and causing the second motor protein to progress from the loading site towards the spacer, wherein the second motor protein forces the first motor protein onto the spacer. In one embodiment, binding the blocking moiety to the polynucleotide adapter forces the motor protein onto the spacer.


In some embodiments, the polynucleotide adapter comprises a loading site connected to a spacer and the blocking moiety binds to the loading site. In one embodiment, the loading site is contiguous with the spacer and the blocking moiety binds to the loading site immediately adjacent to the spacer.


In one embodiment, step (iii) comprises causing the motor protein to progress onto the spacer such that the spacer occupies the active site of the motor protein.


In some embodiments, the polynucleotide adapter comprises a loading site connected to a spacer and the loading site comprises a single-stranded or non-hybridised polynucleotide. In one embodiment, the loading site comprises a single-stranded or non-hybridised polynucleotide having a length of between about 2 and about 1000 nucleotide units.


In some embodiments, the blocking moiety is a physical or chemical blocking moiety. In one embodiment, binding the blocking moiety to the polynucleotide adapter sterically prevents the movement of the motor protein off the spacer. In one embodiment, binding the blocking moiety to the polynucleotide adapter introduces a chemical group which prevents movement of the motor protein off the spacer.


In some embodiments, (i) the loading moiety comprises a single-stranded or non-hybridised polynucleotide and the blocking moiety comprises a single-stranded or non-hybridised polynucleotide; and (ii) binding the blocking moiety to the loading site comprises hybridising the blocking moiety to the loading site. In one embodiment, the blocking moiety comprises a single-stranded or non-hybridised polynucleotide having a length of between about 2 and about 1000 nucleotide units.


In some embodiments, the spacer comprises:

    • i) one or more nitroindoles, one or more inosines, one or more acridines, one or more 2-aminopurines, one or more 2-6-diaminopurines, one or more 5-bromo-deoxyuridines, one or more inverted thymidines (inverted dTs), one or more inverted dideoxy-thymidines (ddTs), one or more dideoxy-cytidines (ddCs), one or more 5-methylcytidines, one or more 5-hydroxymethylcytidines, one or more 2′-O-Methyl RNA bases, one or more Iso-deoxycytidines (Iso-dCs), one or more Iso-deoxyguanosines (Iso-dGs), one or more C3 (OC3H6OPO3) groups, one or more photo-cleavable (PC) [OC3H6—C(O)NHCH2—C6H3NO2—CH(CH3)OPO3] groups, one or more hexandiol groups, one or more spacer 9 (iSp9) [(OCH2CH2)3OPO3] groups, or one or more spacer 18 (iSp18) [(OCH2CH2)6OPO3] groups;
    • ii) one or more thiol connections;
    • iii) one or more abasic nucleotides;
    • iv) one or more nucleotides of different backbone structure to the loading site;
    • v) one or more chemical groups which cause the one or more motor proteins to stall; and/or
    • vi) a polymer, optionally wherein said polymer is a polypeptide or a polyethylene glycol (PEG).


In some embodiments the spacer comprises one or more nucleotides, preferably wherein the spacer comprises one or more nucleotide islands.


In some embodiments:

    • i) the polynucleotide adapter comprises a spacer comprising one or more nucleotides, preferably one or more nucleotide islands; and a blocking moiety bound to the polynucleotide adapter; and
    • ii) positioning the motor protein on the spacer comprises contacting the motor protein with the spacer and modifying the motor protein to prevent the motor protein disengaging from the spacer.


In some embodiments the spacer comprises one or more moieties selected from: —S—N—S—N—S—N—S—; —S—N—N—S—N—N—S—N—N—S—; —S—S—S—S—S—S—N—N—S—S—; —S—S—S—S—S—N—N—S—N—N—S—S—S—; —S—S—S—N—N—S—N—N—S—S—N—N—S—; —S—S—S—S—S—N—N—S—N—N—S—S—N—N—S—; —S—S—S—N—N—S—N—N—S—N—N—S—; —N—N—S—S—N—N—S—S—S—S—S—; —S—N—N—S—S—N—N—S—S—S—S—; —S—S—N—N—S—S—N—N—S—S—S—; —S—S—S—S—N—N—S—S—N—N—S—; —N—N—S—N—N—S—S—S—S—S—S—; —S—N—N—S—N—N—S—S—S—S—S—; —S—S—N—N—S—N—N—S—S—S—S—; —S—S—S—N—N—S—N—N—S—S—S—: —S—S—S—S—N—N—S—N—N—S—S—; and —S—S—S—N—N—S—S—N—N—S—;

    • wherein each S is a spacer unit and each N is a nucleotide.


In some embodiments, the motor protein is a helicase, a polymerase, an exonuclease, a topoisomerase, or a variant thereof. In one embodiment, the motor protein on the spacer of the polynucleotide adapter is modified to prevent the motor protein disengaging from the spacer. In one embodiment, the or each motor protein is a helicase independently selected from a Hel308 helicase, a RecD helicase, a TraI helicase, a TrwC helicase, an XPD helicase, and a Dda helicase, or a variant thereof.


In one embodiment, the method further comprises the step of (v) removing excess motor protein molecules which are not located on the spacer.


Also provided is a method of controlling the movement of a target polynucleotide with respect to a transmembrane nanopore, comprising:

    • i) providing (A) a target polynucleotide; (B) a polynucleotide adapter comprising a spacer; and (C) a motor protein;
    • ii) carrying out a method according to any one of the embodiments described above, thereby stalling the motor protein on the spacer of the polynucleotide adapter;
    • iii) contacting the target polynucleotide and the stalled motor protein on the spacer of the polynucleotide adapter with the nanopore; and
    • iv) applying a potential across the transmembrane nanopore thereby causing the motor protein to move past the spacer onto the target polynucleotide thereby controlling the movement of the target polynucleotide with respect to the nanopore.


In one embodiment, the motor protein is stalled on the polynucleotide adapter before the polynucleotide adapter is attached to the target polynucleotide. In another embodiment, the polynucleotide adapter is attached to the target polynucleotide before the motor protein is stalled on the polynucleotide adapter.


Also provided is a method of controlling the movement of a target polynucleotide with respect to a transmembrane nanopore, comprising:

    • i) providing a target polynucleotide;
    • ii) providing a polynucleotide adapter comprising a spacer and having a motor protein stalled thereon, wherein said polynucleotide adapter is obtained according to the methods disclosed herein;
    • iii) contacting the target polynucleotide and the polynucleotide adapter with the nanopore; and
    • iv) applying a potential across the transmembrane nanopore thereby causing the motor protein to move past the spacer onto the target polynucleotide thereby controlling the movement of the target polynucleotide with respect to the nanopore.


In some embodiments, the methods further comprises taking one or more measurements as the target polynucleotide moves with respect to the nanopore, wherein the one or more measurements are indicative of one or more characteristics of the target polynucleotide, and thereby characterising the target polynucleotide as it moves with respect to the nanopore.


Also provided is a polynucleotide adapter comprising (i) a spacer; (ii) a motor protein stalled on the spacer, wherein the active site of the motor protein is occupied by the spacer; and (iii) a blocking moiety bound to the adapter, wherein the blocking moiety prevents the motor protein from moving off the spacer.


In one embodiment, (i) the adapter comprises a loading site connected to the spacer and the blocking moiety is bound to the loading site; and (ii) the blocking moiety prevents the motor protein from engaging with the loading site.


In one embodiment, the polynucleotide adapter comprises:

    • i) {LB-S-D}n or {D-S-LB}n in the 5′ to 3′ direction; wherein LB is a blocked loading site; S is a spacer; D is a double-stranded polynucleotide; and n is an integer, optionally an integer from 1 to about 20; and
    • ii) one or more motor proteins stalled on the spacer (S);
    • wherein the or each LB moiety prevents the or each motor protein from moving off the spacer (S) in the direction away from the double-stranded polynucleotide (D).


In one embodiment, the polynucleotide adapter comprises:

    • i) {LB-S-D}n or {D-S-LB}n in the 5′ to 3′ direction; wherein LB is a first double-stranded polynucleotide; S is a spacer; D is a second double-stranded polynucleotide; and n is an integer, optionally an integer from 1 to about 20; and wherein the first double-stranded polynucleotide (LB) is contiguous with the spacer (S) and the spacer (S) is contiguous with the second double-stranded polynucleotide (D); and
    • ii) one or more motor proteins is stalled on the spacer (S).


Also provided is a kit for modifying a target polynucleotide, comprising:

    • i) a polynucleotide adapter comprising a spacer;
    • ii) a motor protein capable of controlling the movement of the target polynucleotide; and
    • iii) a blocking moiety capable of binding to the polynucleotide adapter so that when the motor protein is located on the spacer of the polynucleotide adapter and the polynucleotide-unwinding site of the motor protein is occupied by the spacer, the motor protein is prevented from moving off the spacer


In one embodiment, the polynucleotide adapter comprises a loading site and the blocking moiety is capable of binding to the polynucleotide adapter so that the motor protein is prevented from engaging with the loading site.


Also provided is a kit for modifying a target polynucleotide, comprising:

    • i) a polynucleotide adapter comprising a spacer and a blocking moiety bound to the polynucleotide adapter; and
    • ii) a motor protein capable of controlling the movement of the target polynucleotide;
    • wherein when the motor protein is bound to the adapter, the blocking moiety prevents the motor protein from moving off the spacer.


In some embodiments, the polynucleotide adapter or kit according to the preceding embodiments comprises a loading site, blocking moiety, spacer and/or motor protein each independently as defined in any one the preceding embodiments.





BRIEF DESCRIPTION OF THE FIGURES


FIG. 1. Futile turnover is reduced using the methods disclosed herein. FIG. 1(A) shows a schematic representation of constructs comprising double-stranded DNA, followed by spacer (4×Sp18 spacer groups), followed by further double-stranded DNA. The spacer is flanked by the double-stranded DNA so that there is no single-stranded DNA accessible at either end of the spacer. A Dda helicase is stalled on the spacer. FIG. 1(B) shows similar constructs in which the spacer is not flanked by double-stranded DNA and the lower strand is missing ten residues. The construct thus comprises single-stranded DNA flanking the 5′ end of the spacer. FIG. 1(C) shows a bar graph comparing the catalytic rate of ATP turnover by Dda helicase enzymes stalled on the constructs of FIG. 1(A) and FIG. 1(B), respectively. This data is discussed in Example 1.



FIG. 2. Results of a loading titration showing effective stalling of a motor protein on an adapter comprising a spacer as defined herein. This data is discussed in Example 3.



FIG. 3. Results showing increased efficiency obtained when example adapters according to the methods described herein are tested in a DNA sequencing system as compared to adapters lacking a spacer as described herein. This data is discussed in Example 4.





DETAILED DESCRIPTION

The present invention will be described with respect to particular embodiments and with reference to certain drawings but the invention is not limited thereto but only by the claims. Any reference signs in the claims shall not be construed as limiting the scope. Of course, it is to be understood that not necessarily all aspects or advantages may be achieved in accordance with any particular embodiment of the invention. Thus, for example those skilled in the art will recognize that the invention may be embodied or carried out in a manner that achieves or optimizes one advantage or group of advantages as taught herein without necessarily achieving other aspects or advantages as may be taught or suggested herein.


The invention, both as to organization and method of operation, together with features and advantages thereof, may best be understood by reference to the following detailed description when read in conjunction with the accompanying drawings. The aspects and advantages of the invention will be apparent from and elucidated with reference to the embodiment(s) described hereinafter. Reference throughout this specification to “one embodiment” or “an embodiment” means that a particular feature, structure or characteristic described in connection with the embodiment is included in at least one embodiment of the present invention. Thus, appearances of the phrases “in one embodiment” or “in an embodiment” in various places throughout this specification are not necessarily all referring to the same embodiment, but may. Similarly, it should be appreciated that in the description of exemplary embodiments of the invention, various features of the invention are sometimes grouped together in a single embodiment, figure, or description thereof for the purpose of streamlining the disclosure and aiding in the understanding of one or more of the various inventive aspects. This method of disclosure, however, is not to be interpreted as reflecting an intention that the claimed invention requires more features than are expressly recited in each claim. Rather, as the following claims reflect, inventive aspects lie in less than all features of a single foregoing disclosed embodiment.


It should be appreciated that “embodiments” of the disclosure can be specifically combined together unless the context indicates otherwise. The specific combinations of all disclosed embodiments (unless implied otherwise by the context) are further disclosed embodiments of the claimed invention.


In addition as used in this specification and the appended claims, the singular forms “a”, “an”, and “the” include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to “a polynucleotide” includes two or more polynucleotides, reference to “a motor protein” includes two or more such proteins, reference to “a helicase” includes two or more helicases, reference to “a monomer” refers to two or more monomers, reference to “a pore” includes two or more pores and the like.


All publications, patents and patent applications cited herein, whether supra or infra, are hereby incorporated by reference in their entirety.


Definitions

Where an indefinite or definite article is used when referring to a singular noun e.g. “a” or “an”, “the”, this includes a plural of that noun unless something else is specifically stated. Where the term “comprising” is used in the present description and claims, it does not exclude other elements or steps. Furthermore, the terms first, second, third and the like in the description and in the claims, are used for distinguishing between similar elements and not necessarily for describing a sequential or chronological order. It is to be understood that the terms so used are interchangeable under appropriate circumstances and that the embodiments of the invention described herein are capable of operation in other sequences than described or illustrated herein. The following terms or definitions are provided solely to aid in the understanding of the invention. Unless specifically defined herein, all terms used herein have the same meaning as they would to one skilled in the art of the present invention. Practitioners are particularly directed to Sambrook et al., Molecular Cloning: A Laboratory Manual, 4th ed., Cold Spring Harbor Press, Plainsview, New York (2012); and Ausubel et al., Current Protocols in Molecular Biology (Supplement 114), John Wiley & Sons, New York (2016), for definitions and terms of the art. The definitions provided herein should not be construed to have a scope less than understood by a person of ordinary skill in the art.


“About” as used herein when referring to a measurable value such as an amount, a temporal duration, and the like, is meant to encompass variations of ±20% or ±10%, more preferably ±5%, even more preferably ±1%, and still more preferably ±0.1% from the specified value, as such variations are appropriate to perform the disclosed methods.


“Nucleotide sequence”, “DNA sequence” or “nucleic acid molecule(s)” as used herein refers to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. This term refers only to the primary structure of the molecule. Thus, this term includes double- and single-stranded DNA, and RNA. The term “nucleic acid” as used herein, is a single or double stranded covalently-linked sequence of nucleotides in which the 3′ and 5′ ends on each nucleotide are joined by phosphodiester bonds. The polynucleotide may be made up of deoxyribonucleotide bases or ribonucleotide bases. Nucleic acids may be manufactured synthetically in vitro or isolated from natural sources. Nucleic acids may further include modified DNA or RNA, for example DNA or RNA that has been methylated, or RNA that has been subject to post-translational modification, for example 5′-capping with 7-methylguanosine, 3′-processing such as cleavage and polyadenylation, and splicing. Nucleic acids may also include synthetic nucleic acids (XNA), such as hexitol nucleic acid (HNA), cyclohexene nucleic acid (CeNA), threose nucleic acid (TNA), glycerol nucleic acid (GNA), locked nucleic acid (LNA) and peptide nucleic acid (PNA). Sizes of nucleic acids, also referred to herein as “polynucleotides” are typically expressed as the number of base pairs (bp) for double stranded polynucleotides, or in the case of single stranded polynucleotides as the number of nucleotides (nt). One thousand bp or nt equal a kilobase (kb). Polynucleotides of less than around 40 nucleotides in length are typically called “oligonucleotides” and may comprise primers for use in manipulation of DNA such as via polymerase chain reaction (PCR).


The term “amino acid” in the context of the present disclosure is used in its broadest sense and is meant to include organic compounds containing amine (NH2) and carboxyl (COOH) functional groups, along with a side chain (e.g., a R group) specific to each amino acid. In some embodiments, the amino acids refer to naturally occurring L α-amino acids or residues. The commonly used one and three letter abbreviations for naturally occurring amino acids are used herein: A=Ala; C=Cys; D=Asp; E=Glu; F=Phe; G=Gly; H=His; I=Ile; K=Lys; L=Leu; M=Met; N=Asn; P=Pro; Q=Gln; R=Arg; S=Ser; T=Thr; V=Val; W=Trp; and Y=Tyr (Lehninger, A. L., (1975) Biochemistry, 2d ed., pp. 71-92, Worth Publishers, New York). The general term “amino acid” further includes D-amino acids, retro-inverso amino acids as well as chemically modified amino acids such as amino acid analogues, naturally occurring amino acids that are not usually incorporated into proteins such as norleucine, and chemically synthesised compounds having properties known in the art to be characteristic of an amino acid, such as j-amino acids. For example, analogues or mimetics of phenylalanine or proline, which allow the same conformational restriction of the peptide compounds as do natural Phe or Pro, are included within the definition of amino acid. Such analogues and mimetics are referred to herein as “functional equivalents” of the respective amino acid. Other examples of amino acids are listed by Roberts and Vellaccio, The Peptides: Analysis, Synthesis, Biology, Gross and Meiehofer, eds., Vol. 5 p. 341, Academic Press, Inc., N.Y. 1983, which is incorporated herein by reference.


The terms “polypeptide”, and “peptide” are interchangeably used herein to refer to a polymer of amino acid residues and to variants and synthetic analogues of the same. Thus, these terms apply to amino acid polymers in which one or more amino acid residues is a synthetic non-naturally occurring amino acid, such as a chemical analogue of a corresponding naturally occurring amino acid, as well as to naturally-occurring amino acid polymers. Polypeptides can also undergo maturation or post-translational modification processes that may include, but are not limited to: glycosylation, proteolytic cleavage, lipidization, signal peptide cleavage, propeptide cleavage, phosphorylation, and such like. A peptide can be made using recombinant techniques, e.g., through the expression of a recombinant or synthetic polynucleotide. A recombinantly produced peptide it typically substantially free of culture medium, e.g., culture medium represents less than about 20%, more preferably less than about 10%, and most preferably less than about 5% of the volume of the protein preparation.


The term “protein” is used to describe a folded polypeptide having a secondary or tertiary structure. The protein may be composed of a single polypeptide, or may comprise multiple polypepties that are assembled to form a multimer. The multimer may be a homooligomer, or a heterooligmer. The protein may be a naturally occurring, or wild type protein, or a modified, or non-naturally, occurring protein. The protein may, for example, differ from a wild type protein by the addition, substitution or deletion of one or more amino acids.


A “variant” of a protein encompass peptides, oligopeptides, polypeptides, proteins and enzymes having amino acid substitutions, deletions and/or insertions relative to the unmodified or wild-type protein in question and having similar biological and functional activity as the unmodified protein from which they are derived. The term “amino acid identity” as used herein refers to the extent that sequences are identical on an amino acid-by-amino acid basis over a window of comparison. Thus, a “percentage of sequence identity” is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical amino acid residue (e.g., Ala, Pro, Ser, Thr, Gly, Val, Leu, Ile, Phe, Tyr, Trp, Lys, Arg, His, Asp, Glu, Asn, Gln, Cys and Met) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.


For all aspects and embodiments of the present invention, a “variant” has at least 50%, 60%, 70%, 80%, 90%, 95% or 99% complete sequence identity to the amino acid sequence of the corresponding wild-type protein. Sequence identity can also be to a fragment or portion of the full length polynucleotide or polypeptide. Hence, a sequence may have only 50% overall sequence identity with a full length reference sequence, but a sequence of a particular region, domain or subunit could share 80%, 90%, or as much as 99% sequence identity with the reference sequence.


The term “wild-type” refers to a gene or gene product isolated from a naturally occurring source. A wild-type gene is that which is most frequently observed in a population and is thus arbitrarily designed the “normal” or “wild-type” form of the gene. In contrast, the term “modified”, “mutant” or “variant” refers to a gene or gene product that displays modifications in sequence (e.g., substitutions, truncations, or insertions), post-translational modifications and/or functional properties (e.g., altered characteristics) when compared to the wild-type gene or gene product. It is noted that naturally occurring mutants can be isolated; these are identified by the fact that they have altered characteristics when compared to the wild-type gene or gene product. Methods for introducing or substituting naturally-occurring amino acids are well known in the art. For instance, methionine (M) may be substituted with arginine (R) by replacing the codon for methionine (ATG) with a codon for arginine (CGT) at the relevant position in a polynucleotide encoding the mutant monomer. Methods for introducing or substituting non-naturally-occurring amino acids are also well known in the art. For instance, non-naturally-occurring amino acids may be introduced by including synthetic aminoacyl-tRNAs in the IVTT system used to express the mutant monomer. Alternatively, they may be introduced by expressing the mutant monomer in E. coli that are auxotrophic for specific amino acids in the presence of synthetic (i.e. non-naturally-occurring) analogues of those specific amino acids. They may also be produced by naked ligation if the mutant monomer is produced using partial peptide synthesis. Conservative substitutions replace amino acids with other amino acids of similar chemical structure, similar chemical properties or similar side-chain volume. The amino acids introduced may have similar polarity, hydrophilicity, hydrophobicity, basicity, acidity, neutrality or charge to the amino acids they replace. Alternatively, the conservative substitution may introduce another amino acid that is aromatic or aliphatic in the place of a pre-existing aromatic or aliphatic amino acid. Conservative amino acid changes are well-known in the art and may be selected in accordance with the properties of the 20 main amino acids as defined in Table 1 below. Where amino acids have similar polarity, this can also be determined by reference to the hydropathy scale for amino acid side chains in Table 2.









TABLE 1





Chemical properties of amino acids


















Ala
aliphatic, hydrophobic, neutral
Met
hydrophobic, neutral


Cys
polar, hydrophobic, neutral
Asn
polar, hydrophilic, neutral


Asp
polar, hydrophilic, charged (−)
Pro
hydrophobic, neutral


Glu
polar, hydrophilic, charged (−)
Gln
polar, hydrophilic, neutral


Phe
aromatic, hydrophobic, neutral
Arg
polar, hydrophilic, charged (+)


Gly
aliphatic, neutral
Ser
polar, hydrophilic, neutral


His
aromatic, polar, hydrophilic,
Thr
polar, hydrophilic, neutral



charged (+)


Ile
aliphatic, hydrophobic, neutral
Val
aliphatic, hydrophobic, neutral


Lys
polar, hydrophilic, charged(+)
Trp
aromatic, hydrophobic, neutral


Leu
aliphatic, hydrophobic, neutral
Tyr
aromatic, polar, hydrophobic
















TABLE 2







Hydropathy scale










Side Chain
Hydropathy














Ile
4.5



Val
4.2



Leu
3.8



Phe
2.8



Cys
2.5



Met
1.9



Ala
1.8



Gly
−0.4



Thr
−0.7



Ser
−0.8



Trp
−0.9



Tyr
−1.3



Pro
−1.6



His
−3.2



Glu
−3.5



Gln
−3.5



Asp
−3.5



Asn
−3.5



Lys
−3.9



Arg
−4.5










A mutant or modified protein, monomer or peptide can also be chemically modified in any way and at any site. A mutant or modified monomer or peptide is preferably chemically modified by attachment of a molecule to one or more cysteines (cysteine linkage), attachment of a molecule to one or more lysines, attachment of a molecule to one or more non-natural amino acids, enzyme modification of an epitope or modification of a terminus. Suitable methods for carrying out such modifications are well-known in the art. The mutant of modified protein, monomer or peptide may be chemically modified by the attachment of any molecule. For instance, the mutant of modified protein, monomer or peptide may be chemically modified by attachment of a dye or a fluorophore.


Stalling Motor Proteins

The disclosure relates to method of loading a motor protein onto a polynucleotide adapter comprising a spacer, wherein a blocking moiety prevents the motor protein from moving off the spacer. As explained in more detail below, the method may reduce the rate at which the motor protein turns over fuel molecules compared to when the motor protein is bound to a polynucleotide.


As discussed above, methods for controlling the movement of a motor protein onto a target polynucleotide are known in the art. One method that is known in the art involves preventing the movement of a motor protein onto a target polynucleotide using a spacer. The method involves holding the motor protein at the spacer (e.g. abutting the spacer). The motor protein can be held in this way on, for example, a polynucleotide strand. The motor protein may be directional (i.e. process the polynucleotide in a 5′→3′ or 3′→5′ direction). By providing a spacer between the motor protein and the target polynucleotide in the direction that the motor protein processes, the movement of the motor protein can be constrained by the spacer. On the one hand, the movement of the motor protein onto the target polynucleotide is impeded by the spacer. On the other hand, the movement of the motor protein is also constrained by its directionality meaning that it may not move away from the spacer in the direction away from the target polynucleotide. In this way, a motor protein can be held at (e.g. abutting the spacer), because its movement either “forward” towards the spacer or “backwards” away from the spacer is constrained.


However, constraining a motor protein in this known way typically may not prevent the motor protein from consuming fuel (e.g. cofactors required for polynucleotide processing by the motor protein) which may be present in the reaction conditions. Without being bound by theory, stalling a motor protein at a spacer is believed to result in “slippage” of the motor protein. The motor protein is loaded onto the polynucleotide adapter and progresses until it reaches the spacer in the manner described above. The movement of the motor protein is stalled when it reaches the spacer. However, the motor protein does not remain stationary at the spacer. Rather, the motor protein is believed to periodically disengage from being bound to the polynucleotide adapter adjacent to the spacer, causing the motor protein to diffuse back along the polynucleotide adapter away from the spacer. The motor protein then re-engages with the polynucleotide adapter and progresses until it reaches the spacer again, following which the cycle is repeated. The successive disengagement of the motor protein from the polynucleotide adapter, re-engagement with the polynucleotide adapter and progression of the motor protein along the polynucleotide adapter to the spacer consumes fuel present in the system, despite being associated with no overall progress of the motor protein. This non-productive consumption of fuel by a motor protein which is stalled at a spacer is termed futile turnover.


Futile turnover is undesirable and decreases the overall efficiency of the system. For example, if a motor protein is stalled at a spacer in the manner described for a prolonged period of time, the quantity of fuel consumed by the motor protein in futile turnover can be significant. Such unproductive fuel use can significantly limit the lifetime of the system e.g. in storage. The decrease of fuel may for example also undesirably reduce the speed of the motor protein. Futile turnover may require the quantity of fuel in the reaction system being initially and undesirably increased to take account of this undesired consumption. The requirements for high purity fuel in order to avoid artefacts caused by impurities during the characterisation of the target polynucleotide means that futile turnover can significantly increase costs. Furthermore, if the motor protein is negatively affected by high concentrations of spent fuel molecules (i.e. fuel molecules which have been turned over by the motor protein such as ADP) then the control which the motor protein exerts on the target polynucleotide being characterised can be decreased and/or the speed of the motor protein can be undesirably decreased.


In seeking to address this it has been surprisingly found that futile turnover can be decreased or prevented by stalling the motor protein on a spacer. In particular, by preventing the movement of the motor protein off the spacer, futile turnover is reduced. In other words, the rate at which the motor protein turns over fuel molecules compared to when it is bound to a polynucleotide is reduced. Suitable spacers are described in more detail herein.


In developing the presently claimed methods it has surprisingly been found that a motor protein can be beneficially prevented from moving off a spacer comprised in a polynucleotide adapter by binding a blocking moiety to the polynucleotide adapter. The blocking moiety can for example sterically prevent the motor protein from moving off the spacer. The blocking moiety can chemically prevent the motor protein from moving off the spacer. Blocking moieties are described in more detail herein.


Accordingly provided herein is a method of loading a motor protein onto a polynucleotide adapter, the method comprising:

    • i) providing a polynucleotide adapter comprising a spacer;
    • ii) contacting the polynucleotide adapter with a motor protein; and
    • iii) positioning the motor protein on the spacer;
    • wherein a blocking moiety bound to the polynucleotide adapter prevents the motor protein from moving off the spacer.


In one embodiment, provided herein is a method of loading a motor protein onto a polynucleotide adapter, the method comprising:

    • i) providing a polynucleotide adapter comprising a spacer;
    • ii) contacting the polynucleotide adapter with a motor protein;
    • iii) causing the motor protein to progress onto the spacer; and
    • iv) binding a blocking moiety to the polynucleotide adapter, wherein the blocking moiety prevents the motor protein from moving off the spacer.


In some embodiments, the polynucleotide comprises a loading site connected to a spacer. In some embodiments, the loading site may be contacted with a motor protein. Contacting the loading site with a motor protein causes the motor protein to progress from the loading site onto the spacer. In embodiments in which the polynucleotide adapter comprises a loading site, binding a blocking moiety to the polynucleotide adapter typically prevents the motor protein from moving off the spacer and onto the loading site. Loading sites are described in more detail herein.


Accordingly, in some embodiments, the provided methods comprise (i) contacting the loading site with a motor protein, wherein the motor protein engages with the loading site; and (ii) binding a blocking moiety to the polynucleotide adapter, wherein the blocking moiety prevents the motor protein from moving off the spacer and re-engaging with the loading site.


In other embodiments, the polynucleotide adapter does not comprise a loading site. In such embodiments the motor protein is typically contacted with the polynucleotide adapter e.g. at the spacer; i.e the motor protein may be contacted with the spacer. The motor protein is positioned on the spacer. The motor protein may be positioned on the spacer by any suitable means. For example, as described in more detail herein, the motor protein may be contacted with the spacer and subsequently the motor protein may be modified in order to prevent the motor protein from disengaging from the spacer. The spacer may be flanked by a blocking moiety to prevent the motor protein from moving off the spacer. The spacer may in some embodiments comprise natural nucleotides in addition to spacer units. This is described in more detail herein.


Polynucleotide Adapter

The provided methods comprise loading a motor protein onto a polynucleotide adapter. WO 2015/110813 describes the loading of motor proteins onto a target polynucleotide such as an adapter, and is hereby incorporated by reference in its entirety.


An adapter typically comprises a polynucleotide strand capable of being attached to the end of a target polynucleotide. The target polynucleotide is typically intended for characterisation in accordance with methods disclosed herein.


The polynucleotide adapter may be added to both ends of the target polynucleotide. Alternatively, different adapters may be added to the two ends of the target polynucleotide. An adapter may be added to just one end of the target polynucleotide. Methods of adding adapters to polynucleotides are known in the art. Adapters may be attached to polynucleotides, for example, by ligation, by click chemistry, by tagmentation, by topoisomerisation or by any other suitable method.


In one embodiment, the adapter is synthetic or artificial. Typically, the adapter comprises a polymer as described herein. The adapter comprises a spacer as described herein. As explained in more detail below, the adapter may also comprise a loading site, e.g. a loading site connected to a spacer. Loading sites are described in more detail herein.


In some embodiments, the adapter comprises a polynucleotide. For example, as explained below, the loading site may comprise a single-stranded polynucleotide strand. The polynucleotide adapter may comprise DNA, RNA, modified DNA (such as a basic DNA), RNA, PNA, LNA, BNA and/or PEG. Usually, the adapter comprises single stranded and/or double stranded DNA or RNA.


In one embodiment, the adapter is a Y adapter. A Y adapter is typically a polynucleotide adapter. A Y adapter is typically double stranded and comprises (a) at one end, a region where the two strands are hybridised together and (b), at the other end, a region where the two strands are not complementary. The non-complementary parts of the strands form overhangs. The presence of a non-complementary region in the Y adapter gives the adapter its Y shape since the two strands typically do not hybridise to each other unlike the double stranded portion. As explained in more detail below, in one embodiment a motor protein may bind to an overhang of an adapter such as a Y adapter. In another embodiment, a motor protein may bind to the double stranded region. In other embodiments, a motor protein may bind to a single-stranded and/or a double-stranded region of the adapter. In other embodiments, a first motor protein may bind to the single-stranded region of such an adapter and a second motor protein may bind to the double-stranded region of the adapter.


In one embodiment the adapter comprises a membrane anchor or a pore anchor as described in more detail herein. In some embodiments, the anchor may be attached to a polynucleotide that is complementary to and hence that is hybridised to the overhang to which an nucleic acid handling enzyme is bound.


In some embodiments, one of the non-complementary strands of a polynucleotide adapter such as a Y adapter may comprise a leader sequence, which when contacted with a transmembrane pore is capable of threading into a nanopore. In one embodiment, the leader sequence may comprise a loading site as described in more detail herein. In one embodiment the leader sequence may precede the loading site (i.e. the adapter may comprise a leader sequence connected to a loading site, the loading site being connected to the spacer, such that the loading site is located between the leader sequence and the spacer). In one embodiment, the loading site may precede the leader sequence (i.e. the adapter may comprise a loading site connected to a leader sequence, the leader sequence being connected to the spacer, such that the leader sequence is located between the loading site and the spacer).


The leader sequence typically comprises a polymer such as a polynucleotide, for instance DNA or RNA, a modified polynucleotide (such as abasic DNA), PNA, LNA, polyethylene glycol (PEG) or a polypeptide. In some embodiments, the leader sequence comprises a single strand of DNA, such as a poly dT section. The leader sequence can be any length, but is typically 10 to 150 nucleotides in length, such as from 20 to 120, 30 to 100, 40 to 80 or 50 to 70 nucleotides in length.


In one embodiment, the polynucleotide adapter is a hairpin loop adapter. A hairpin loop adapter is an adapter comprising a single polynucleotide strand, wherein the ends of the polynucleotide strand are capable of hybridising to each other, or are hybridized to each other, and wherein the middle section of the polynucleotide forms a loop. Suitable hairpin loop adapters can be designed using methods known in the art.


As explained in more detail below, a polynucleotide adapter can be attached to a target polynucleotide in order to characterise the target polynucleotide.


Those skilled in the art will appreciate that the adapters described for use in the methods provided herein thus reduce futile turnover by a motor protein stalled thereon compared to adapters lacking a blocking moiety as described herein. Typically, the adapters described for use in the methods provided herein improve the efficiency of fuel usage compared to adapters lacking a blocking moiety as provided herein.


Those skilled in the art will also appreciate that when the adapter comprises a polynucleotide strand, the sequence of the adapter is typically not determinative and can be controlled or chosen according to the motor protein and other experimental conditions such as any polynucleotide to be characterised. Exemplary sequences are provided solely by way of illustration in the examples. For example, the adapter may comprise a sequence such as SEQ ID NO: 13 or a polynucleotide sequence having at least 20%, such as at least 30%, e.g. at least 40% such as at least 50%, e.g. at least 60% such as at least 70%, e.g. at least 80%, for example at least 90% e.g. at least 95% sequence similarity or identity to SEQ ID NO: 13. The adapter may comprise a spacer as described herein flanked by sequences such as those provided in SEQ ID NOs: 14 and 15, or polynucleotide sequences independently having at least 20%, such as at least 30%, e.g. at least 40% such as at least 50%, e.g. at least 60% such as at least 70%, e.g. at least 80%, for example at least 90% e.g. at least 95% sequence similarity or identity to SEQ ID NOs: 14 and 15. Those skilled in the art will appreciate that SEQ ID NO: 14 comprises a sequence such as SEQ ID NO: 15 and the adapter may thus comprise a polynucleotide sequence such as SEQ ID NO: 15 or a polynucleotide sequence having at least 20%, such as at least 30%, e.g. at least 40% such as at least 50%, e.g. at least 60% such as at least 70%, e.g. at least 80%, for example at least 90% e.g. at least 95% sequence similarity or identity to SEQ ID NO: 15. The sequence of the adapter can typically be altered without negatively affecting the reduction in futile turnover provided by a given spacer.


Spacer(s)

The disclosed method comprise loading a motor protein onto a polynucleotide adapter comprising a spacer. One or more spacers may be present in the polynucleotide adapter. For example, the polynucleotide adapter may comprise from one to about 10 spacers, e.g. from 1 to about 5 spacers, e.g. 1, 2, 3, 4 or 5 spacers. The term “spacer” and “stalling site” may be used interchangeably and refer to a portion of the polynucleotide adapter which stalls the motor protein, typically preventing futile turnover as described above. The spacer (stalling site) may comprise any suitable number of spacer units. Suitable spacer units are described herein and include abasic nucleotides and spacer groups such as iSp9, iSp18, and C3 groups (described below). The spacer (stalling site) may comprise nucleotide units in addition to spacer units. For example, as described in more detail herein, the spacer (stalling site) may comprise spacer units interspaced by one or more nucleotides. The spacer (stalling site) may comprise one or more spacer units flanked or separated by one or more nucleotide units, such as one or more polynucleotides. This concept is sometimes referred to as “nucleotide islands” and is discussed further below.


The one or more spacers are included in the polynucleotide adapter. Typically the polynucleotide adapter may comprise strands of single stranded and/or double stranded polynucleotides and the one or more spacers may be comprised in the polynucleotide strands, e.g. interrupting a strand or separating one strand from another. Exemplary polynucleotide adapters are described in more detail herein.


Each spacer in the polynucleotide adapter provides an energy barrier which impedes movement of the motor protein. For example, a spacer may stall the motor protein by reducing the traction of the motor protein. This may be achieved for instance by using an abasic spacer i.e. a spacer in which the bases are removed from one or more nucleotides in the polynucleotide adapter. A spacer may physically block movement of the motor protein, for instance by introducing a bulky chemical group to physically impede the movement of the motor protein.


A spacer may comprise any molecule or combination of molecules that stalls the one or more motor protein(s). A spacer may comprise any molecule or combination of molecules that prevents the motor protein from moving along the target polynucleotide. It is straightforward to determine whether or not the motor protein is stalled at a spacer. For example, this can be assayed as discussed in WO 2014/135838, the contents of which are incorporated by reference—for instance, the ability of a motor protein to move past a spacer and displace a complementary strand of DNA can be measured by PAGE.


In some embodiments, a spacer may comprise a linear molecule, such as a polymer. Typically, such a spacer has a different structure from the target polynucleotide. For instance, if the target polynucleotide is DNA, the or each spacer typically does not comprise DNA. In particular, if the target polynucleotide is deoxyribonucleic acid (DNA) or ribonucleic acid (RNA), the or each spacer preferably comprises peptide nucleic acid (PNA), glycerol nucleic acid (GNA), threose nucleic acid (TNA), locked nucleic acid (LNA), bridged nucleic acid (BNA) or a synthetic polymer with nucleotide side chains.


In some embodiments, a spacer may comprise one or more nitroindoles, one or more inosines, one or more acridines, one or more 2-aminopurines, one or more 2-6-diaminopurines, one or more 5-bromo-deoxyuridines, one or more inverted thymidines (inverted dTs), one or more inverted dideoxy-thymidines (ddTs), one or more dideoxy-cytidines (ddCs), one or more 5-methylcytidines, one or more 5-hydroxymethylcytidines, one or more 2′-O-Methyl RNA bases, one or more Iso-deoxycytidines (Iso-dCs), one or more Iso-deoxyguanosines (Iso-dGs), one or more C3 (OC3H6OPO3) groups, one or more photo-cleavable (PC) [OC3H6—C(O)NHCH2—C6H3NO2—CH(CH3)OPO3] groups, one or more hexandiol groups, one or more spacer 9 (iSp9) [(OCH2CH2)3OPO3] groups, or one or more spacer 18 (iSp18) [(OCH2CH2)6OPO3] groups; or one or more thiol connections. A spacer may comprise any combination of these groups. Many of these groups are commercially available from IDT® (Integrated DNA Technologies®). For example, C3, iSp9 and iSp18 spacers are all available from IDT®.


A spacer may comprise any number of the above groups as spacer units. For instance, a spacer may comprise from 1 to about 12 or more (e.g. from about 1 to about 8, for instance from 1 to about 6 such as from 1 to about 4) spacers selected from 2-aminopurines, 2-6-diaminopurines, 5-bromo-deoxyuridines, inverted dTs, ddTs, ddCs, 5-methylcytidines, 5-hydroxymethylcytidines, 2′-O-Methyl RNA bases, Iso-dCs, Iso-dGs, iSpC3 groups, PC groups, hexandiol groups and thiol connections. A spacer may for instance comprise 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 of such groups.


A spacer may comprise from 1 to about 12 or more (e.g. from about 1 to about 8, for instance from 1 to about 6 such as from 1 to about 4) C3 groups; for instance a spacer may comprise 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 C3 groups. A C3 group is typically a —OC3H6OPO3— group.


A spacer may comprise from about 1 to about 8 or more (e.g. from about 1 to about 6 such as from 1 to about 4) iSp9 groups; for instance a spacer may comprise 2, 3, 4, 5, 6, 7 or 8 iSp9 groups. An iSp9 group is typically a —(OCH2CH2)3OPO3— group.


A spacer may comprise from about 1 to about 8 or more (e.g. from about 1 to about 6 such as from 1 to about 4) iSp18 groups; for instance a spacer may comprise 2, 3, 4, 5, 6, 7 or 8 iSp9 groups. An iSp18 group is typically a —(OCH2CH2)6OPO3— group. In one embodiment the spacer comprises 4 iSp18 groups.


In some embodiments, the spacer comprises one or more iSp18 group(s) and/or one ore more iSp9 group(s) and/or one or more C3 group(s).


In some embodiments, a spacer may comprise one or more chemical groups which cause the motor protein to stall. In some embodiments, suitable chemical groups are one or more pendant chemical groups. The one or more chemical groups may be attached to one or more nucleobases in the polynucleotide adapter. The one or more chemical groups may be attached to the backbone of the polynucleotide adapter. Any number of appropriate chemical groups may be present, such as 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more. Suitable groups include, but are not limited to, fluorophores, streptavidin and/or biotin, cholesterol, methylene blue, dinitrophenols (DNPs), digoxigenin and/or anti-digoxigenin and dibenzylcyclooctyne groups.


In some embodiments, a spacer may comprise a polymer. In some embodiments the spacer may comprise a polymer which is a polypeptide or a polyethylene glycol (PEG).


When the spacer comprises a polypeptide, the polypeptide may comprise any number of amino acids. For example, the polypeptide may comprise from about 1 to about 12 or more (e.g. from about 1 to about 8, for instance from 1 to about 6 such as from 1 to about 4) amino acids; for instance a spacer may comprise 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 amino acids.


When the spacer comprises a polymer such as PEG (polyethylene glycol), the polymer may comprise any number of monomer units. For example, the polymer may comprise from about 1 to about 12 or more (e.g. from about 1 to about 8, for instance from 1 to about 6 such as from 1 to about 4) monomer units; for instance a spacer may comprise 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 monomer (e.g. PEG) units.


In some embodiments, a spacer may comprise one or more abasic nucleotides (i.e. nucleotides lacking a nucleobase), such as 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more abasic nucleotides. The nucleobase can be replaced by —H (idSp) or —OH in the abasic nucleotide. Abasic spacers can be inserted into target polynucleotides by removing the nucleobases from one or more adjacent nucleotides. For instance, polunucleotides may be modified to include 3-methyladenine, 7-methylguanine, 1,N6-ethenoadenine inosine or hypoxanthine and the nucleobases may be removed from these nucleotides using Human Alkyladenine DNA Glycosylase (hAAG). Alternatively, polunucleotides may be modified to include uracil and the nucleobases removed with Uracil-DNA Glycosylase (UDG). In one embodiment, the one or more spacers do not comprise any abasic nucleotides.


In some embodiments, the spacer may comprise one or more nucleotide units, also referred to as nucleotide islands. The spacer typically does not comprise a polynucleotide strand sufficiently long to fully occupy the active site of the motor protein. For example, in embodiments in which the spacer comprises one or more nucleotide units, the spacer typically comprises from 1 to 3 nucleotides, more often from 1 to 2 nucleotides. In some embodiments the spacer comprises from 1 to 3 contiguous nucleotides in the or each nucleotide island present in the spacer. In some embodiments a spacer may comprise from 1 to 5 nucleotide islands, e.g. 1, 2 or 3 nucleotide islands each comprising from 1 to 3 contiguous nucleotides. Those skilled in the art will recognise that the active site (polynucleotide-binding cleft) of motor proteins is typically of size corresponding to around 8 nucleotide units. As such, in embodiments in which the spacer comprises from 1 to 3, e.g. from 1 to 2 nucleotide spacer units, the nucleotide spacer units do not fully occupy the active site of the motor protein. In some embodiments, exemplary spacers (stalling sites) which comprise from 1 to 3, e.g. from 1 to 2 nucleotides typically comprise one or more moieties selected from —[(S)x—(N)y—(S)z]w— wherein each S is a spacer unit (e.g. a spacer unit described herein); each N is a nucleotide; x is an integer from 1 to 7; y is an integer from 1 to 3, typically 1 or 2; z is an integer from 1 to 7 and w is an integer from 1 to 3; and wherein each S is the same or different and each N is the same or different. More often in such embodiments, each S is a spacer unit independently selected from C3, iSp9 and iSp18 spacer units; each N is independently selected from adenine, cytosine, guanine, and thymine; x is an integer from 1 to 7; y is 1 or 2; z is an integer from 1 to 4 and w is an integer from 1 to 3.


In some embodiments the spacer may comprise one or more nucleotide islands and the adapter may have a blocking moiety as defined herein bound thereto prior to the contacting of the motor protein with the adapter. In such embodiments the motor protein may thus directly load onto the spacer. The motor protein may be loaded onto a nucleotide island comprised within the spacer. The motor protein may be loaded onto a nucleotide island comprised with in the spacer and then be modified to prevent the motor protein from leaving the spacer, e.g. by dissociating from the spacer. Modification of motor proteins is described in more detail herein. In some embodiments the motor protein may be loaded onto a nucleotide island and then progress onto spacer units comprised in the spacer. In some embodiments the motor protein may remain located at the nucleotide island(s) in the spacer until a force is applied to move the motor protein off the islands. In some embodiments the force is provided by a nanopore as described herein.


In some embodiments the spacer may comprise one or more moieties selected from: —S—N—N—S—S—; —S—N—S—N—S—; —S—S—N—N—S—; —S—S—N—S—S—; —N—N—S—N—N—S—; —S—S—N—N—S—S—; —S—N—N—S—N—N—S—; —S—N—S—N—S—N—S—; —S—S—S—S—S—S—S—; —S—S—N—N—S—N—N—S—; —S—S—S—S—N—N—S—S—; —S—N—N—S—S—N—N—S—S—; —S—S—N—N—N—S—N—N—S—; —S—S—N—N—S—N—N—N—S—; —S—S—N—N—S—N—N—S—S—; —S—S—S—N—N—N—S—N—S—; —S—S—S—N—S—N—N—N—S—; —S—S—S—S—N—N—S—N—S—; —S—S—S—S—N—S—N—N—S—; —S—N—N—S—N—N—S—N—N—S—; —S—S—S—N—N—S—N—N—S—S—; —S—S—S—N—N—S—S—N—N—S—; —S—S—S—S—S—S—N—N—S—S—; —N—N—S—N—N—S—S—S—S—S—S—; —N—N—S—S—N—N—S—S—S—S—S—; —N—N—S—S—S—N—N—S—S—S—S—; —N—N—S—S—S—S—N—N—S—S—S—; —N—N—S—S—S—S—S—N—N—S—S—; —N—N—S—S—S—S—S—S—N—N—S—; —S—N—N—S—N—N—S—S—S—S—S—; —S—N—N—S—S—N—N—S—S—S—S—; —S—N—N—S—S—S—N—N—S—S—S—; —S—N—N—S—S—S—S—N—N—S—S—; —S—N—N—S—S—S—S—S—N—N—S—; —S—S—N—N—S—N—N—S—S—S—S—; —S—S—N—N—S—S—N—N—S—S—S—; —S—S—N—N—S—S—S—N—N—S—S—; —S—S—N—N—S—S—S—S—N—N—S—; —S—S—S—N—N—S—N—N—S—S—S—; —S—S—S—N—N—S—S—N—N—S—S—; —S—S—S—S—N—N—S—N—N—S—S—; —S—S—S—S—N—N—S—S—N—N—S—; —S—S—S—S—S—N—N—S—N—N—S—; —S—S—S—N—N—S—N—N—S—N—N—S—; —S—S—S—N—N—S—N—N—S—S—S—S—; —S—S—S—N—N—S—S—N—N—S—S—S—; —S—S—S—N—N—S—S—S—S—N—N—S—; —S—S—S—N—N—S—N—N—S—S—N—N—S—; —S—S—S—N—N—S—S—N—N—S—S—S—S—; —S—S—S—S—S—N—N—S—N—N—S—S—S—; —S—S—S—N—N—S—S—N—N—S—S—S—S—S—; —S—S—S—N—N—S—S—S—S—S—S—N—N—S—; —S—S—S—S—S—N—N—S—N—N—S—N—N—S—; —S—S—S—N—N—S—S—N—N—S—S—S—S—S—S—; —S—S—S—S—S—N—N—S—N—N—S—S—N—N—S—; —S—S—S—N—N—S—S—N—N—S—S—S—S—S—S—S—; —S—S—S—N—N—S—S—N—N—S—S—S—S—S—S—S—S—; etc; wherein each S is a spacer unit as described herein and each N is a nucleotide.


In some embodiments the spacer may comprise one or more moieties selected from: —S—N—S—N—S—N—S—; —S—N—N—S—N—N—S—N—N—S—; —S—S—S—S—S—S—N—N—S—S—; —S—S—S—S—S—N—N—S—N—N—S—S—S—; —S—S—S—N—N—S—N—N—S—S—N—N—S—; —S—S—S—S—S—N—N—S—N—N—S—S—N—N—S—; —S—S—S—N—N—S—N—N—S—N—N—S—; —N—N—S—S—N—N—S—S—S—S—S—; —S—N—N—S—S—N—N—S—S—S—S—; —S—S—N—N—S—S—N—N—S—S—S—; —S—S—S—S—N—N—S—S—N—N—S—; —N—N—S—N—N—S—S—S—S—S—S—; —S—N—N—S—N—N—S—S—S—S—S—; —S—S—N—N—S—N—N—S—S—S—S—; —S—S—S—N—N—S—N—N—S—S—S—: —S—S—S—S—N—N—S—N—N—S—S—; —S—S—S—N—N—S—S—N—N—S—; etc; wherein each S is a spacer unit as described herein and each N is a nucleotide.


In some embodiments the spacer may comprise one or more moieties selected from: —S—N—N—S—N—N—S—N—N—S—; —S—S—S—S—S—N—N—S—N—N—S—S—S—; —N—N—S—S—N—N—S—S—S—S—S—; —S—N—N—S—S—N—N—S—S—S—S—; —S—S—N—N—S—S—N—N—S—S—S—; —S—S—S—S—N—N—S—S—N—N—S—; —S—S—N—N—S—N—N—S—S—S—S—; —S—S—S—N—N—S—N—N—S—S—S—: —S—S—S—S—N—N—S—N—N—S—S—; —S—S—S—N—N—S—S—N—N—S—; etc; wherein each S is a spacer unit as described herein and each N is a nucleotide.


In some embodiments the spacer may comprise one or more moieties selected from: —S—S—S—S—S—N—N—S—N—N—S—S—S—; —N—N—S—S—N—N—S—S—S—S—S—; —S—N—N—S—S—N—N—S—S—S—S—; —S—S—N—N—S—S—N—N—S—S—S—; —S—S—S—S—N—N—S—S—N—N—S—; —S—S—S—N—N—S—S—N—N—S—; etc; wherein each S is a spacer unit as described herein and each N is a nucleotide.


In some embodiments the spacer may comprise one or more moieties selected from: —S—S—N—N—S—S—; —S—N—S—N—S—N—S; —S—N—N—S—N—N—S—N—N—S—; —S—S—S—S—N—N—S—S—; —S—S—S—S—S—S—N—N—S—S—; —S—S—S—N—N—S—N—N—S—N—N—S—; —S—S—S—S—S—N—N—S—N—N—S—N—N—S—; S—S—S—N—N—S—N—N—S—S—S—; —S—S—S—S—S—N—N—S—N—N—S—S—S—; —S—S—S—N—N—S—N—N—S—S—N—N—S—; and —S—S—S—S—S—N—N—S—N—N—S—S—N—N—S—; etc; wherein each S is a spacer unit as described herein and each N is a nucleotide. In some embodiments, each S is the same spacer unit. In some embodiments, the S groups are different spacer units. In some embodiments a spacer may comprise both nucleotide based spacer units (e.g. modified nucleotides such as, 2′-O-Methyl RNA bases) and non-nucleotide based spacer units (such as iSp18, iSp9 and C3 spacer units). In some embodiments each S is independently selected from iSp18 groups, iSp9 groups, 2′-O-Methyl uridine and C3 groups. In some embodiments each S is independently selected from iSp18 groups, iSp9 groups and C3 groups. In some embodiments each S independently is selected from iSp18 groups, 2′-O-Methyl uridine and C3 groups. In some embodiments each S independently is selected from iSp18 groups and C3 groups. In some embodiments each N is the same nucleotide. In some embodiments, the N groups in the above moieties are different. In some embodiments each N group is independently selected from adenine, cytosine, guanine, and thymine. In some embodiments each N group is independently selected from cytosine and thymine. In some embodiments each N group is a thymine group.


In some embodiments, the spacer may comprise one or more moieties selected from: -8-T-T-9-T-T-8-; -8-T-8-T-8-T-8-; -8-T-T-8-T-T-8-T-T-8-; -3-3-8-8-T-T-8-8-; -3-3-3-3-8-8-T-T-8-8-; -3-3-3-3-8-T-T-8-T-T-8-3-8-; -3-3-8-T-T-8-T-T-8-3-T-T-8-; -3-3-3-3-8-T-T-8-T-T-8-3-T-T-8-; -3-3-3-T-T-8-T-T-8-T-T-8-; -3-3-3-T-T-8-T-T-8-; -3-T-T-8-T-T-8-T-T-8-; -T-T-3-3-T-T-3-3-3-3-8-; -3-T-T-3-3-T-T-3-3-3-8-; -3-3-T-T-3-3-T-T-3-3-8-; -3-3-3-3-T-T-3-3-T-T-8-; -T-T-3-3-3-T-T-3-3-3-8-; -T-T-8-T-T-3-3-3-3-3-8-; -3-T-T-8-T-T-3-3-3-3-8-; -3-3-T-T-8-T-T-3-3-3-8-; -3-3-3-T-T-8-T-T-3-3-8-; -3-3-3-3-T-T-8-T-T-3-8-; -3-3-3-T-T-3-3-T-T-9-; -3-3-3-T-T-mU-mU-mU-T-T-8-; -3-3-3-T-T-mU-mU-T-T-8-; wherein 3 is first spacer and 8 is a second spacer and 9 is a third spacer and mU is a fourth spacer; typically wherein 3 is a C3 spacer as defined herein and 8 is an iSp18 spacer as defined herein and 9 is an iSp9 spacer as defined herein and mU is 2′-O-Methyl uridine; and each N is independently selected from adenine, cytosine, guanine, and thymine; preferably thymine.


In some embodiments, the spacer may comprise one or more moieties selected from: -8-8-N—N-8-8-; -8-N-8-N-8-N-8; -8-N—N-8-N—N-8-N—N-8-; -3-3-8-8-N—N-8-8-; -3-3-3-3-8-8-N—N-8-8-; -3-3-8-N—N-8-N—N-8-N—N-8-; -3-3-3-3-8-N—N-8-N—N-8-N—N-8-; 3-3-8-N—N-8-N—N-8-3-8-; -3-3-3-3-8-N—N-8-N—N-8-3-8-; -3-3-8-N—N-8-N—N-8-3-N—N-8-; and -3-3-3-3-8-N—N-8-N—N-8-3-N—N-8-; wherein 3 is first spacer and 8 is a second spacer; typically wherein 3 is a C3 spacer as defined herein and 8 is an iSp18 or iSp9 spacer as defined herein, typically 8 is an iSp18 spacer as defined herein; and each N is independently selected from adenine, cytosine, guanine, and thymine; preferably thymine.


In some embodiments the spacer may comprise one or more moieties selected from: 88TTT88; 88mUmUmU88; 88/iBNA-T//iBNA-T//iBNA-T/88; 88T88; 8TT88; 88TT8; 8T8T8; 99TT9TT99; 8TT9TT8; 8TT3TT8; 8T8T8T8; 8TT8TT8TT8; 3388TT88; 333388TT88; 338TT8TT8TT8; 33338TT8TT8TT8; 338TT8TT838; 33338TT8TT838; 338TT8TT83TT8; 33338TT8TT83TT8; 8TT8TT8; TT8TT8; 3TT8TT8; 333TT8TT8TT8; 333TT8TT8; 3TT8TT8TT8; 33TT8TT8; 333TT8TT838; 33338TT8TT8; 333TT333333TT8; 333TT99TT8; 333TT9TT8; 333TT3TT8; 9TT8TT8; 99TT8TT8; 3333T8TT8; 3333TT8T8; 333T8TTT8; 333TTT8T8; 33TTT8TT8; 33TT8TTT8; 9TT99TT99; 333TT8TT9999; 333TT8TT999; 333TT8TT99; 333TT8TT9; TT3TT333338; 3TT3TT33338; 33TT3TT3338; 333TT3TT338; 3333TT3TT38; 33333TT3TT8; TT33TT33338; 3TT33TT3338; 33TT33TT338; 333TT33TT38; 3333TT33TT8; TT333TT3338; 3TT333TT338; 33TT333TT38; 333TT333TT8; TT3333TT338; 3TT3333TT38; 33TT3333TT8; TT33333TT38; 3TT33333TT8; TT333333TT8; TT8TT333338; 3TT8TT33338; 33TT8TT3338; 333TT8TT338; 3333TT8TT38; 33333TT8TT8; 333TT33TT8; 333TT33TT9; 333TTmUmUmUTT8; 333TTSpSpTT8; 333TTSpTT8; 9TT33TT99; 333TTmUmUTT8; 333TTrUTT8; 333TTrUrUTT8; 333TTrUrUrUTT8; 333TTrUrUrUrUTT8; 333TT33TTC12; 333TT33TTC6; mUmUmUTTmUmUTT8; mUmUmUTT33TT8; 333TT33TT88; 333TT33TT888; 333TT33TT8888; 333TT33TT99; 333TT33TT999; 333TT33TT9999; 333TT33TT333; 333TT33TT3333; 333TT33TT33333; 333TT33TT333333; 333TT33TT3333333; and 333TT33TT33333333.


In some embodiments the spacer may comprise one or more moieties selected from: 88mUmUmU88; 88/iBNA-T//iBNA-T//iBNA-T/88; 88T88; 88TT88; 8TT88; 88TT8; 8T8T8; 8TT9TT8; 8TT3TT8; 8T8T8T8; 8TT8TT8TT8; 3388TT88; 333388TT88; 33338TT8TT838; 338TT8TT83TT8; 33338TT8TT83TT8; 8TT8TT8; TT8TT8; 3TT8TT8; 333TT8TT8TT8; 333TT8TT8; 3TT8TT8TT8; TT3TT333338; 3TT3TT33338; 33TT3TT3338; 333TT3TT338; 3333TT3TT38; 33333TT3TT8; TT33TT33338; 3TT33TT3338; 33TT33TT338; 3333TT33TT8; TT333TT3338; 3TT333TT338; 33TT333TT38; TT3333TT338; 3TT3333TT38; 33TT3333TT8; TT33333TT38; 3TT33333TT8; TT333333TT8; TT8TT333338; 3TT8TT33338; 33TT8TT3338; 333TT8TT338; 3333TT8TT38; 33333TT8TT8; 333TT33TT9; 333TTmUmUmUTT8; 333TTSpSpTT8; 333TTSpTT8; 333TTmUmUTT8; and 333TT33TT8.


In some embodiments, the spacer may comprise one or more moieties selected from: -8-8-T-T-8-8-; -8-T-8-T-8-T-8; -8-T-T-8-T-T-8-T-T-8-; -3-3-8-8-T-T-8-8-; -3-3-3-3-8-8-T-T-8-8-; -3-3-8-T-T-8-T-T-8-T-T-8-; -3-3-3-3-8-T-T-8-T-T-8-T-T-8-; 3-3-8-T-T-8-T-T-8-3-8-; -3-3-3-3-8-T-T-8-T-T-8-3-8-; -3-3-8-T-T-8-T-T-8-3-T-T-8-; and -3-3-3-3-8-T-T-8-T-T-8-3-T-T-8-; wherein 3 is first spacer and 8 is a second spacer; typically wherein 3 is a C3 spacer as defined herein and 8 is an iSp18 or iSp9 spacer as defined herein, typically 8 is an iSp18 spacer as defined herein; and each T is thymine.


In some embodiments, the polynucleotide adapter comprises more than one spacer. Ins such embodiments, the two or more spacers may be the same or different. For example, one spacer may comprise one of the linear molecules discussed herein and another spacer may comprise one or more chemical groups which physically cause the one or more motor proteins to stall. A spacer may comprise any of the linear molecules discussed herein and one or more chemical groups which physically cause the one or more motor proteins to stall, such as one or more abasics and a fluorophore.


Suitable spacers can be designed or selected depending on the nature of the polynucleotide adapter, the motor protein and the conditions under which the method is to be carried out. For example, many motor proteins process DNA in vivo and such motor proteins may typically be stalled using anything that is not DNA.


Characterisation of a target polynucleotide is often carried out in the presence of free nucleotides and/or fuel molecules (cofactors for the motor protein). In the disclosed methods the motor protein is typically prevented from moving off the spacer in the presence of free nucleotides and/or fuel molecules (cofactors for the motor protein). If the polynucleotide adapter is to be used in methods which do not involve the presence of free nucleotides and/or fuel molecules, the motor protein is typically prevented from moving off the spacer in the absence of free nucleotides and/or fuel molecules. Different spacers may be used in these embodiments. For example, in embodiments wherein free nucleotides and/or fuel molecules are present, a longer spacer may beneficially be used compared to embodiments wherein free nucleotides and/or fuel molecules are not present.


In some embodiments, it is beneficial to design or select a suitable spacer for use in accordance with the disclosed methods according to the salt concentration that is present in the reaction conditions. For example, methods comprising characterisation of a target polynucleotide strand by moving the polynucleotide strand with respect to a nanopore often involve the use of relatively high salt concentrations. The salt concentration may affect the ability of the one or more spacers to stall the one or more motor proteins. In general, the higher the salt concentration used in the method of the invention, the shorter the one or more spacers that are typically used and vice versa.


Some particular combinations of features are shown in Table 1 below.

















Target
Spacer
Spacer

Free



polynucle-
compo-
length (i.e.
Salt
nucleo-
Motor


otide
sition*
number of *)
concentration
tides?
protein




















DNA
iSpC3
4
1M
Yes
Yes













DNA
iSp18
4
100-1000
mM
Yes
Yes


DNA
iSp18
6
<100-1000
mM
Yes
Yes












DNA
iSp18
2
1M
Yes
Yes













DNA
iSpC3
12
<100-1000
mM
Yes
Yes


DNA
iSpC3
20
<100-1000
mM
Yes
Yes


DNA
iSp9
6
100-1000
mM
Yes
Yes












DNA
idSp
4
1M
Yes
Yes









In embodiments which involve the use of multiple motor proteins, a longer spacer can be beneficial. For example, in embodiments that involve the use of two motor proteins as described herein, a suitable spacer may comprise from about 1 to about 25 of the above-mentioned spacers (e.g. from about 1 to about 25 groups selected from iSp18 groups, iSp9 groups and C3 groups).


Blocking Moieties

In some embodiments, the disclosed methods involve binding a blocking moiety to the polynucleotide adapter. The blocking moiety prevents the motor protein from moving off the spacer of the polynucleotide adapter.


A blocking moiety is typically a moiety which prevents the movement of the motor protein in the direction opposite to that in which the motor protein naturally processes a polynucleotide. For example, if the motor protein naturally processes a polynucleotide strand in the 5′ to 3′ direction, then a suitable blocking moiety is in some embodiments a moiety which prevents the motor protein from moving in the 3′ to 5′ direction. Similarly, if the motor protein naturally processes a polynucleotide strand in the 3′ to 5′ direction, then a suitable blocking moiety is in some embodiments a moiety which prevents the motor protein from moving in the 5′ to 3′ direction.


In the disclosed methods, the blocking moiety is bound to the polynucleotide adapter so as to prevent the movement of the motor protein off the spacer. Preventing the movement of the motor protein from off the spacer can be achieved by providing a steric block to physically prevent the movement of the motor protein. Preventing the movement of the motor protein from off the spacer can be achieved by using a chemical blocking moiety over or past which the motor protein cannot move. In some embodiments, the blocking moiety comprises one or more of the spacer groups discussed herein. In other embodiments, the blocking moiety may comprise a polynucleotide strand. This is discussed in more detail below.


In the disclosed methods, the blocking moiety prevents the motor protein from moving off the spacer. In one embodiment, this is achieved by binding the blocking moiety to the polynucleotide adapter adjacent to the spacer.


For example, in some embodiments the polynucleotide adapter comprises a polynucleotide strand contiguous with the spacer. In such embodiments, the blocking moiety may bind on the polynucleotide strand adjacent to the spacer. For example the blocking moiety may bind to one or more of the 20 nucleotides adjacent to the spacer. The blocking moiety may bind to one or more of the 10 nucleotides adjacent to the spacer. The blocking moiety may bind to one or more of the 5 nucleotides adjacent to the spacer. The blocking moiety may bind to either or both of the 2, 3 or 4 nucleotides adjacent to the spacer. In one embodiment, the blocking moiety binds to the terminal nucleotide adjacent to the spacer. In such embodiments the location of the blocking group in relation to the spacer is such that the motor protein cannot move off the spacer onto the portion of the polynucleotide adapter to which the blocking moiety is bonded. In some embodiments, the blocking moiety binds to a loading site described herein.


In some embodiments the blocking moiety is a protein such as a single strand binding protein (SSB), such as the E. coli single stranded binding protein. The protein binds to the polynucleotide adapter to prevent the movement of the motor protein off the spacer.


In some embodiments the blocking moiety is an intercalator. Any suitable intercalator can be used. The intercalator intercalates a polynucleotide strand of the polynucleotide adapter and thus prevents the movement of the motor protein past the intercalator. In some embodiments, positioning the intercalator close to the spacer can prevent movement of the motor protein off the spacer. In one embodiment, an intercalator can be introduced between to two of the 20 nucleotides adjacent to the spacer. In one embodiment, an intercalator can be introduced between to two of the 10 nucleotides adjacent to the spacer. In one embodiment, an intercalator can be introduced between to two of the 5 nucleotides adjacent to the spacer. In one embodiment, an intercalator can be introduced between the terminal two nucleotides adjacent to the spacer.


In some embodiments, the blocking moiety comprises a secondary structure of a polynucleotide strand. For example, the blocking moiety may comprise a secondary structure such as a pseudoknot for preventing the movement of the motor protein off the spacer.


In some embodiments, the blocking moiety may comprise a chemical tag. For example, the chemical tag may be attached to a group such as a polynucleotide which can bind to the polynucleotide adapter. Examples of suitable tags include, but are not limited to, biotin, a selectable polynucleotide sequence, antibodies, antibody fragments, such as Fab and ScSv, antigens, polynucleotide binding proteins, poly histidine tails and GST tags. Biotin specifically binds to avidins, such as streptavidin. A biotin group bound to an avidin such as streptavidin will prevent the movement of a motor protein. In some embodiments a biotin group bound to an avidin such as streptavidin will prevent the movement of a motor protein past the biotin group.


In some embodiments the blocking moiety comprises a single-stranded or non-hybridised polynucleotide having a length of between about 2 and about 1000 nucleotide units. The blocking moiety may be hybridised to the polynucleotide adapter so as to prevent the movement of the motor protein off the spacer.


In some embodiments the blocking moiety comprises a single-stranded or non-hybridised polynucleotide having a length of between about 2 and about 500 nucleotide units, for instance between about 2 and about 100 nucleotide units, such as between about 10 and about 100 nucleotide units, e.g. between about 20 and about 80 nucleotide units such as between about 30 and about 50 nucleotide units. In some embodiments the blocking moiety comprises a single-stranded or non-hybridised polynucleotide having a length of between about 1 and about 100 nucleotide units, e.g. between about 1 and about 90 nucleotide units, such as between about 1 and about 80 nucleotide units, e.g. between about 1 and about 70 nucleotide units, for example between about 1 and about 60 nucleotide units, for instance between about 1 and about 50 nucleotide units, e.g. between about 1 and about 40 nucleotide units; such as between about 1 and about 30 nucleotide units; for example between about 1 and about 20 nucleotide units such as between about 1 and about 10 nucleotide units. In some embodiments the blocking moiety comprises a single-stranded or non-hybridised polynucleotide having a length of between about 2 and about 100 nucleotide units, e.g. between about 2 and about 90 nucleotide units, such as between about 2 and about 80 nucleotide units, e.g. between about 2 and about 70 nucleotide units, for example between about 2 and about 60 nucleotide units, for instance between about 2 and about 50 nucleotide units, e.g. between about 2 and about 40 nucleotide units; such as between about 2 and about 30 nucleotide units; for example between about 2 and about 20 nucleotide units such as between about 2 and about 10 nucleotide units.


Those skilled in the art will appreciate that when the blocking moiety comprises a single-stranded or non-hybridised polynucleotide, the sequence of the blocking moiety polynucleotide is typically not determinative and can be controlled or chosen according to the adapter and motor protein and other experimental conditions. Exemplary sequences are provided solely by way of illustration in the examples. For example, the blocking moiety may comprise a polynucleotide sequence such as SEQ ID NO: 19 or a polynucleotide sequence having at least 20%, such as at least 30%, e.g. at least 40% such as at least 50%, e.g. at least 60% such as at least 70%, e.g. at least 80%, for example at least 90% e.g. at least 95% sequence similarity or identity to SEQ ID NO: 19. For example, the blocking moiety may comprise a polynucleotide sequence such as SEQ ID NO: 10 or a polynucleotide sequence having at least 20%, such as at least 30%, e.g. at least 40% such as at least 50%, e.g. at least 60% such as at least 70%, e.g. at least 80%, for example at least 90% e.g. at least 95% sequence similarity or identity to SEQ ID NO: 10. The blocking moiety may comprise a polynucleotide sequence corresponding to SEQ ID NO: 10 or to SEQ ID NO: 19 and comprising at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 nucleotide substitutions. Without being bound by theory, those skilled in the art will appreciate that the function of the blocking moiety in preventing movement of the motor protein off the spacer can be achieved by blocking moieties which are chosen to be compatible with the sequence of the adapter. The structure of the blocking moiety can be altered providing the blocking moiety can attach to the adapter (e.g. by hybridisation) and prevent movement of the motor protein from off the spacer.


Sometimes, the blocking moiety adapter has a sequence complementary to a sequence of the polynucleotide adapter in the region of the spacer (e.g. within about 20 nucleotides of the spacer, such as within about 10 nucleotides of the spacer, e.g. within about 5 nucleotides of the spacer, such as within 2, 3 or 4 nucleotides of the spacer), so that the blocking moiety polynucleotide can hybridise to the polynucleotide adapter in the region of the spacer and thus prevent the motor protein from moving off the spacer.


A blocking moiety comprising a single-stranded or non-hybridised polynucleotide which may attach, e.g. by hybridisation, to a polynucleotide adapter may also be referred to as a “trap strand”. The trap strand traps the motor protein on the spacer. Attaching a trap strand to the polynucleotide adapter may comprise attaching the trap strand, e.g. by hybridisation, to a sequence of the polynucleotide adapter, e.g. a sequence close to or adjacent to the spacer of the polynucleotide adapter.


Typically the sequence to which the blocking moiety or trap strand attaches e.g. by hybridisation is a single stranded sequence such that the resulting adapter comprising the blocking moiety may be a double stranded polynucleotide. Those skilled in the art will thus appreciate that an adapter may comprise a region of double-stranded polynucleotide attached to a spacer; in such an embodiment the double-stranded polynucleotide blocks the movement of the motor protein off the spacer and one strand of the double-stranded polynucleotide or a portion of one strand of the double-stranded polynucleotide comprises the trap strand. This is discussed more in the examples.


As explained in more detail here, in some embodiments the blocking moiety if present is bound to the adapter once the motor protein has positioned on the spacer moiety. In some embodiments the blocking moiety if present is bound to the adapter before the motor protein has positioned on the spacer unit. In some embodiments a blocking moiety is bound to the adapter before the motor protein has positioned on a spacer unit comprising one or more nucleotide islands as described herein.


Loading Site

As discussed above, in some embodiments the polynucleotide adapter comprises a loading site connected to a spacer. A loading site is a site for loading the motor protein onto the polynucleotide adapter.


In one embodiment, the loading site is a linear molecule, such as a polymer. In some embodiments, the loading site may comprise deoxyribonucleic acid (DNA), ribonucleic acid (RNA), peptide nucleic acid (PNA), glycerol nucleic acid (GNA), threose nucleic acid (TNA), locked nucleic acid (LNA) or a synthetic polymer with nucleotide side chains. The loading site may comprise a polymer such as PEG.


In some embodiments, the motor protein engages with the loading site of the polynucleotide adapter. A motor protein may engage with the polynucleotide adapter (e.g. with the loading site of the polynucleotide adapter) if it contacts the polynucleotide adapter (e.g. the loading site of the polynucleotide adapter) and associates with the polynucleotide adapter. For example, the motor protein may associate to the polynucleotide adapter (e.g. the loading site) by binding to the polynucleotide adapter, or by forming a complex around the portion of the polynucleotide adapter to which it engages but not binding to the polynucleotide adapter. Thus, for instance, if the motor protein is a DNA processing enzyme and the loading site comprises a linear molecule which is not DNA (e.g. the loading site comprises RNA, PNA, GNA, TNA, LNA, or PEG, etc), the motor protein may associate with (engage with) the loading site without binding to it. On the other hand, if the loading site comprises DNA then the motor protein may engage with the loading site by binding to the loading site. Similarly, if the motor protein is an RNA processing enzyme and the loading site comprises a linear molecule which is not RNA (e.g. the loading site comprises DNA, PNA, GNA, TNA, LNA, or PEG, etc), the motor protein may associate with (engage with) the loading site without binding to it. On the other hand, if the loading site comprises RNA then the motor protein may engage with the loading site by binding to the loading site. Of course, in some embodiments the motor protein may bind to a loading site which does not comprise the natural substrate for the motor protein (e.g. a DNA-binding enzyme may in some embodiments bind to a loading site which comprises a linear molecule other than DNA, etc).


Accordingly, in some embodiments, the polynucleotide adapter comprises a loading site connected to a spacer and the motor protein binds to the loading site of the polynucleotide adapter.


In some embodiments of the disclosed methods, the polynucleotide adapter comprises a loading site connected to a spacer and the blocking moiety described herein binds to the loading site. As explained in more detail here, if the blocking moiety binds to the loading site the blocking moiety prevents the motor protein from moving off the spacer. In some embodiments the blocking moiety may prevent the motor protein from moving off the spacer onto the loading site.


In some embodiments, the loading site is contiguous with the spacer. In other words, the loading site may be directly attached to the spacer. In some embodiments, the loading site is contiguous with the spacer and the blocking moiety binds to the loading site immediately adjacent to the spacer. As will be apparent, in some embodiments binding the blocking moiety to the loading site immediately adjacent to the spacer prevents the motor protein is from moving off the spacer onto the polynucleotide adapter. In some embodiments binding the blocking moiety to the loading site immediately adjacent to the spacer prevents the motor protein from moving off the spacer onto the loading site.


For example, the polynucleotide adapter may comprise a loading site connected to a spacer, wherein the loading site comprises a single-stranded or non-hybridised polynucleotide. In some embodiments, the motor protein may bind to the polynucleotide adapter at the loading site and progress from the loading site onto the spacer. The blocking moiety may bind to the loading site (e.g. as described above), Binding the blocking moiety to the loading site may prevent the motor protein from moving back onto the single-stranded or non-hybridised polynucleotide.


In some embodiments, the loading site comprises a single-stranded or non-hybridised polynucleotide. A single-stranded polynucleotide strand may comprise an overhang region of a double stranded polynucleotide strand. A non-hybridised polynucleotide may comprise for example a Y shape polynucleotide as described in more detail above.


In some preferred embodiments, the loading site comprises a single-stranded or non-hybridised polynucleotide and the blocking moiety comprises a single-stranded or non-hybridised polynucleotide; and (ii) binding the blocking moiety to the loading site comprises hybridising the blocking moiety to the loading site.


In some embodiments the loading site comprises a single-stranded or non-hybridised polynucleotide having a length of between about 2 and about 1000 nucleotide units. In some embodiments the loading site comprises a single-stranded or non-hybridised polynucleotide having a length of between about 2 and about 500 nucleotide units, for instance between about 2 and about 100 nucleotide units, such as between about 10 and about 100 nucleotide units, e.g. between about 20 and about 80 nucleotide units such as between about 30 and about 50 nucleotide units. In some embodiments the loading site comprises a single-stranded or non-hybridised polynucleotide having a length of between about 1 and about 100 nucleotide units, e.g. between about 1 and about 90 nucleotide units, such as between about 1 and about 80 nucleotide units, e.g. between about 1 and about 70 nucleotide units, for example between about 1 and about 60 nucleotide units, for instance between about 1 and about 50 nucleotide units, e.g. between about 1 and about 40 nucleotide units; such as between about 1 and about 30 nucleotide units; for example between about 1 and about 20 nucleotide units such as between about 1 and about 10 nucleotide units. In some embodiments the loading site comprises a single-stranded or non-hybridised polynucleotide having a length of between about 2 and about 100 nucleotide units, e.g. between about 2 and about 90 nucleotide units, such as between about 2 and about 80 nucleotide units, e.g. between about 2 and about 70 nucleotide units, for example between about 2 and about 60 nucleotide units, for instance between about 2 and about 50 nucleotide units, e.g. between about 2 and about 40 nucleotide units; such as between about 2 and about 30 nucleotide units; for example between about 2 and about 20 nucleotide units such as between about 2 and about 10 nucleotide units. In some embodiments, the blocking moiety comprises a single-stranded or non-hybridised polynucleotide having a length of between about 2 and about 1000 nucleotide units. In some embodiments the blocking moiety comprises a single-stranded or non-hybridised polynucleotide having a length of between about 2 and about 500 nucleotide units, for instance between about 2 and about 100 nucleotide units, such as between about 10 and about 100 nucleotide units, e.g. between about 20 and about 80 nucleotide units such as between about 30 and about 50 nucleotide units. In some embodiments the blocking moiety comprises a single-stranded or non-hybridised polynucleotide having a length of between about 1 and about 100 nucleotide units, e.g. between about 1 and about 90 nucleotide units, such as between about 1 and about 80 nucleotide units, e.g. between about 1 and about 70 nucleotide units, for example between about 1 and about 60 nucleotide units, for instance between about 1 and about 50 nucleotide units, e.g. between about 1 and about 40 nucleotide units; such as between about 1 and about 30 nucleotide units; for example between about 1 and about 20 nucleotide units such as between about 1 and about 10 nucleotide units. In some embodiments the blocking moiety comprises a single-stranded or non-hybridised polynucleotide having a length of between about 2 and about 100 nucleotide units, e.g. between about 2 and about 90 nucleotide units, such as between about 2 and about 80 nucleotide units, e.g. between about 2 and about 70 nucleotide units, for example between about 2 and about 60 nucleotide units, for instance between about 2 and about 50 nucleotide units, e.g. between about 2 and about 40 nucleotide units; such as between about 2 and about 30 nucleotide units; for example between about 2 and about 20 nucleotide units such as between about 2 and about 10 nucleotide units.


In some embodiments, the loading site has a sequence which is complementary to the sequence of the blocking moiety.


Those skilled in the art will appreciate that the sequence of the loading site is typically not determinative and can be controlled or chosen according to the adapter and motor protein and other experimental conditions. Exemplary sequences are provided solely by way of illustration in the examples. Without being bound by theory, those skilled in the art will appreciate that the function of the loading site in promoting loading of the motor protein onto the spacer can be achieved by loading sites which are chosen to be compatible with the adapter and motor protein used in the method. The sequence of the loading site can thus be altered providing the motor protein can progress from the loading site onto the spacer, as described herein.


In some embodiments the backbone of the loading site and the blocking moiety is the same (e.g. the loading site and the blocking moiety both have a DNA backbone, an RNA backbone, etc). In other embodiments the backbone of the loading site and the blocking moiety is different (e.g. the loading site may have a DNA backbone and the blocking moiety have an RNA backbone or the loading site may have an RNA backbone and the blocking moiety have an DNA backbone, etc).


In some embodiments the hybridisation of the blocking moiety to the loading site creates a region of double-stranded polynucleotide adjacent to the spacer. Such regions typically prevent the movement of a motor protein from off the spacer onto the region of the loading site which is hybridised to the blocking moiety. For example, the loading site may comprise single-stranded polynucleotide and the blocking moiety may bind at the terminal nucleotide contiguous with the spacer so as to create a region of double-stranded polynucleotide contiguous with the spacer.


Loading Strand

In some embodiments the motor protein is loaded onto a polynucleotide adapter comprising a loading strand. In some embodiments a loading strand improves the efficiency of motor protein loading, particularly in embodiments of the methods provided herein in which it is desirable that only one motor protein is loaded onto a single adapter. In some embodiments the loading strand comprises a portion which is complementary to a sequence of the adapter adjacent to (or in the vicinity of, such as within 1, 2, 3, 4, or 5 nucleotides of) the spacer of the polynucleotide adapter. In some embodiments the loading strand further comprises a portion which is not complementary to the sequence of the polynucleotide adapter. In some embodiments the loading strand comprises a portion which is complementary to a sequence of the adapter and thus hybridises to the adapter in the vicinity of (e.g. adjacent to) the spacer; and a portion which is not complementary to the adapter sequence and thus does not hybridise to the adapter. In some embodiments the portion which does not hybridise to the adapter facilitates loading of the motor protein onto the adapter. In some embodiments the motor protein processes the hybridised loading strand/adapter complex and in doing so is caused to process onto the spacer. In some embodiments the processing of the motor protein onto the spacer displaces the loading strand from the polynucleotide adapter. In some embodiments the displacement of the loading strand from the adapter prevents the loading of subsequent motor proteins onto the adapter.


In some embodiments the loading strand has a length of between about 2 and about 500 nucleotide units, for instance between about 5 and about 100 nucleotide units, such as between about 10 and about 60 nucleotide units, e.g. between about 20 and about 40 nucleotide units.


Those skilled in the art will appreciate that the sequence of the loading strand is typically not determinative and can be controlled or chosen according to the adapter and motor protein and other experimental conditions. Exemplary sequences are provided solely by way of illustration in the examples. For example, the loading strand may comprise a polynucleotide sequence such as SEQ ID NO: 18 or a polynucleotide sequence having at least 20%, such as at least 30%, e.g. at least 40% such as at least 50%, e.g. at least 60% such as at least 70%, e.g. at least 80%, for example at least 90% e.g. at least 95% sequence similarity or identity to SEQ ID NO: 18. Without being bound by theory, those skilled in the art will appreciate that the function of the loading strand in promoting loading of the motor protein onto the spacer can be achieved by loading strands which are chosen to be compatible with the adapter and motor protein used in the method. The sequence of the loading strand can thus be altered providing the motor protein can progress from the loading strand onto the spacer, as described herein.


In some embodiments, a blocking moiety is attached to the adapter in the vicinity of the spacer (e.g. adjacent to the spacer) in place of the displaced loading strand. The blocking moiety may for example be a single-stranded or non-hybridised polynucleotide (i.e. a blocking strand) which may attach, e.g. by hybridisation, to the polynucleotide adapter in place of the displaced loading strand.


In some embodiments in which a loading strand is used to progress the motor protein onto the spacer and a blocking strand is used to prevent the motor protein moving off the spacer, the blocking strand may bind more strongly to the polynucleotide adapter than the loading strand. For example, the blocking strand may have a length greater than the loading strand and therefore hybridise more strongly than the loading strand. In some embodiments the blocking strand is provided at concentrations in excess of the loading strand. By providing excess blocking strand the re-annealing of displaced loading strand is reduced or prevented thus allowing the number of motor proteins on the polynucleotide adapter to be controlled. For example, the blocking strand may be present at concentrations at least 2×, such as at least 5×, e.g. at least 10×, such as at least 20×, e.g. at least 50× or at least 100× the concentration of the loading strand.


Progressing the Motor Protein onto the Spacer


As discussed in more detail herein, the methods provided herein comprise positioning a motor protein on a spacer comprised in an adapter.


As discussed in more detail herein, in some embodiments contacting the polynucleotide adapter with a motor protein causes the motor protein to progress onto the spacer of the polynucleotide adapter.


In some embodiments, causing the motor protein to progress from the loading site onto the spacer comprises providing the motor protein with an impetus to pass from the loading site onto the spacer. Any suitable impetus can be used.


Typically there is an energy barrier for a motor protein to progress from the polynucleotide adapter (e.g. from the loading site) onto the spacer. The energy barrier may arise from a change in the chemical composition of the linear molecule along which the motor protein progresses. For example, in some embodiments the change may be from a polynucleotide backbone of the loading site to a non-polynucleotide backbone of the spacer. In other embodiments, the energy barrier may arise from a change from a DNA or RNA backbone of the loading site to an abasic spacer. The typical existence of the energy barrier means that an impetus is often required to cause the motor protein to progress from the polynucleotide adapter (e.g. from the loading site) onto the spacer.


For example, in some embodiments causing the motor protein to progress onto the spacer comprises applying a physical or chemical force to the motor protein. In some embodiments, causing the motor protein to progress onto the spacer comprises contacting the motor protein with one or more fuel molecules. In some embodiments, a force is applied by a second motor protein which “pushes” the motor protein onto the spacer. In other words, in some embodiments the polynucleotide adapter comprises a loading site connected to a spacer; the motor protein is a first motor protein and causing the first motor protein to progress from the loading site onto the spacer comprises loading a second motor protein onto the loading site and causing the second motor protein to progress from the loading site towards the spacer, wherein the second motor protein forces the first motor protein onto the spacer.


In other embodiments, binding the blocking moiety to the polynucleotide adapter forces the motor protein onto the spacer. The binding of the blocking moiety to the polynucleotide adapter (e.g. to the loading site) can be sufficiently favourable as to overcome the energy barrier to force the motor protein onto the spacer.


In other embodiments, the motor protein is positioned on a spacer before or after a blocking moiety has been bound to the adapter. For example, a motor protein may be positioned on the spacer and a blocking moiety bound to the polynucleotide adapter may prevent the motor protein from moving off the spacer. In some embodiments a motor protein may be positioned on an adapter comprising a spacer and blocking moiety bound to the adapter. The motor protein may be positioned on an adapter by any suitable means. For example, the motor protein may preferentially localise at certain locations within the spacer. For example, in some embodiments the motor protein may bind to a nucleotide island within the spacer. Accordingly, in some embodiments contacting the polynucleotide adapter with the motor protein may comprise contacting the motor protein with a nucleotide island comprised in the spacer.


In such embodiments the motor protein is typically modified in order to prevent it from dissociating from the spacer e.g. by moving off the spacer. The motor protein may be modified before or after being positioned on the spacer. Typically the motor protein is modified after being positioned on the spacer. Modifications of motor proteins is described in more detail herein.


It will be apparent from the above discussion that some embodiments of the disclosed methods involve causing the motor protein to progress from the polynucleotide adapter onto the spacer.


In some embodiments, when the motor protein is on the spacer the spacer occupies the active site of the motor protein. In some embodiments, the active site is partially occupied by the spacer. In other embodiments, the active site is wholly occupied by the spacer. The active site may be occupied to a sufficient extent to impact on the turnover of fuel molecules by the motor protein. Typically, as used herein, the active site of a motor protein refers to the polynucleotide-binding cleft in the motor protein. Those skilled in the art will appreciate that the ATP-binding site of the motor protein may be distinct from the polynucleotide adapter. Thus, in some embodiments, the polynucleotide-binding cleft of the motor protein is occupied by the spacer and the ATP-binding site of the motor protein is not occupied by the spacer. In other embodiments both the polynucleotide-binding cleft and the ATP-binding site of the motor protein are occupied by the spacer. Thus, the polynucleotide-binding cleft of the motor protein may be occupied by the spacer and the ATP-binding site of the motor protein may be occluded or blocked by the spacer, or may be accessible to ATP. Without being bound by theory, a motor protein may still be stalled on a spacer and not engage in futile turnover even if the ATP binding site is accessible. For example, in some embodiments ATP hydrolysis requires conformational changes in the motor protein which are induced by polynucleotide-binding to the polynucleotide-binding cleft of the motor protein. When stalled on a spacer so that the polynucleotide-binding cleft is inaccessible to polynucleotides, such conformational changes do not occur and futile turnover is reduced or eliminated.


In some embodiments, the spacer spans the whole or part of the footprint of the motor protein. In some embodiments, the spacer spans the entire footprint of the motor protein and occupies the active site of the motor protein. In other words, in some embodiments the motor protein progresses onto the spacer so that it is wholly on the spacer.


Those skilled in the art will appreciate that there is a significant difference between a motor protein which is stalled on a spacer as defined herein, and a motor protein which is stalled merely close to a spacer e.g. adjacent to a spacer. If a motor protein is merely adjacent to a spacer or only spans the spacer by a trivial amount then futile turnover will not necessarily be prevented. Allowing a motor protein to move off the spacer to this extent does not correspond to preventing the motor protein from moving off the spacer as defined in the present claims. A motor protein which is “on” a spacer due to a slight overlap between the motor protein and the spacer but which is not prevented from turning over fuel molecules at substantially the same rate as when it is bound to a polynucleotide is not on the spacer as used herein.


Accordingly, in some embodiments, when the spacer occupies the active site of the motor protein the turnover of fuel molecules by the motor protein is reduced. In some embodiments, the turnover of fuel molecules by the motor protein is eliminated.


Motor Proteins

As those skilled in the art will appreciate, any suitable motor protein can be used in the methods and products provided herein. In one embodiment, a motor protein may be any protein that is capable of binding to a polynucleotide and controlling its movement with respect to a nanopore, e.g. through the pore.


In one embodiment, a motor protein is or is derived from a polynucleotide handling enzyme. A polynucleotide handling enzyme is a polypeptide that is capable of interacting with and modifying at least one property of a polynucleotide. The enzyme may modify the polynucleotide by cleaving it to form individual nucleotides or shorter chains of nucleotides, such as di- or trinucleotides. The enzyme may modify the polynucleotide by orienting it or moving it to a specific position.


In one embodiment, the motor protein is derived from a member of any of the Enzyme Classification (EC) groups 3.1.11, 3.1.13, 3.1.14, 3.1.15, 3.1.16, 3.1.21, 3.1.22, 3.1.25, 3.1.26, 3.1.27, 3.1.30 and 3.1.31.


Typically, the motor protein is a helicase, a polymerase, an exonuclease, a topoisomerase, or a variant thereof.


In some embodiments, the motor protein on the spacer of the polynucleotide adapter is modified to prevent the motor protein disengaging from the spacer (other than by passing off the end of the spacer). The motor protein can be adapted in any suitable way. For example, the motor protein can be loaded on the adapter and then modified in order to prevent it from disengaging from the spacer. Alternatively, the motor protein can be modified to prevent it from disengaging from the spacer before it is loaded onto the adapter. Modification of a motor protein in order to prevent it from disengaging from a spacer can be achieved using methods known in the art, such as those discussed in WO 2014/013260, which is hereby incorporated by reference in its entirety, and with particular reference to passages describing the modification of motor proteins such as helicases in order to prevent them from disengaging with polynucleotide strands. For example, a motor protein can be modified by treating with tetramethylazodicarboxamide (TMAD).


For example, the motor protein may have a polynucleotide-unbinding opening; e.g. a cavity, cleft or void through which a polynucleotide strand may pass when the motor protein disengages from the strand. In some embodiments, the polynucleotide-unbinding opening is the opening through which a spacer may pass when the motor protein disengages from the spacer. In some embodiments, the polynucleotide-unbinding opening for a given motor protein can be determined by reference to its structure, e.g. by reference to its X-ray crystal structure. The X-ray crystal structure may be obtained in the presence and/or the absence of a polynucleotide substrate. In some embodiments, the location of a polynucleotide-unbinding opening in a given motor protein may be deduced or confirmed by molecular modelling using standard packages known in the art. In some embodiments, the polynucleotide-unbinding opening may be transiently produced by movement of one or more parts e.g. one or more domains of the motor protein.


The motor protein may be modified by closing the polynucleotide-unbinding opening. Closing the polynucleotide-unbinding opening may therefore prevent the motor protein from disengaging from the spacer. For example, the motor protein may be modified by covalently closing the polynucleotide-unbinding opening. In some embodiments, a preferred motor protein for addressing in this way is a helicase.


In one embodiment, the motor protein is an exonuclease. Suitable enzymes include, but are not limited to, exonuclease I from E. coli (SEQ ID NO: 1), exonuclease III enzyme from E. coli (SEQ ID NO: 2), RecJ from T. thermophilus (SEQ ID NO: 3) and bacteriophage lambda exonuclease (SEQ ID NO: 4), TatD exonuclease and variants thereof. Three subunits comprising the sequence shown in SEQ ID NO: 3 or a variant thereof interact to form a trimer exonuclease.


In one embodiment, the motor protein is a polymerase. The polymerase may be PyroPhage® 3173 DNA Polymerase (which is commercially available from Lucigen® Corporation), SD Polymerase (commercially available from Bioron®), Klenow from NEB or variants thereof. In one embodiment, the enzyme is Phi29 DNA polymerase (SEQ ID NO: 5) or a variant thereof. Modified versions of Phi29 polymerase that may be used in the invention are disclosed in U.S. Pat. No. 5,576,204.


In one embodiment the motor protein is a topoisomerase. In one embodiment, the topoisomerase is a member of any of the Moiety Classification (EC) groups 5.99.1.2 and 5.99.1.3. The topoisomerase may be a reverse transcriptase, which are enzymes capable of catalysing the formation of cDNA from a RNA template. They are commercially available from, for instance, New England Biolabs® and Invitrogen®.


In one embodiment, the motor protein is a helicase. Any suitable helicase can be used in accordance with the methods provided herein. For example, the or each motor protein used in accordance with the present disclosure may be independently selected from a Hel308 helicase, a RecD helicase, a TraI helicase, a TrwC helicase, an XPD helicase, and a Dda helicase, or a variant thereof. Monomeric helicases may comprise several domains attached together. For instance, TraI helicases and TraI subgroup helicases may contain two RecD helicase domains, a relaxase domain and a C-terminal domain. The domains typically form a monomeric helicase that is capable of functioning without forming oligomers. Particular examples of suitable helicases include Hel308, NS3, Dda, UvrD, Rep, PcrA, Pif1 and TraI. These helicases typically work on single stranded DNA. Examples of helicases that can move along both strands of a double stranded DNA include FtfK and hexameric enzyme complexes, or multisubunit complexes such as RecBCD.


Hel308 helicases are described in publications such as WO 2013/057495, the entire contents of which are incorporated by reference. RecD helicases are described in publications such as WO 2013/098562, the entire contents of which are incorporated by reference. XPD helicases are described in publications such as WO 2013/098561, the entire contents of which are incorporated by reference. Dda helicases are described in publications such as WO 2015/055981 and WO 2016/055777, the entire contents of each of which are incorporated by reference.


In one embodiment the helicase comprises the sequence shown in SEQ ID NO: 6 (Trwc Cba) or a variant thereof, the sequence shown in SEQ ID NO: 7 (Hel308 Mbu) or a variant thereof or the sequence shown in SEQ ID NO: 8 (Dda) or a variant thereof. Variants may differ from the native sequences in any of the ways discussed herein. An example variant of SEQ ID NO: 8 comprises E94C/A360C. A further example variant of SEQ ID NO: 8 comprises E94C/A360C and then (ΔM1)G1G2 (i.e. deletion of M1 and then addition of G1 and G2).


In some embodiments a motor protein (e.g. a helicase) can control the movement of polynucleotides in at least two active modes of operation (when the motor protein is provided with all the necessary components to facilitate movement, e.g. fuel and cofactors such as ATP and Mg2+ discussed herein) and one inactive mode of operation (when the motor protein is not provided with the necessary components to facilitate movement).


When provided with all the necessary components to facilitate movement (i.e. in the active modes), the motor protein (e.g. helicase) moves along the polynucleotide in a 5′ to 3′ or a 3′ to 5′ direction (depending on the motor protein). In embodiments in which the motor protein is used to control the movement of a polynucleotide strand with respect to a nanopore, the motor protein can be used to either move the polynucleotide away from (e.g. out of) the pore (e.g. against an applied field) or the polynucleotide towards (e.g. into) the pore (e.g. with an applied field). For example, when the end of the polynucleotide towards which the motor protein moves is captured by a pore, the motor protein works against the direction of the field resulting from the applied potential and pulls the threaded polynucleotide out of the pore (e.g. into the cis chamber). However, when the end away from which the motor protein moves is captured in the pore, the motor protein works with the direction of the field resulting from the applied potential and pushes the threaded polynucleotide into the pore (e.g. into the trans chamber).


When the motor protein (e.g. helicase) is not provided with the necessary components to facilitate movement (i.e. in the inactive mode) it can bind to the polynucleotide and act as a brake slowing the movement of the polynucleotide when it is moved with respect to a nanopore, e.g. by being pulled into the pore by a field resulting from an applied potential. In the inactive mode, it does not matter which end of the polynucleotide is captured, it is the applied field which determines the movement of the polynucleotide with respect to the pore, and the motor protein acts as a brake. When in the inactive mode, the movement control of the polynucleotide by the motor protein can be described in a number of ways including ratcheting, sliding and braking.


As discussed above, the methods disclosed herein may reduce the concept of futile turnover. Turnover is the chemical (enzymatic) conversion of a fuel molecule by a motor protein.


Fuel is typically free nucleotides or free nucleotide analogues. The free nucleotides may be one or more of, but are not limited to, adenosine monophosphate (AMP), adenosine diphosphate (ADP), adenosine triphosphate (ATP), guanosine monophosphate (GMP), guanosine diphosphate (GDP), guanosine triphosphate (GTP), thymidine monophosphate (TMP), thymidine diphosphate (TDP), thymidine triphosphate (TTP), uridine monophosphate (UMP), uridine diphosphate (UDP), uridine triphosphate (UTP), cytidine monophosphate (CMP), cytidine diphosphate (CDP), cytidine triphosphate (CTP), cyclic adenosine monophosphate (cAMP), cyclic guanosine monophosphate (cGMP), deoxyadenosine monophosphate (dAMP), deoxyadenosine diphosphate (dADP), deoxyadenosine triphosphate (dATP), deoxyguanosine monophosphate (dGMP), deoxyguanosine diphosphate (dGDP), deoxyguanosine triphosphate (dGTP), deoxythymidine monophosphate (dTMP), deoxythymidine diphosphate (dTDP), deoxythymidine triphosphate (dTTP), deoxyuridine monophosphate (dUMP), deoxyuridine diphosphate (dUDP), deoxyuridine triphosphate (dUTP), deoxycytidine monophosphate (dCMP), deoxycytidine diphosphate (dCDP) and deoxycytidine triphosphate (dCTP). The free nucleotides are usually selected from AMP, TMP, GMP, CMP, UMP, dAMP, dTMP, dGMP or dCMP. The free nucleotides are typically adenosine triphosphate (ATP).


A cofactor for the motor protein is a factor that allows the motor protein to function. The cofactor is preferably a divalent metal cation. The divalent metal cation is preferably Mg2+, Mn2+, Ca2+ or Co2+. The cofactor is most preferably Mg2+.


Removal of Excess Motor Protein

In some embodiments, the provided methods further comprise the step of removing excess motor protein molecules which are not located on the spacer. The removal of excess motor proteins can be referred to as a stress step. A stress step can be used to remove incorrectly bound motor proteins from the polynucleotide adapter. In embodiments of the provided methods which comprise modifying the motor protein in order to prevent it from disengaging from the spacer, a stress step can be used to remove motor proteins which are not correctly modified.


Removal of excess motor proteins is beneficial in order to reduce or exclude the presence of unbound motor proteins which are not stalled on a polynucleotide adapter as described herein. Unstalled motor proteins may engage with polynucleotide strands and/or may consume fuel molecules that are present, i.e. may engage in futile turnover. Removing excess motor proteins reduces or prevents this futile turnover from unstalled motor proteins and thus reduces the unproductive consumption of fuel molecules.


Unbound motor proteins can be removed (e.g. in a stress step) in any suitable manner. For example, the unbound motor proteins can be removed by washing or filtering. Unbound motor proteins can be removed by using a high salt wash buffer. Unbound motor proteins can be removed using specific pH or temperature conditions that promote their removal. For example, stress conditions may include for example high salt concentrations in the presence of fuel such as ATP.


Progressing the Motor Protein Off the Spacer

As discussed in more detail herein, in some embodiments the adapter is useful for stalling a motor protein prior to its use to control the movement of a target polynucleotide. For example, in some embodiments the disclosed adapter provides a motor protein for controlling the movement of a target polynucleotide with respect to a nanopore. In some embodiments, the movement of a target polynucleotide with respect to a nanopore is useful to characterise the target polynucleotide.


As discussed in more detail herein, the disclosed methods involve stalling a motor protein on a spacer. The blocking moiety prevents the motor protein from moving off the spacer onto the polynucleotide adapter, e.g. from moving from the spacer onto a loading site of the polynucleotide adapter.


Typically there is an energy barrier for a motor protein to progress from the spacer onto a target polynucleotide in order to control the movement of the target polynucleotide. The energy barrier may arise from a change in the chemical composition of the linear molecule along which the motor protein progresses. For example, in some embodiments the change may be from a non-polynucleotide backbone of the spacer to a polynucleotide backbone of the target polynucleotide. In other embodiments, the energy barrier may arise from a change from an basic spacer to a DNA or RNA backbone of the target polynucleotide. The typical existence of the energy barrier means that an impetus is often required to cause the motor protein to progress from the polynucleotide adapter (e.g. from the spacer) onto the target polynucleotide.


In some embodiments, causing the motor protein to progress from the spacer onto the target polynucleotide thus comprises providing the motor protein with an impetus to pass from the spacer onto the target polynucleotide. Any suitable impetus can be used.


For example, in some embodiments, the impetus can be provided by contacting the polynucleotide adapter with a nanopore. For example, in some embodiments, the nanopore engages with the polynucleotide adapter and forces the motor protein onto the target polynucleotide.


In more detail, in some embodiments a polynucleotide adapter having a motor protein stalled on a spacer thereof is contacted with a target polynucleotide under conditions such that the polynucleotide adapter is attached to the target polynucleotide. For example, as described in more detail herein the polynucleotide adapter can be ligated to the target polynucleotide adapter, e.g. to an end of the target polynucleotide. The polynucleotide adapter-target polynucleotide conjugate can be contacted with a nanopore such that the polynucleotide adapter engages with the nanopore. For example, the polynucleotide adapter may thread through the nanopore. Movement of the polynucleotide adapter with respect to the nanopore (e.g. through the nanopore) can provide a force on the motor protein stalled on the spacer of the polynucleotide adapter. For example, in embodiments where the polynucleotide adapter is threaded through a nanopore under the influence of an applied potential, the force applied by the nanopore on the motor protein as it approaches or contacts the nanopore is sufficient to force the motor protein onto the target polynucleotide. In such embodiments the nanopore can be considered as “pushing” the motor protein from off the spacer onto the target polynucleotide adapter. Such embodiments are particularly suited to (but not limited to) embodiments of the disclosure in which the polynucleotide adapter comprises a spacer positioned between (i) a loading site and (ii) a polynucleotide strand which can be ligated or otherwise attached onto the target polynucleotide.


In other embodiments the force required to progress the motor protein from the spacer onto the target polynucleotide is provided by applying a physical or chemical force to the motor protein. In some embodiments, causing the motor protein to progress from the spacer onto the target polynucleotide comprises contacting the motor protein with one or more fuel molecules. In some embodiments, a force is applied by a second motor protein which “pushes” the motor protein off the spacer onto the target polynucleotide. In other words, in some embodiments the polynucleotide adapter comprises a spacer and is attached to the target polynucleotide; the motor protein is a first motor protein and causing the first motor protein to progress from the spacer onto the target polynucleotide comprises loading a second motor protein onto the polynucleotide adapter and causing the second motor protein to progress towards the target polynucleotide, wherein the second motor protein forces the first motor protein onto the spacer. In such embodiments the polynucleotide adapter typically comprises a loading site connected to the end of the spacer away from the target polynucleotide (away from the end of the polynucleotide adapter which is or will be attached to the target polynucleotide).


It will be appreciated that in such embodiments it is typically not necessary to remove the blocking moiety in order to progress the motor protein from off the spacer onto the target polynucleotide. However in some embodiments the method involves displacing the blocking moiety. For example, the blocking moiety may be removed or displaced by contacting the polynucleotide adapter with a nanopore. In some embodiments removal of the blocking moiety from the polynucleotide adapter allows the motor protein to move off the spacer onto the polynucleotide adapter and/or onto the target polynucleotide.


In some embodiments the blocking moiety binds to the polynucleotide adapter on the side of the spacer away from the target polynucleotide (i.e. away from the end of the polynucleotide adapter which is or will be attached to the target polynucleotide). In such embodiments the polynucleotide adapter typically comprises a loading site connected to the end of the spacer away from the target polynucleotide (away from the end of the polynucleotide adapter which is or will be attached to the target polynucleotide) and the blocking moiety binds to the polynucleotide adapter between the loading site and spacer.


In other embodiments the blocking moiety binds to the polynucleotide adapter between the spacer and the target polynucleotide (towards the end of the polynucleotide adapter which is or will be attached to the target polynucleotide). In such embodiments the polynucleotide adapter typically comprises a loading site connected to the end of the spacer away from the target polynucleotide (away from the end of the polynucleotide adapter which is or will be attached to the target polynucleotide) and the blocking moiety binds to the polynucleotide adapter towards the end of the polynucleotide adapter which is or will be attached to the target polynucleotide.


Controlling Movement and Characterisation

Also provided herein is a method of controlling the movement of a target polynucleotide with respect to a transmembrane nanopore, comprising:

    • i) providing (A) a target polynucleotide; (B) a polynucleotide adapter comprising a spacer; and (C) a motor protein;
    • ii) carrying out a method as disclosed herein thereby stalling the motor protein on the spacer of the polynucleotide adapter;
    • iii) contacting the target polynucleotide and the stalled motor protein on the spacer of the polynucleotide adapter with the nanopore; and
    • iv) applying a potential across the transmembrane nanopore thereby causing the motor protein to move past the spacer onto the target polynucleotide thereby controlling the movement of the target polynucleotide with respect to the nanopore.


Any of the methods in embodiments disclosed herein can be used to stall the motor protein on the spacer of the polynucleotide adapter.


In one embodiment, the target polynucleotide is bound to the polynucleotide adapter. In one embodiment, step (iii) comprises binding the polynucleotide adapter to the target polynucleotide.


In one embodiment, the motor protein is stalled on the polynucleotide adapter before the polynucleotide adapter is attached to the target polynucleotide. In another embodiment, the polynucleotide adapter is attached to the target polynucleotide before the motor protein is stalled on the polynucleotide adapter.


Also provided herein is a method of controlling the movement of a target polynucleotide with respect to a transmembrane nanopore, comprising:

    • i) providing a target polynucleotide;
    • ii) providing a polynucleotide adapter comprising a spacer and having a motor protein stalled thereon, wherein said polynucleotide adapter is obtained according to any one of the methods disclosed herein;
    • iii) contacting the target polynucleotide and the polynucleotide adapter with the nanopore; and
    • iv) applying a potential across the transmembrane nanopore thereby causing the motor protein to move past the spacer onto the target polynucleotide thereby controlling the movement of the target polynucleotide with respect to the nanopore.


Any of the methods in embodiments disclosed herein can be used to stall the motor protein on the spacer of the polynucleotide adapter.


In one embodiment, the target polynucleotide is bound to the polynucleotide adapter. In one embodiment, step (iii) comprises binding the polynucleotide adapter to the target polynucleotide.


In the disclosed methods, the polynucleotide adapter can be attached to the target polynucleotide in any manner. The adapters are preferably covalently attached to the target polynucleotide. The adapters may be ligated to the target polynucleotide. The adapters may be ligated to either end of the target polynucleotide, i.e. the 5′ or the 3′ end, or to both ends of the target polynucleotide i.e. to the 5′ end and to the 3′ end. The adapters may be ligated to the target polynucleotide using any method known in the art. The adapter may be ligated to the target polynucleotide in the absence of ATP or using gamma-S-ATP (ATPγS) instead of ATP. Usually, if the motor protein is stalled on the polynucleotide adapter when the polynucleotide adapter is attached to the target polynucleotide, the adapter is ligated to the target polynucleotide in the absence of ATP. The adapter may be ligated using a ligase, such as T4 DNA ligase, E. coli DNA ligase, Taq DNA ligase, Tma DNA ligase and 9° N DNA ligase. The ligase may be removed from the sample before step (iii) of the method. The adapter may be attached using a topoisomerisase. The topoisomerase may, for example be a member of any of the Moiety Classification (EC) groups 5.99.1.2 and 5.99.1.3.


Also provided is a method of characterising a target polynucleotide, comprising:

    • i) carrying out one of the methods disclosed above; and
    • ii) taking one or more measurements as the target polynucleotide moves with respect to the nanopore, wherein the one or more measurements are indicative of one or more characteristics of the target polynucleotide, and thereby characterising the target polynucleotide as it moves with respect to the nanopore.


Polynucleotide Adapters

Also provided are polynucleotide adapters comprising spacers and having a motor protein stalled on the spacer. It will be understood that any of the polynucleotide adapters disclosed herein can be applied in the embodiments of the methods discussed herein and above.


In one embodiment, provided herein is a polynucleotide adapter comprising (i) a spacer; (ii) a motor protein stalled on the spacer, wherein the active site of the motor protein is occupied by the spacer; and (iii) a blocking moiety bound to the adapter, wherein the blocking moiety prevents the motor protein from moving off the spacer.


In some embodiments, the spacer, the motor protein and the blocking moiety are as described in detail herein.


In one embodiment, (i) the adapter comprises a loading site connected to the spacer and the blocking moiety is bound to the loading site; and (ii) the blocking moiety prevents the motor protein from engaging with the loading site. In some embodiments, the loading site is as described herein.


In one embodiment, provided is a polynucleotide adapter comprising:

    • i) {LB-S-D}n or {D-S-LB}n in the 5′ to 3′ direction; wherein LB is a blocked loading site; S is a spacer; D is a double-stranded polynucleotide; and n is an integer, optionally an integer from 1 to about 20; and
    • ii) one or more motor proteins stalled on the spacer (S); wherein the or each LB moiety prevents the or each motor protein from moving off the spacer (S) in the direction away from the double-stranded polynucleotide (D).


In some embodiments, the loading site(s), spacer(s), and motor protein(s) are as described herein.


In some embodiments, n is an integer from 1 to about 10, e.g. from 1 to about 5, such as 1, 2, 3, or 4, often 1 or 2. In some embodiments n is more than 1 and multiple motor proteins can be stalled on the multiple spacers S.


In some embodiments, the double-stranded polynucleotide has a length of from about 1 to about 1000 nucleotides. In some embodiments the double-stranded polynucleotide has a length of between about 5 and about 500 nucleotides, for instance between about 10 and about 100 nucleotides, e.g. between about 20 and about 80 nucleotides such as between about 30 and about 50 nucleotides.


In some embodiments, LB may be a polynucleotide which is the same type of polynucleotide as D or may be a different type of polynucleotide from D. LB and/or D may be the same type of polynucleotide as a target polynucleotide to which the adapter may be attached or may be a different type of polynucleotide from the target polynucleotide. For example, LB may be a double stranded DNA and D may be a double stranded DNA and the adapter may be suitable for attaching to a target polynucleotide which is a double stranded DNA.


In one embodiment, provided is a polynucleotide adapter comprising:

    • i) {LB-S-D}n or {D-S-LB}n in the 5′ to 3′ direction; wherein LB is a first double-stranded polynucleotide; S is a spacer; D is a second double-stranded polynucleotide; and n is an integer, optionally an integer from 1 to about 20; and wherein the first double-stranded polynucleotide (LB) is contiguous with the spacer (S) and the spacer (S) is contiguous with the second double-stranded polynucleotide (D); and
    • ii) one or more motor proteins is stalled on the spacer (S).


In some embodiments, the spacer(s) and motor protein(s) are as described herein.


In some embodiments, n is an integer from 1 to about 10, e.g. from 1 to about 5, such as 1, 2, 3, or 4, often 1 or 2.


In some embodiments, LB may be a polynucleotide which is the same type of polynucleotide as D or may be a different type of polynucleotide from D. LB and/or D may be the same type of polynucleotide as a target polynucleotide to which the adapter may be attached or may be a different type of polynucleotide from the target polynucleotide. For example, LB may be a double stranded DNA and D may be a double stranded DNA and the adapter may be suitable for attaching to a target polynucleotide which is a double stranded DNA.


Kit

Also provided are kits comprising polynucleotide adapters and motor proteins. It will be understood that any of the polynucleotide adapters disclosed herein can be applied in the embodiments of the kits discussed herein and above.


In one embodiment, provided is a kit for modifying a target polynucleotide, comprising:

    • i) a polynucleotide adapter comprising a spacer;
    • ii) a motor protein capable of controlling the movement of the target polynucleotide; and
    • iii) a blocking moiety capable of binding to the polynucleotide adapter so that when the motor protein is located on the spacer of the polynucleotide adapter and the active site of the motor protein is occupied by the spacer, the motor protein is prevented from moving off the spacer.


In one embodiment, the polynucleotide adapter is a polynucleotide adapter as described in more detailed herein. In one embodiment, the motor protein is a motor protein as described herein. In one embodiment the blocking moiety is a blocking moiety as described herein.


In one embodiment, the polynucleotide adapter comprises a loading site. The loading site may be any of the loading sites as described herein. In one embodiment, the blocking moiety is capable of binding to the polynucleotide adapter so that the motor protein is prevented from engaging with the loading site.


Also provided is a kit for modifying a target polynucleotide, comprising:

    • i) a polynucleotide adapter comprising a spacer and a blocking moiety bound to the polynucleotide adapter; and
    • ii) a motor protein capable of controlling the movement of the target polynucleotide;
    • wherein when the motor protein is bound to the adapter, the blocking moiety prevents the motor protein from moving off the spacer.


The polynucleotide adapter, spacer, blocking moiety and motor protein are typically as defined herein in more detail.


System

Also provided are systems comprising polynucleotide adapters, motor proteins and nanopores. It will be understood that any of the polynucleotide adapters disclosed herein can be applied in the embodiments of the systems discussed herein and above.


In one embodiment provided is a system for characterising a target polynucleotide comprising:

    • a polynucleotide adapter comprising a spacer;
    • a motor protein, wherein the active site of the motor protein is occupied by the spacer;
    • a blocking moiety bound to the adapter, wherein the blocking moiety prevents the motor protein from moving off the spacer;
    • a nanopore for characterising the target polynucleotide as the target polynucleotide moves with respect to the nanopore.


In one embodiment, the polynucleotide adapter is a polynucleotide adapter as described in more detailed herein. In one embodiment, the motor protein is a motor protein as described herein. In one embodiment the blocking moiety is a blocking moiety as described herein. In one embodiment the nanopore is a nanopore as described herein, The system may further comprise a membrane; control equipment; etc as defined herein.


In one embodiment, the polynucleotide adapter comprises a loading site. The loading site may be any of the loading sites as described herein. In one embodiment, the blocking moiety is capable of binding to the polynucleotide adapter so that the motor protein is prevented from engaging with the loading site.


In one embodiment the system further comprises the target polynucleotide. In one embodiment the target polynucleotide is a target polynucleotide as described herein.


Target Polynucleotide

In embodiments of the present disclosure which relate to characterising a target polynucleotide, the target analyte moves with respect to, such as into or through, a transmembrane nanopore as described in more detail herein.


In one embodiment, the presence, absence or one or more characteristics of a target polynucleotide are determined. The methods may be for determining the presence, absence or one or more characteristics of at least one target polynucleotide. The methods may concern determining the presence, absence or one or more characteristics of two or more target polynucleotide. The methods may comprise determining the presence, absence or one or more characteristics of any number of target polynucleotides, such as 2, 5, 10, 15, 20, 30, 40, 50, 100 or more target polynucleotides. Any number of characteristics of the one or more target polynucleotides may be determined, such as 1, 2, 3, 4, 5, 10 or more characteristics.


The binding of a molecule (e.g. a target polynucleotide) in the channel of the pore will have an effect on the open-channel ion flow through the pore, which is the essence of “molecular sensing” of pore channels. Variation in the open-channel ion flow can be measured using suitable measurement techniques by the change in electrical current (for example, WO 2000/28312 and D. Stoddart et al., Proc. Natl. Acad. Sci., 2010, 106, 7702-7 or WO 2009/077734). The degree of reduction in ion flow, as measured by the reduction in electrical current, is related to the size of the obstruction within, or in the vicinity of, the pore. Binding of a molecule of interest (e.g. the target polynucleotide) in or near the pore therefore provides a detectable and measurable event, thereby forming the basis of a “biological sensor”. Detecting the presence of biological molecules finds application in personalised drug development, medicine, diagnostics, life science research, environmental monitoring and in the security and/or the defence industry.


The target polynucleotide may be secreted from cells. Alternatively, the target analyte can be an analyte that is present inside cells such that the analyte must be extracted from the cells before the method can be carried out.


In one embodiment, the target polynucleotide is a nucleic acid. A polynucleotide is defined as a macromolecule comprising two or more nucleotides. The naturally-occurring nucleic acid bases in DNA and RNA may be distinguished by their physical size. As a nucleic acid molecule, or individual base, passes through the channel of a nanopore, the size differential between the bases causes a directly correlated reduction in the ion flow through the channel. The variation in ion flow may be recorded. Suitable electrical measurement techniques for recording ion flow variations are described in, for example, WO 2000/28312 and D. Stoddart et al., Proc. Natl. Acad. Sci., 2010, 106, pp 7702-7 (single channel recording equipment); and, for example, in WO 2009/077734 (multi-channel recording techniques). Through suitable calibration, the characteristic reduction in ion flow can be used to identify the particular nucleotide and associated base traversing the channel in real-time. In typical nanopore nucleic acid sequencing, the open-channel ion flow is reduced as the individual nucleotides of the nucleic sequence of interest sequentially pass through the channel of the nanopore due to the partial blockage of the channel by the nucleotide. It is this reduction in ion flow that is measured using the suitable recording techniques described above. The reduction in ion flow may be calibrated to the reduction in measured ion flow for known nucleotides through the channel resulting in a means for determining which nucleotide is passing through the channel, and therefore, when done sequentially, a way of determining the nucleotide sequence of the nucleic acid passing through the nanopore. For the accurate determination of individual nucleotides, it has typically required for the reduction in ion flow through the channel to be directly correlated to the size of the individual nucleotide passing through the constriction (or “reading head”). It will be appreciated that sequencing may be performed upon an intact nucleic acid polymer that is ‘threaded’ through the pore via the action of an associated motor protein such as a polymerase or helicase, for example. Alternatively, sequences may be determined by passage of nucleotide triphosphate bases that have been sequentially removed from a target nucleic acid in proximity to the pore (see for example WO 2014/187924).


The polynucleotide or nucleic acid may comprise any combination of any nucleotides. The nucleotides can be naturally occurring or artificial. One or more nucleotides in the polynucleotide can be oxidized or methylated. One or more nucleotides in the polynucleotide may be damaged. For instance, the polynucleotide may comprise a pyrimidine dimer. Such dimers are typically associated with damage by ultraviolet light and are the primary cause of skin melanomas. One or more nucleotides in the polynucleotide may be modified, for instance with a label or a tag, for which suitable examples are known by a skilled person. The polynucleotide may comprise one or more spacers. A nucleotide typically contains a nucleobase, a sugar and at least one phosphate group. The nucleobase and sugar form a nucleoside. The nucleobase is typically heterocyclic. Nucleobases include, but are not limited to, purines and pyrimidines and more specifically adenine (A), guanine (G), thymine (T), uracil (U) and cytosine (C). The sugar is typically a pentose sugar. Nucleotide sugars include, but are not limited to, ribose and deoxyribose. The sugar is preferably a deoxyribose. The polynucleotide preferably comprises the following nucleosides: deoxyadenosine (dA), deoxyuridine (dU) and/or thymidine (dT), deoxyguanosine (dG) and deoxycytidine (dC). The nucleotide is typically a ribonucleotide or deoxyribonucleotide. The nucleotide typically contains a monophosphate, diphosphate or triphosphate. The nucleotide may comprise more than three phosphates, such as 4 or 5 phosphates. Phosphates may be attached on the 5′ or 3′ side of a nucleotide. The nucleotides in the polynucleotide may be attached to each other in any manner. The nucleotides are typically attached by their sugar and phosphate groups as in nucleic acids. The nucleotides may be connected via their nucleobases as in pyrimidine dimers. The polynucleotide may be single stranded or double stranded. At least a portion of the polynucleotide is preferably double stranded. The polynucleotide is most preferably ribonucleic nucleic acid (RNA) or deoxyribonucleic acid (DNA). In particular, said method using a polynucleotide as an analyte alternatively comprises determining one or more characteristics selected from (i) the length of the polynucleotide, (ii) the identity of the polynucleotide, (iii) the sequence of the polynucleotide, (iv) the secondary structure of the polynucleotide and (v) whether or not the polynucleotide is modified.


The polynucleotide can be any length (i). For example, the polynucleotide can be at least 10, at least 50, at least 100, at least 150, at least 200, at least 250, at least 300, at least 400 or at least 500 nucleotides or nucleotide pairs in length. The polynucleotide can be 1000 or more nucleotides or nucleotide pairs, 5000 or more nucleotides or nucleotide pairs in length or 100000 or more nucleotides or nucleotide pairs in length. Any number of polynucleotides can be investigated. For instance, the method may concern characterising 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 50, 100 or more polynucleotides. If two or more polynucleotides are characterised, they may be different polynucleotides or two instances of the same polynucleotide. The polynucleotide can be naturally occurring or artificial. For instance, the method may be used to verify the sequence of a manufactured oligonucleotide. The method is typically carried out in vitro.


Nucleotides can have any identity (ii), and include, but are not limited to, adenosine monophosphate (AMP), guanosine monophosphate (GMP), thymidine monophosphate (TMP), uridine monophosphate (UMP), 5-methylcytidine monophosphate, 5-hydroxymethylcytidine monophosphate, cytidine monophosphate (CMP), cyclic adenosine monophosphate (cAMP), cyclic guanosine monophosphate (cGMP), deoxyadenosine monophosphate (dAMP), deoxyguanosine monophosphate (dGMP), deoxythymidine monophosphate (dTMP), deoxyuridine monophosphate (dUMP), deoxycytidine monophosphate (dCMP) and deoxymethylcytidine monophosphate. The nucleotides are preferably selected from AMP, TMP, GMP, CMP, UMP, dAMP, dTMP, dGMP, dCMP and dUMP. A nucleotide may be abasic (i.e. lack a nucleobase). A nucleotide may also lack a nucleobase and a sugar (i.e. is a C3 spacer). The sequence of the nucleotides (iii) is determined by the consecutive identity of following nucleotides attached to each other throughout the polynucleotide strain, in the 5′ to 3′ direction of the strand.


The target polynucleotide may comprise the products of a PCR reaction, genomic DNA, the products of an endonuclease digestion and/or a DNA library. The target polynucleotide may be obtained from or extracted from any organism or microorganism. The target polynucleotide is often obtained from a human or animal, e.g. from urine, lymph, saliva, mucus, seminal fluid or amniotic fluid, or from whole blood, plasma or serum. The target polynucleotide may be obtained from a plant e.g. a a cereal, legume, fruit or vegetable. The target polynucleotide may comprise genomic DNA. The genomic DNA may be fragmented. The DNA may be fragmented by any suitable method. For example, methods of fragmenting DNA are known in the art, Such methods may use a transposase, such as a MuA transposase. Often the genomic DNA is not fragmented. In some embodiments, the target polynucleotide may be DNA, RNA and/or a DNA/RNA hybrid.


Nanopore

In embodiments of the invention which relate to a nanopore, any suitable nanopore can be used. In one embodiment a nanopore is a transmembrane pore.


A transmembrane pore is a structure that crosses the membrane to some degree. It permits hydrated ions driven by an applied potential to flow across or within the membrane. The transmembrane pore typically crosses the entire membrane so that hydrated ions may flow from one side of the membrane to the other side of the membrane. However, the transmembrane pore does not have to cross the membrane. It may be closed at one end. For instance, the pore may be a well, gap, channel, trench or slit in the membrane along which or into which hydrated ions may flow.


Any transmembrane pore may be used in the methods provided herein. The pore may be biological or artificial. Suitable pores include, but are not limited to, protein pores, polynucleotide pores and solid state pores. The pore may be a DNA origami pore (Langecker et al., Science, 2012; 338: 932-936). Suitable DNA origami pores are disclosed in WO2013/083983.


In one embodiment, the nanopore is a transmembrane protein pore. A transmembrane protein pore is a polypeptide or a collection of polypeptides that permits hydrated ions, such as polynucleotide, to flow from one side of a membrane to the other side of the membrane. In the methods provided herein, the transmembrane protein pore is capable of forming a pore that permits hydrated ions driven by an applied potential to flow from one side of the membrane to the other. The transmembrane protein pore preferably permits polynucleotides to flow from one side of the membrane, such as a triblock copolymer membrane, to the other. The transmembrane protein pore allows a polynucleotide to be moved through the pore.


In one embodiment, the nanopore is a transmembrane protein pore which is a monomer or an oligomer. The pore is preferably made up of several repeating subunits, such as at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, or at least 16 subunits. The pore is preferably a hexameric, heptameric, octameric or nonameric pore. The pore may be a homo-oligomer or a hetero-oligomer.


In one embodiment, the transmembrane protein pore comprises a barrel or channel through which the ions may flow. The subunits of the pore typically surround a central axis and contribute strands to a transmembrane β-barrel or channel or a transmembrane (α-helix bundle or channel.


Typically, the barrel or channel of the transmembrane protein pore comprises amino acids that facilitate interaction with an analyte, such as a target polynucleotide (as described herein). These amino acids are preferably located near a constriction of the barrel or channel. The transmembrane protein pore typically comprises one or more positively charged amino acids, such as arginine, lysine or histidine, or aromatic amino acids, such as tyrosine or tryptophan. These amino acids typically facilitate the interaction between the pore and nucleotides, polynucleotides or nucleic acids.


In one embodiment, the nanopore is a transmembrane protein pore derived from β-barrel pores or α-helix bundle pores. β-barrel pores comprise a barrel or channel that is formed from β-strands. Suitable β-barrel pores include, but are not limited to, β-toxins, such as α-hemolysin, anthrax toxin and leukocidins, and outer membrane proteins/porins of bacteria, such as Mycobacterium smegmatis porin (Msp), for example MspA, MspB, MspC or MspD, CsgG, outer membrane porin F (OmpF), outer membrane porin G (OmpG), outer membrane phospholipase A and Neisseria autotransporter lipoprotein (NalP) and other pores, such as lysenin. α-helix bundle pores comprise a barrel or channel that is formed from α-helices. Suitable α-helix bundle pores include, but are not limited to, inner membrane proteins and a outer membrane proteins, such as WZA and ClyA toxin.


In one embodiment the nanopore is a transmembrane pore derived from or based on Msp, α-hemolysin (α-HL), lysenin, CsgG, ClyA, Sp1 or haemolytic protein fragaceatoxin C (FraC).


In one embodiment, the nanopore is a transmembrane protein pore derived from CsgG, e.g. from CsgG from E. coli Str. K-12 substr. MC4100. Such a pore is oligomeric and typically comprises 7, 8, 9 or 10 monomers derived from CsgG. The pore may be a homo-oligomeric pore derived from CsgG comprising identical monomers. Alternatively, the pore may be a hetero-oligomeric pore derived from CsgG comprising at least one monomer that differs from the others. Examples of suitable pores derived from CsgG are disclosed in WO 2016/034591.


In one embodiment, the nanopore is a transmembrane pore derived from lysenin. Examples of suitable pores derived from lysenin are disclosed in WO 2013/153359.


In one embodiment, the nanopore is a transmembrane pore derived from or based on α-hemolysin (α-HL). The wild type α-hemolysin pore is formed of 7 identical monomers or sub-units (i.e., it is heptameric). An α-hemolysin pore may be α-hemolysin-NN or a variant thereof. The variant preferably comprises N residues at positions E111 and K147.


In one embodiment, the nanopore is a transmembrane protein pore derived from Msp, e.g. from MspA. Examples of suitable pores derived from MspA are disclosed in WO 2012/107778.


In one embodiment, the nanopore is a transmembrane pore derived from or based on ClyA.


Membrane

In embodiments of the invention which comprise the use of a transmembrane nanopore, the transmembrane nanopore is typically present in a membrane. Any suitable membrane may be used in the system.


The membrane is preferably an amphiphilic layer. An amphiphilic layer is a layer formed from amphiphilic molecules, such as phospholipids, which have both hydrophilic and lipophilic properties. The amphiphilic molecules may be synthetic or naturally occurring. Non-naturally occurring amphiphiles and amphiphiles which form a monolayer are known in the art and include, for example, block copolymers (Gonzalez-Perez et al., Langmuir, 2009, 25, 10447-10450). Block copolymers are polymeric materials in which two or more monomer sub-units that are polymerized together to create a single polymer chain. Block copolymers typically have properties that are contributed by each monomer sub-unit. However, a block copolymer may have unique properties that polymers formed from the individual sub-units do not possess. Block copolymers can be engineered such that one of the monomer sub-units is hydrophobic (i.e. lipophilic), whilst the other sub-unit(s) are hydrophilic whilst in aqueous media. In this case, the block copolymer may possess amphiphilic properties and may form a structure that mimics a biological membrane. The block copolymer may be a diblock (consisting of two monomer sub-units), but may also be constructed from more than two monomer sub-units to form more complex arrangements that behave as amphipiles. The copolymer may be a triblock, tetrablock or pentablock copolymer. The membrane is preferably a triblock copolymer membrane.


Archaebacterial bipolar tetraether lipids are naturally occurring lipids that are constructed such that the lipid forms a monolayer membrane. These lipids are generally found in extremophiles that survive in harsh biological environments, thermophiles, halophiles and acidophiles. Their stability is believed to derive from the fused nature of the final bilayer. It is straightforward to construct block copolymer materials that mimic these biological entities by creating a triblock polymer that has the general motif hydrophilic-hydrophobic-hydrophilic. This material may form monomeric membranes that behave similarly to lipid bilayers and encompass a range of phase behaviours from vesicles through to laminar membranes. Membranes formed from these triblock copolymers hold several advantages over biological lipid membranes. Because the triblock copolymer is synthesised, the exact construction can be carefully controlled to provide the correct chain lengths and properties required to form membranes and to interact with pores and other proteins.


Block copolymers may also be constructed from sub-units that are not classed as lipid sub-materials; for example a hydrophobic polymer may be made from siloxane or other non-hydrocarbon based monomers. The hydrophilic sub-section of block copolymer can also possess low protein binding properties, which allows the creation of a membrane that is highly resistant when exposed to raw biological samples. This head group unit may also be derived from non-classical lipid head-groups.


Triblock copolymer membranes also have increased mechanical and environmental stability compared with biological lipid membranes, for example a much higher operational temperature or pH range. The synthetic nature of the block copolymers provides a platform to customise polymer based membranes for a wide range of applications.


In some embodiments, the membrane is one of the membranes disclosed in International Application No. WO2014/064443 or WO2014/064444.


The amphiphilic molecules may be chemically-modified or functionalised to facilitate coupling of the polynucleotide. The amphiphilic layer may be a monolayer or a bilayer. The amphiphilic layer is typically planar. The amphiphilic layer may be curved. The amphiphilic layer may be supported.


Amphiphilic membranes are typically naturally mobile, essentially acting as two dimensional fluids with lipid diffusion rates of approximately 10−8 cm s−1. This means that the pore and coupled polynucleotide can typically move within an amphiphilic membrane.


The membrane may be a lipid bilayer. Lipid bilayers are models of cell membranes and serve as excellent platforms for a range of experimental studies. For example, lipid bilayers can be used for in vitro investigation of membrane proteins by single-channel recording. Alternatively, lipid bilayers can be used as biosensors to detect the presence of a range of substances. The lipid bilayer may be any lipid bilayer. Suitable lipid bilayers include, but are not limited to, a planar lipid bilayer, a supported bilayer or a liposome. The lipid bilayer is preferably a planar lipid bilayer. Suitable lipid bilayers are disclosed in WO 2008/102121, WO 2009/077734 and WO 2006/100484.


Methods for forming lipid bilayers are known in the art. Lipid bilayers are commonly formed by the method of Montal and Mueller (Proc. Natl. Acad. Sci. USA., 1972; 69: 3561-3566), in which a lipid monolayer is carried on aqueous solution/air interface past either side of an aperture which is perpendicular to that interface. The lipid is normally added to the surface of an aqueous electrolyte solution by first dissolving it in an organic solvent and then allowing a drop of the solvent to evaporate on the surface of the aqueous solution on either side of the aperture. Once the organic solvent has evaporated, the solution/air interfaces on either side of the aperture are physically moved up and down past the aperture until a bilayer is formed. Planar lipid bilayers may be formed across an aperture in a membrane or across an opening into a recess.


The method of Montal & Mueller is popular because it is a cost-effective and relatively straightforward method of forming good quality lipid bilayers that are suitable for protein pore insertion. Other common methods of bilayer formation include tip-dipping, painting bilayers and patch-clamping of liposome bilayers.


Tip-dipping bilayer formation entails touching the aperture surface (for example, a pipette tip) onto the surface of a test solution that is carrying a monolayer of lipid. Again, the lipid monolayer is first generated at the solution/air interface by allowing a drop of lipid dissolved in organic solvent to evaporate at the solution surface. The bilayer is then formed by the Langmuir-Schaefer process and requires mechanical automation to move the aperture relative to the solution surface.


For painted bilayers, a drop of lipid dissolved in organic solvent is applied directly to the aperture, which is submerged in an aqueous test solution. The lipid solution is spread thinly over the aperture using a paintbrush or an equivalent. Thinning of the solvent results in formation of a lipid bilayer. However, complete removal of the solvent from the bilayer is difficult and consequently the bilayer formed by this method is less stable and more prone to noise during electrochemical measurement.


Patch-clamping is commonly used in the study of biological cell membranes. The cell membrane is clamped to the end of a pipette by suction and a patch of the membrane becomes attached over the aperture. The method has been adapted for producing lipid bilayers by clamping liposomes which then burst to leave a lipid bilayer sealing over the aperture of the pipette. The method requires stable, giant and unilamellar liposomes and the fabrication of small apertures in materials having a glass surface.


Liposomes can be formed by sonication, extrusion or the Mozafari method (Colas et al. (2007) Micron 38:841-847).


In some embodiments, a lipid bilayer is formed as described in International Application No. WO 2009/077734. Advantageously in this method, the lipid bilayer is formed from dried lipids. In a most preferred embodiment, the lipid bilayer is formed across an opening as described in WO2009/077734.


A lipid bilayer is formed from two opposing layers of lipids. The two layers of lipids are arranged such that their hydrophobic tail groups face towards each other to form a hydrophobic interior. The hydrophilic head groups of the lipids face outwards towards the aqueous environment on each side of the bilayer. The bilayer may be present in a number of lipid phases including, but not limited to, the liquid disordered phase (fluid lamellar), liquid ordered phase, solid ordered phase (lamellar gel phase, interdigitated gel phase) and planar bilayer crystals (lamellar sub-gel phase, lamellar crystalline phase).


Any lipid composition that forms a lipid bilayer may be used. The lipid composition is chosen such that a lipid bilayer having the required properties, such surface charge, ability to support membrane proteins, packing density or mechanical properties, is formed. The lipid composition can comprise one or more different lipids. For instance, the lipid composition can contain up to 100 lipids. The lipid composition preferably contains 1 to 10 lipids. The lipid composition may comprise naturally-occurring lipids and/or artificial lipids.


The lipids typically comprise a head group, an interfacial moiety and two hydrophobic tail groups which may be the same or different. Suitable head groups include, but are not limited to, neutral head groups, such as diacylglycerides (DG) and ceramides (CM); zwitterionic head groups, such as phosphatidylcholine (PC), phosphatidylethanolamine (PE) and sphingomyelin (SM); negatively charged head groups, such as phosphatidylglycerol (PG); phosphatidylserine (PS), phosphatidylinositol (PI), phosphatic acid (PA) and cardiolipin (CA); and positively charged headgroups, such as trimethylammonium-Propane (TAP). Suitable interfacial moieties include, but are not limited to, naturally-occurring interfacial moieties, such as glycerol-based or ceramide-based moieties. Suitable hydrophobic tail groups include, but are not limited to, saturated hydrocarbon chains, such as lauric acid (n-Dodecanolic acid), myristic acid (n-Tetradecononic acid), palmitic acid (n-Hexadecanoic acid), stearic acid (n-Octadecanoic) and arachidic (n-Eicosanoic); unsaturated hydrocarbon chains, such as oleic acid (cis-9-Octadecanoic); and branched hydrocarbon chains, such as phytanoyl. The length of the chain and the position and number of the double bonds in the unsaturated hydrocarbon chains can vary. The length of the chains and the position and number of the branches, such as methyl groups, in the branched hydrocarbon chains can vary. The hydrophobic tail groups can be linked to the interfacial moiety as an ether or an ester. The lipids may be mycolic acid.


The lipids can also be chemically-modified. The head group or the tail group of the lipids may be chemically-modified. Suitable lipids whose head groups have been chemically-modified include, but are not limited to, PEG-modified lipids, such as 1,2-Diacyl-sn-Glycero-3-Phosphoethanolamine-N-[Methoxy(Polyethylene glycol)-2000]; functionalised PEG Lipids, such as 1,2-Distearoyl-sn-Glycero-3 Phosphoethanolamine-N-[Biotinyl(Polyethylene Glycol)2000]; and lipids modified for conjugation, such as 1,2-Dioleoyl-sn-Glycero-3-Phosphoethanolamine-N-(succinyl) and 1,2-Dipalmitoyl-sn-Glycero-3-Phosphoethanolamine-N-(Biotinyl). Suitable lipids whose tail groups have been chemically-modified include, but are not limited to, polymerisable lipids, such as 1,2-bis(10,12-tricosadiynoyl)-sn-Glycero-3-Phosphocholine; fluorinated lipids, such as 1-Palmitoyl-2-(16-Fluoropalmitoyl)-sn-Glycero-3-Phosphocholine; deuterated lipids, such as 1,2-Dipalmitoyl-D62-sn-Glycero-3-Phosphocholine; and ether linked lipids, such as 1,2-Di-O-phytanyl-sn-Glycero-3-Phosphocholine. The lipids may be chemically-modified or functionalised to facilitate coupling of the polynucleotide.


The amphiphilic layer, for example the lipid composition, typically comprises one or more additives that will affect the properties of the layer. Suitable additives include, but are not limited to, fatty acids, such as palmitic acid, myristic acid and oleic acid; fatty alcohols, such as palmitic alcohol, myristic alcohol and oleic alcohol; sterols, such as cholesterol, ergosterol, lanosterol, sitosterol and stigmasterol; lysophospholipids, such as 1-Acyl-2-Hydroxy-sn-Glycero-3-Phosphocholine; and ceramides.


In another embodiment, the membrane comprises a solid state layer. Solid state layers can be formed from both organic and inorganic materials including, but not limited to, microelectronic materials, insulating materials such as Si3N4, Al2O3, and SiO, organic and inorganic polymers such as polyamide, plastics such as Teflon® or elastomers such as two-component addition-cure silicone rubber, and glasses. The solid state layer may be formed from graphene. Suitable graphene layers are disclosed in WO 2009/035647. If the membrane comprises a solid state layer, the pore is typically present in an amphiphilic membrane or layer contained within the solid state layer, for instance within a hole, well, gap, channel, trench or slit within the solid state layer. The skilled person can prepare suitable solid state/amphiphilic hybrid systems. Suitable systems are disclosed in WO 2009/020682 and WO 2012/005857. Any of the amphiphilic membranes or layers discussed above may be used.


The methods disclosed herein are typically carried out using (i) an artificial amphiphilic layer comprising a pore, (ii) an isolated, naturally-occurring lipid bilayer comprising a pore, or (iii) a cell having a pore inserted therein. The methods are typically carried out using an artificial amphiphilic layer, such as an artificial triblock copolymer layer. The layer may comprise other transmembrane and/or intramembrane proteins as well as other molecules in addition to the pore. Suitable apparatus and conditions are discussed below. The method of the invention is typically carried out in vitro.


Anchor

In one embodiment, the polynucleotide adapter comprises a membrane anchor or a transmembrane pore anchor attached to the adapter. In one embodiment the anchor characterisation of a target polynucleotide in accordance with the methods disclosed herein. For example, in methods which comprise contacting the target polynucleotide with a transmembrane pore, a membrane anchor or transmembrane pore anchor may promote localisation of the selected polynucleotides around the transmembrane pore.


The anchor may be a polypeptide anchor and/or a hydrophobic anchor that can be inserted into the membrane. In one embodiment, the hydrophobic anchor is a lipid, fatty acid, sterol, carbon nanotube, polypeptide, protein or amino acid, for example cholesterol, palmitate or tocopherol. The anchor may comprise thiol, biotin or a surfactant. In one aspect the anchor may be biotin (for binding to streptavidin), amylose (for binding to maltose binding protein or a fusion protein), Ni-NTA (for binding to poly-histidine or poly-histidine tagged proteins) or peptides (such as an antigen).


In one embodiment, the anchor comprises a linker, or 2, 3, 4 or more linkers. Preferred linkers include, but are not limited to, polymers, such as polynucleotides, polyethylene glycols (PEGs), polysaccharides and polypeptides. These linkers may be linear, branched or circular. For instance, the linker may be a circular polynucleotide. The adapter may hybridise to a complementary sequence on a circular polynucleotide linker. The one or more anchors or one or more linkers may comprise a component that can be cut or broken down, such as a restriction site or a photolabile group. The linker may be functionalised with maleimide groups to attach to cysteine residues in proteins. Suitable linkers are described in WO 2010/086602.


In one embodiment, the anchor is cholesterol or a fatty acyl chain. For example, any fatty acyl chain having a length of from 6 to 30 carbon atom, such as hexadecanoic acid, may be used. Examples of suitable anchors and methods of attaching anchors to adapters are disclosed in WO 2012/164270 and WO 2015/150786.


Characterising

In embodiments of the present disclosure which relate to characterising a target polynucleotide, the target analyte moves with respect to, such as into or through, a transmembrane nanopore as described in more detail herein.


The characterisation methods may be carried out using any apparatus that is suitable for investigating a membrane/pore system in which a pore is inserted into a membrane. The characterisation method may be carried out using any apparatus that is suitable for transmembrane pore sensing. For example, the apparatus may comprise a chamber comprising an aqueous solution and a barrier that separates the chamber into two sections. The barrier may have an aperture in which a membrane containing a transmembrane pore is formed. Transmembrane pores are described herein.


The characterisation methods may be carried out using the apparatus described in WO 2008/102120, WO 2010/122293 or WO 00/28312.


The characterisation methods may involve measuring the ion current flow through the pore, typically by measurement of a current. Alternatively, the ion flow through the pore may be measured optically, such as disclosed by Heron et al: J. Am. Chem. Soc. 9 Vol. 131, No. 5, 2009. Therefore the apparatus may also comprise an electrical circuit capable of applying a potential and measuring an electrical signal across the membrane and pore. The characterisation methods may be carried out using a patch clamp or a voltage clamp. The characterisation methods preferably involve the use of a voltage clamp. The characterisation methods may be carried out on a silicon-based array of wells where each array comprises 128, 256, 512, 1024, 2000, 3000, 4000, 6000, 10000, 12000, 15000 or more wells.


The characterisation methods may involve the measuring of a current flowing through the pore. The method is typically carried out with a voltage applied across the membrane and pore. The voltage used is typically from +2 V to −2 V, typically −400 mV to +400 mV. The voltage used is preferably in a range having a lower limit selected from −400 mV, −300 mV, −200 mV, −150 mV, −100 mV, −50 mV, −20 mV and 0 mV and an upper limit independently selected from +10 mV, +20 mV, +50 mV, +100 mV, +150 mV, +200 mV, +300 mV and +400 mV. The voltage used is more preferably in the range 100 mV to 240 mV and most preferably in the range of 120 mV to 220 mV. It is possible to increase discrimination between different nucleotides by a pore by using an increased applied potential.


The characterisation methods are typically carried out in the presence of any charge carriers, such as metal salts, for example alkali metal salts, halide salts, for example chloride salts, such as alkali metal chloride salt. Charge carriers may include ionic liquids or organic salts, for example tetramethyl ammonium chloride, trimethylphenyl ammonium chloride, phenyltrimethyl ammonium chloride, or 1-ethyl-3-methyl imidazolium chloride. In the exemplary apparatus discussed above, the salt is present in the aqueous solution in the chamber. Potassium chloride (KCl), sodium chloride (NaCl) or caesium chloride (CsCl) is typically used. KCl is preferred. The salt may be an alkaline earth metal salt such as calcium chloride (CaCl2)). The salt concentration may be at saturation. The salt concentration may be 3M or lower and is typically from 0.1 to 2.5 M, from 0.3 to 1.9 M, from 0.5 to 1.8 M, from 0.7 to 1.7 M, from 0.9 to 1.6 M or from 1 M to 1.4 M. The salt concentration is preferably from 150 mM to 1 M. The characterisation method is preferably carried out using a salt concentration of at least 0.3 M, such as at least 0.4 M, at least 0.5 M, at least 0.6 M, at least 0.8 M, at least 1.0 M, at least 1.5 M, at least 2.0 M, at least 2.5 M or at least 3.0 M. High salt concentrations provide a high signal to noise ratio and allow for currents indicative of binding/no binding to be identified against the background of normal current fluctuations.


The characterisation methods are typically carried out in the presence of a buffer. In the exemplary apparatus discussed above, the buffer is present in the aqueous solution in the chamber. Any suitable buffer may be used. Typically, the buffer is HEPES. Another suitable buffer is Tris-HCl buffer. The methods are typically carried out at a pH of from 4.0 to 12.0, from 4.5 to 10.0, from 5.0 to 9.0, from 5.5 to 8.8, from 6.0 to 8.7 or from 7.0 to 8.8 or 7.5 to 8.5. The pH used is preferably about 7.5.


The characterisation methods may be carried out at from 0° C. to 100° C., from 15° C. to 95° C., from 16° C. to 90° C., from 17° C. to 85° C., from 18° C. to 80° C., 19° C. to 70° C., or from 20° C. to 60° C. The characterisation methods are typically carried out at room temperature. The characterisation methods are optionally carried out at a temperature that supports enzyme function, such as about 37° C.


It is to be understood that although particular embodiments, specific configurations as well as materials and/or molecules, have been discussed herein for methods according to the present invention, various changes or modifications in form and detail may be made without departing from the scope and spirit of this invention. The following examples are provided to better illustrate particular embodiments, and they should not be considered limiting the application. The application is limited only by the claims.


EXAMPLES
Example 1

This example shows that futile turnover is reduced when a motor protein is stalled on a spacer in accordance with the methods disclosed herein, compared to when it is stalled adjacent to a spacer.


A first DNA construct comprising a single-stranded polynucleotide strand of SEQ ID NO: 9 and comprising a spacer (4 iSp18 units, IDT) was hybridized to complementary single-stranded DNA strands (SEQ ID Nos: 10 and 11). SEQ ID NO: 10 is complementary to the portion of SEQ ID NO: 9 between the 5′ end of SEQ ID NO: 9 and the 5′ end of the spacer and is referred to as a “test” strand. A motor protein (closed T4 Dda helicase) was stalled on the spacer. The construct is depicted schematically in FIG. 1A.


A second DNA construct was produced with a closed T4 Dda helicase loaded on the spacer. The second DNA construct was identical to the first DNA construct, except that SEQ ID NO: 12 was used instead of SEQ ID NO: 10. SEQ ID NO: 12 is identical to SEQ ID NO: 10, except it lacks the terminal ten nucleotides at the 5′ end of SEQ ID NO: 10. In consequence, SEQ ID NO: 12 hybridises to SEQ ID NO: 9 to leave a region of single-stranded DNA of 10 nucleotides in length to the 5′ end of the spacer. SEQ ID NO: 12 is thus referred to as a “test −10” strand. The construct is depicted schematically in FIG. 1B.


A spectrophotometric assay was used to determine the rate of fuel use (ATP turnover) by the motor protein (closed T4 Dda helicase in this example) stalled on the first and second DNA constructs, respectively. In brief, the spectrophotometric assay monitors ATP usage by a motor protein using a coupled enzyme system. Pyruvate Kinase (PK, rabbit muscle, 600-1000 U/mL, Sigma) converts the ADP formed by the motor protein into ATP. This reaction requires the conversion of one molecule of phosphor(enol)pyruvate (PEP, phospho(enol)pyruvic acid monopotassium salt, Sigma) into pyruvate. The pyruvate is converted into lactate by Lactate Dehydrogenase (LDH, rabbit muscle, 900-1400 U/mL, Sigma), resulting in the oxidation of an NADH molecule. The oxidation of NADH is followed spectrophotometrically due to a decrease in absorbance at 340-380 nm (extinction coefficients are 1210 M−1 cm−1 at 380 nm and 6220 M−1 cm−1 at 340 nm). As one molecule of NADH is oxidised per molecule of ADP converted into ATP, the decrease in absorbance signal is proportional to the steady state rate of ATP hydrolysis by the motor protein.



FIG. 1C shows the calculated rate of ATP turnover by the closed T4 Dda helicase when stalled on the first and second DNA constructs, respectively. The catalytic rate of ATP turnover (kcat) when the closed T4 Dda helicase was stalled on the spacer of the first construct was ca. 115 s−1. By contrast, when the closed T4 Dda helicase was stalled on the second construct, adjacent to the spacer, the rate of ATP turnover was approximately double this rate (kcat ca. 235 s−1). The rate of futile turnover by the closed T4 Dda helicase was thus approximately halved.


Example 2

This Example compares adapters with various different spacer designs and demonstrates that futile ATP turnover is reduced when a motor protein is stalled on the spacer in accordance with the methods provided herein.


Multiple different adapters were prepared with spacer designs as shown in the results table below. The tested adapters comprised polynucleotide strands as follows: (1) a Top Strand, (2) a Bottom Strand, and (3) a Blocking Strand. The Top Strand included the spacer design being tested, flanked by polynucleotide sequences on either side. The Blocking Strand was a single-stranded polynucleotide blocking moiety such as described herein.


Adapter Sequences









Top Strand:


333333333333333333333333333333CCTTTTTTTTGGCGTCTGCT





TGGGTGTTTAAC


C/[spacer sequence]/CCACAACTTCGTTCAGTTACGTATTGCT 


(i.e., SEQ ID NO: 13; comprising SEQ ID NOs: 14


and 16 spanning the spacer sequence. SEQ ID NO: 14


comprises SEQ ID NO: 15)





Bottom Strand: 


5phos/GCAATACGTAACTGAACGAAGTTGTGG (i.e., SEQ ID 


NO: 17)





Loading Strand: 


GGTTAAACACCCAAGCAGACGCCTTT (i.e., SEQ ID NO: 18)





Blocking Strand: 


GGTTAAACACCCAAGCAGACGCCAAAAAAAAGG/3Cy5Sp/(i.e.,


SEQ ID NO: 19)






Adapter Preparation and Loading

Motor protein was loaded onto adapters that initially comprised a Top Strand, a Bottom Strand and a Loading Strand. The use of a Loading Strand is an optional feature that can improve the efficiency of motor protein loading where it is desired to reduce the proportion of adapters having multiple motor proteins loaded on a single adapter. The motor protein is caused to progress onto the spacer, in accordance with methods provided herein; in doing so the motor protein displaces the Loading Strand from the adapter. The Blocking Strand is subsequently annealed to the adapter to produce the completed adapter with motor protein stalled on the spacer and prevented from moving off by the Blocking Strand. The Blocking Strand is able to preferentially bind to the adapter compared to the Loading Strand, due to the greater length of the Blocking Strand; the preferential binding is further aided by the Blocking Strand being provided at a significantly greater concentration than the Loading Strand.


Adapter Preparation Protocol

Adapter polynucleotide strands were assembled by annealing the strands in potassium acetate buffer (400 mM HEPES pH8.0, 400 mM Potassium Acetate) at the following concentrations:
















Volume (μL)
Final Concentration




















Top Strand
20
10 μM



Loading strand
22
11 μM



Bottom Strand
22
11 μM



1x KOAc buffer
100
0.5x



Nuclease Free Water
36




Total
200










Motor protein (Dda helicase) was combined with annealed adapter at a final concentration of 50-500 nM DNA and at least 7× molar excess protein under ambient conditions for 10-20 minutes. TMAD (100 μM) in potassium acetate buffer (as above) was added and incubated at 35° C. for one hour. Salt/ATP buffer (final concentration: 0.5M NaCl, 1 mM ATP, 10 mM MgCl2) together with Blocking Strand at 20× Top Strand concentration was added and the mixture incubated at room temperature for 25-30 minutes.


Adapters with bound helicase were purified using a SPRI bead purification system and adapter production was verified using a TBE gel.


ATP Turnover and Stability Testing

Each adapter was tested for ATP turnover and stability.


ATP turnover provides a measurement of futile ATP turnover while the adapter is not engaged in any sequencing reaction; the lower the ATP turnover, the lower the futile ATP usage and the greater the adapter fuel efficiency.


Adapter stability was tested under conditions typically found in nanopore sequencing reactions, and provides an indication of how long a given adapter may be expected to function in such a setting. It is to be noted that sequencing reactions carried out under different conditions, for example in lower salt concentrations or reduced temperatures, may provide increased adapter stability.


The tested adapters were named as B1 through B52 (see results table below). The results were compared to a commercially-available Oxford Nanopore sequencing adapter comprising a motor protein (herein referred to as adapter “AA”).


ATPase Assay Protocol

Adapter samples for testing were diluted to a concentration of 10 nM in SPRI elution buffer (50 m Tris pH 8, 20 nM NaCl). 10 μL of each 10 nM adapter sample was added to a 384-well plate.


An NADH master mix was prepared containing 2.2 μL 40 U/mL lactate dehydrogenase/pyruvate kinase, 33.3 μL 1.33× sequencing buffer, 3.3 μL 3.33 mM NADH, 0.7 μL 5.33 mM pyruvic acid, and 10.4 μL nuclease-free water.


NADH master mix was incubated for 10 minutes at room temperature to turn over any free ADP in solution.


30 μL of the NADH master mix was added to 10 μL of adapter sample in each well of the 384-well plate and mixed.


The plate was added to a UV-absorbance plate reader and absorbance measured at 380 nm at 34° C. for 120 cycles.


The data generated were analysed to determine kcat and ATP turnover values.


Stability Assay Protocol

Assay master mix was prepared containing 7.8 μL nuclease-free water, 10 μL 2× sequencing buffer, and 0.2 μL B-OTG.


Samples for testing were prepared by adding 2 μL of 125 nM adapter to 18 μL of assay master mix +/−ATP in a PCR tube.


Each sample was incubated in a thermal cycler at 34° C. with a cover temperature of 45° C., for 24 hours.


Following incubation, samples were run on 5% TBE gel, 160 mV, 30 mins, or 4-20% TBE gel, 180 mV, 45 mins.


Gels were stained with SYBR Gold for 10 minutes and imaged on an Amersham Typhoon scanner using Cy3 settings.


Densitometric analysis was performed to determine the proportion of bound and unbound adapter.


Results

The results for ATP turnover are shown as a percentage of the turnover seen with the comparison adapter AA, which serves as a baseline. Accordingly, ATP turnover percentage values less than 100% all indicate a decrease in futile ATP turnover and improved fuel efficiency compared to the baseline. All of the tested adapters shown in the results table had reduced ATP turnover and thus improved fuel efficiency compared to adapter AA.


The stability of the adapters was also tested, with results shown as the increase in the percentage of adapter polynucleotide unbound to motor protein over a period of 24 hours. The results demonstrate that stable adapters having loaded motor protein were produced.












Results Table:














24 hr






Stability
ATP


Adapter
Spacer (schematic

(% Increase in
turnover


Name
sequence)
Spacer sequence
Unbound DNA)
(% AA)





AA
TTTTTTTTTT_8
TTTTTTTTTT8
 3%
100% 


B1
_8_8mUmUmU_8_8
88mUmUmU88
n/a
38%, 23%


B2
_8_8/iBNA-T//iBNA-
88/iBNA-T//iBNA-
n/a
42%



T//iBNA-T/_8_8
T//iBNA-T/88


B3
_8_8T_8_8
88T88
n/a
16%, 19%,






16%


B4
_8_8TT_8_8
88TT88
61%
47%, 32%,






54%, 72%


B5
_8TT_8_8
8TT88
88%
30%


B6
_8_8TT_8
88TT8
81%
15%


B7
_8T_8T_8
8T8T8
99%
20%


B8
_8TT_9TT_8
8TT9TT8
41%
23%


B9
_8TT3TT_8
8TT3TT8
77%
81%


B10
_8T_8T_8T_8
8T8T8T8
36%
26%


B11
_8TT_8TT_8TT_8
8TT8TT8TT8
19%
27%


B12
33_8_8TT_8_8
3388TT88
45%
27%


B13
3333_8_8TT_8_8
333388TT88
34%
28%


B14
3333_8TT_8TT_83_8
33338TT8TT838
10%
21%


B15
33_8TT_8TT_83TT_8
338TT8TT83TT8
21%
22%


B16
3333_8TT_8TT_83TT_8
33338TT8TT83TT8
22%
24%


B17
_8TT_8TT_8
8TT8TT8
n/a
18%


B18
TT_8TT_8
TT8TT8
n/a
31%


B19
3TT_8TT_8
3TT8TT8
n/a
23%


B20
333TT_8TT_8TT_8
333TT8TT8TT8
23%
26%


B21
333TT_8TT_8
333TT8TT8
24%
26%


B22
3TT_8TT_8TT_8
3TT8TT8TT8
35%
42%


B23
TT3TT33333_8
TT3TT333338
20%
65%


B24
3TT3TT3333_8
3TT3TT33338
18%
61%


B25
33TT3TT333_8
33TT3TT3338
25%
76%


B26
333TT3TT33_8
333TT3TT338
24%
66%


B27
3333TT3TT3_8
3333TT3TT38
19%
71%


B28
33333TT3TT_8
33333TT3TT8
18%
92%


B29
TT33TT3333_8
TT33TT33338
 7%
11%, 7%


B30
3TT33TT333_8
3TT33TT3338
14%
11%, 9%


B31
33TT33TT33_8
33TT33TT338
 7%
20%, 19%


B32
3333TT33TT_8
3333TT33TT8
13%
16%, 14%


B33
TT333TT333_8
TT333TT3338
48%
46%


B34
3TT333TT33_8
3TT333TT338
52%
53%, 38%


B35
33TT333TT3_8
33TT333TT38
41%
50%, 47%


B36
TT3333TT33_8
TT3333TT338
52%
53%, 45%


B37
3TT3333TT3_8
3TT3333TT38
46%
54%


B38
33TT3333TT_8
33TT3333TT8
61%
57%


B39
TT33333TT3_8
TT33333TT38
61%
53%


B40
3TT33333TT_8
3TT33333TT8
59%
53%


B41
TT33333TT3_8
TT333333TT8
51%
52%


B42
TT_8TT33333_8
TT8TT333338
27%
12%


B43
3TT_8TT3333_8
3TT8TT33338
26%
10%


B44
33TT_8TT333_8
33TT8TT3338
17%
27%


B45
333TT_8TT33_8
333TT8TT338
19%
17%


B46
3333TT_8TT3_8
3333TT8TT38
16%
12%


B47
33333TT_8TT_8
33333TT8TT8
 6%
65%


B48
333TT33TT_9
333TT33TT9
 6%
 7%


B49
333TTmUmUmUTT_8
333TTmUmUmUTT8
 8%
33%


B50
333TTSpSpTT_8
333TTSpSpTT8
 5%
91%


B51
333TTSpTT_8
333TTSpTT8
 9%
95%


B52
333TTmUmUTT_8
333TTmUmUTT8
 8%
24%





8 = spacer 18 (iSp18): [(OCH2CH2)6OPO3]


3 = C3: (OC3H6OPO3)


9 = spacer 9 (iSp9): [(OCH2CH2)3OPO3]


T = thymidine


mU = 2′-O-Methyl uridine


IBNA-T = BNA (bridged nucleic acid) backbone with thymidine base


rU = RNA backbone with uridine base


Sp = d-spacer (DNA abasic site)






Example 3

This Example demonstrates that a motor protein can be loaded directly onto the spacer of a polynucleotide adapter when the blocking moiety (“Blocking Strand”) is already in place.


A polynucleotide adapter was prepared having Top Strand, Bottom Strand and Blocking Strand sequences as described above in Example 2. The Top Strand comprised a spacer sequence comprising multiple nucleotide islands, such as described herein.


The polynucleotide strands comprising the adapter were assembled by annealing the strands in potassium acetate buffer (400 mM HEPES pH8.0, 400 mM Potassium Acetate) at the following concentrations:
















Volume (μL)
Final Concentration




















Top Strand
20
10 μM



Blocker strand
22
11 μM



Bottom Strand
22
11 μM



1x KOAc buffer
100
0.5x



Nuclease Free Water
36




Total
200










Motor protein (Dda helicase) was combined with annealed adapter at a final concentration of 50-500 nM DNA and in varying degrees of molar excess protein under ambient conditions for 10-20 minutes. TMAD (100 μM) in potassium acetate buffer (as above) was added and incubated at 35° C. for one hour. Salt/ATP buffer (final concentration: 0.5M NaCl, 1 mM ATP, 10 mM MgCl2) was added and the mixture incubated at room temperature for 25-30 minutes.


Adapters with bound helicase underwent HPLC purification and adapter production was verified using a TBE gel.


Samples prepared with excess motor protein at 1×, 2×, 5×, 10×, 15×, 20× and 30× were run on a gel, with results depicted in FIG. 2. Samples were obtained from both before (“closed”) and after (“Salt/ATP”) the step of adding salt/ATP buffer.


The lanes show that the following were obtained: free DNA (adapter without motor protein loaded); motor protein and adapter DNA at a ratio of 1:1, indicating correctly loaded motor protein; and a small amount of motor protein and adapter DNA at ratios greater than 1:1, where multiple motor proteins have initially loaded onto a single adapter. The greater the excess of motor protein to DNA adapter, the greater the proportion of loaded adapter (1:1 protein:DNA) was obtained.


The results presented in FIG. 2 therefore demonstrate that a motor protein can be loaded directly onto a spacer section comprising DNA islands as described herein.


Example 4

This Example demonstrates the increased efficiency obtained when example adapters prepared according to the methods described herein are tested in a DNA sequencing system.


A double stranded 440 mer library was prepared with a commercially-available Oxford Nanopore sequencing kit (SQK-LSK109), using either the standard commercially-available sequencing adapter (AMX) or a test adapter (adapters named herein as B14, B21, C1).


The test adapters were as described above in Example 2 and prepared accordingly. Spacer sequences were as follows:

    • B14: 33338TT8TT838
    • B21: 333TT8TT8
    • C1: 333TT33TT8.


The 440 mer library was sequenced on a MinION flowcell (FLO-MIN106) using the Oxford Nanopore MinION Mklb device. Data collection was performed by MinKNOW software using baseline LSK109 sequencing protocol.


Bulk Fast5 data produced by MiniKNOW software was analysed, individual strand data was extracted and stored in subsequent text file. The strand data was used to estimate the speed of DNA translocation using number of events in a strand and duration of strand.


The results presented in FIG. 3 show that the improved fuel efficiency of the tested adapters (B14, B20 and C1) enabled sequencing to continue at a faster rate for longer than with the commercially-available adapter AMX. The results also confirm the stability of the tested adapters in a nanopore sequencing system.


Description of the Sequence Listing

SEQ ID NO: 1 shows the amino acid sequence of (hexa-histidine tagged) exonuclease I (EcoExo I) from E. coli.


SEQ ID NO: 2 shows the amino acid sequence of the exonuclease III enzyme from E. coli.


SEQ ID NO: 3 shows the amino acid sequence of the RecJ enzyme from T. thermophilus (TthRecJ-cd).


SEQ ID NO: 4 shows the amino acid sequence of bacteriophage lambda exonuclease. The sequence is one of three identical subunits that assemble into a trimer. (http://www.neb.com/nebecomm/products/productM0262.asp).


SEQ ID NO: 5 shows the amino acid sequence of Phi29 DNA polymerase from Bacillus subtilis phage Phi29.


SEQ ID NO: 6 shows the amino acid sequence of Trwc Cba (Citromicrobium bathyomarinum) helicase.


SEQ ID NO: 7 shows the amino acid sequence of Hel308 Mbu (Methanococcoides burtonii) helicase.


SEQ ID NO: 8 shows the amino acid sequence of the Dda helicase 1993 from Enterobacteria phage T4.


SEQ ID NO: 9: shows the nucleotide sequence of a polynucleotide strand discussed in example 1.


SEQ ID NO: 10: shows the nucleotide sequence of a polynucleotide strand discussed in example 1 (“Test” strand).


SEQ ID NO: 11: shows the nucleotide sequence of a polynucleotide strand discussed in example 1.


SEQ ID NO: 12: shows the nucleotide sequence of a polynucleotide strand discussed in example 1 (“Test −10” strand).


SEQ ID NO: 13 shows the nucleotide sequence of a polynucleotide adapter discussed in example 2 (“top strand”).


SEQ ID NO: 14 shows the nucleotide sequence of a polynucleotide adapter discussed in example 2 (“top strand”, portion preceding the spacer unit).


SEQ ID NO: 15 shows the nucleotide sequence of a polynucleotide adapter discussed in example 2 (“top strand”, portion preceding the spacer unit; nucleotide region).


SEQ ID NO: 16 shows the nucleotide sequence of a polynucleotide adapter discussed in example 2 (“top strand”, portion following the spacer unit).


SEQ ID NO: 17 shows the nucleotide sequence of a polynucleotide adapter discussed in example 2 (“bottom strand”).


SEQ ID NO: 18 shows the nucleotide sequence of a polynucleotide adapter discussed in example 2 (“loading strand”).


SEQ ID NO: 19 shows the nucleotide sequence of a polynucleotide adapter discussed in example 2 (“blocking strand”).










SEQUENCE LISTING



- exonuclease I from E. coli


SEQ ID NO: 1



MMNDGKQQSTFLFHDYETFGTHPALDRPAQFAAIRTDSEFNVIGEPEVFYCKPADDYLPQ






PGAVLITGITPQEARAKGENEAAFAARIHSLFTVPKTCILGYNNVREDDEVTRNIFYRNF





YDPYAWSWQHDNSRWDLLDVMRACYALRPEGINWPENDDGLPSFRLEHLTKANGIEHSNA





HDAMADVYATIAMAKLVKTRQPRLFDYLFTHRNKHKLMALIDVPQMKPLVHVSGMFGAWR





GNTSWVAPLAWHPENRNAVIMVDLAGDISPLLELDSDTLRERLYTAKTDLGDNAAVPVKL





VHINKCPVLAQANTLRPEDADRLGINRQHCLDNLKILRENPQVREKVVAIFAEAEPFTPS





DNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDITFVDKRIEKLLENYRARNFPGTLD





YAEQQRWLEHRRQVFTPEFLQGYADELQMLVQQYADDKEKVALLKALWQYAEEIVSGSGH





HHHHH





- exonuclease III enzyme from E. coli


SEQ ID NO: 2



MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK






GHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSLLGNVTVINGYFPQGESRDHPI





KFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL





PEEREWMDRLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC





CVETGIDYEIRSMEKPSDHAPVWATERR





- RecJ enzyme from T. thermophilus


SEQ ID NO: 3



MFRRKEDLDPPLALLPLKGLREAAALLEEALRQGKRIRVHGDYDADGLIGTAILVRGLAA






LGADVHPFIPHRLEEGYGVLMERVPEHLEASDLFLTVDCGITNHAELRELLENGVEVIVT





DHHTPGKTPPPGLVVHPALTPDLKEKPTGAGVAFLLLWALHERLGLPPPLEYADLAAVGT





IADVAPLWGWNRALVKEGLARIPASSWVGLRLLAEAVGYTGKAVEVAFRIAPRINAASRL





GEAEKALRLLLTDDAAEAQALVGELHRLNARRQTLEEAMLRKLLPQADPEAKAIVLLDPE





GHPGVMGIVASRILEATLRPVFLVAQGKGTVRSLAPISAVEALRSAEDLLLRYGGHKEAA





GFAMDEALFPAFKARVEAYAARFPDPVREVALLDLLPEPGLLPQVFRELALLEPYGEGNP





EPLFL





- bacteriophage lambda exonuclease


SEQ ID NO: 4



MTPDIILQRTGIDVRAVEQGDDAWHKLRLGVITASEVHNVIAKPRSGKKWPDMKMSYFHT






LLAEVCTGVAPEVNAKALAWGKQYENDARTLFEFTSGVNVTESPITYRDESMRTACSPDG





LCSDGNGLELKCPFTSRDFMKFRLGGFEAIKSAYMAQVQYSMWVTRKNAWYFANYDPRMK





REGLHYVVIERDEKYMASFDEIVPEFIEKMDEALAEIGFVFGEQWR





- Phi29 DNA polymerase


SEQ ID NO: 5



MKHMPRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYF






HNLKFDGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIY





DSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQ





FKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEK





EIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIP





TIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLF





KDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEE





TKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKL





GYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKE





VTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIKSGGSAWSHPQFEKGGGSGGGSGGSA





WSHPQFEK





- Trwc Cba helicase


SEQ ID NO: 6



MLSVANVRSPSAAASYFASDNYYASADADRSGQWIGDGAKRLGLEGKVEARAFDALLRGE






LPDGSSVGNPGQAHRPGTDLTFSVPKSWSLLALVGKDERIIAAYREAVVEALHWAEKNAA





ETRVVEKGMVVTQATGNLAIGLFQHDTNRNQEPNLHFHAVIANVTQGKDGKWRTLKNDRL





WQLNTTLNSIAMARFRVAVEKLGYEPGPVLKHGNFEARGISREQVMAFSTRRKEVLEARR





GPGLDAGRIAALDTRASKEGIEDRATLSKQWSEAAQSIGLDLKPLVDRARTKALGQGMEA





TRIGSLVERGRAWLSRFAAHVRGDPADPLVPPSVLKQDRQTIAAAQAVASAVRHLSQREA





AFERTALYKAALDFGLPTTIADVEKRTRALVRSGDLIAGKGEHKGWLASRDAVVTEQRIL





SEVAAGKGDSSPAITPQKAAASVQAAALTGQGERLNEGQLAAARLILISKDRTIAVQGIA





GAGKSSVLKPVAEVLRDEGHPVIGLAIQNTLVQMLERDTGIGSQTLARFLGGWNKLLDDP





GNVALRAEAQASLKDHVLVLDEASMVSNEDKEKLVRLANLAGVHRLVLIGDRKQLGAVDA





GKPFALLQRAGIARAEMATNLRARDPVVREAQAAAQAGDVRKALRHLKSHTVEARGDGAQ





VAAETWLALDKETRARTSIYASGRAIRSAVNAAVQQGLLASREIGPAKMKLEVLDRVNTT





REELRHLPAYRAGRVLEVSRKQQALGLFIGEYRVIGQDRKGKLVEVEDKRGKRFREDPAR





IRAGKGDDNLTLLEPRKLEIHEGDRIRWTRNDHRRGLFNADQARVVEIANGKVTFETSKG





DLVELKKDDPMLKRIDLAYALNVHMAQGLISDRGIAVMDSRERNLSNQKTFLVTVTRLRD





HLTLVVDSADKLGAAVARNKGEKASAIEVTGSVKPTATKGSGVDQPKSVEANKAEKELTR





SKSKTLDFGI





- Hel308 Mbu helicase


SEQ ID NO: 7



MMIRELDIPRDIIGFYEDSGIKELYPPQAEAIEMGLLEKKNLLAAIPTASGKTLLAELAM






IKAIREGGKALYIVPLRALASEKFERFKELAPFGIKVGISTGDLDSRADWLGVNDIIVAT





SEKTDSLLRNGTSWMDEITTVVVDEIHLLDSKNRGPTLEVTITKLMRLNPDVQVVALSAT





VGNAREMADWLGAALVLSEWRPTDLHEGVLFGDAINFPGSQKKIDRLEKDDAVNLVLDTI





KAEGQCLVFESSRRNCAGFAKTASSKVAKILDNDIMIKLAGIAEEVESTGETDTAIVLAN





CIRKGVAFHHAGLNSNHRKLVENGFRQNLIKVISSTPTLAAGLNLPARRVIIRSYRRFDS





NFGMQPIPVLEYKQMAGRAGRPHLDPYGESVLLAKTYDEFAQLMENYVEADAEDIWSKLG





TENALRTHVLSTIVNGFASTRQELFDFFGATFFAYQQDKWMLEEVINDCLEFLIDKAMVS





ETEDIEDASKLFLRGTRLGSLVSMLYIDPLSGSKIVDGFKDIGKSTGGNMGSLEDDKGDD





ITVTDMTLLHLVCSTPDMRQLYLRNTDYTIVNEYIVAHSDEFHEIPDKLKETDYEWFMGE





VKTAMLLEEWVTEVSAEDITRHFNVGEGDIHALADTSEWLMHAAAKLAELLGVEYSSHAY





SLEKRIRYGSGLDLMELVGIRGVGRVRARKLYNAGFVSVAKLKGADISVLSKLVGPKVAY





NILSGIGVRVNDKHENSAPISSNTLDTLLDKNQKTENDFQ





- Dda helicase


SEQ ID NO: 8



MTFDDLTEGQKNAFNIVMKAIKEKKHHVTINGPAGTGKTTLTKFIIEALISTGETGIILA






APTHAAKKILSKLSGKEASTIHSILKINPVTYEENVLFEQKEVPDLAKCRVLICDEVSMY





DRKLFKILLSTIPPWCTIIGIGDNKQIRPVDPGENTAYISPFFTHKDFYQCELTEVKRSN





APIIDVATDVRNGKWIYDKVVDGHGVRGFTGDTALRDFMVNYFSIVKSLDDLFENRVMAF





TNKSVDKLNSIIRKKIFETDKDFIVGEIIVMQEPLFKTYKIDGKPVSEIIFNNGQLVRII





EAEYTSTFVKARGVPGEYLIRHWDLTVETYGDDEYYREKIKIISSDEELYKFNLFLGKTA





ETYKNWNKGGKAPWSDFWDAKSQFSKVKALPASTFHKAQGMSVDRAFIYTPCIHYADVEL





AQQLLYVGVTRGRYDVFYV





SEQ ID NO: 9



/5Biosg/CCTTTTTTTT GGCGTCTGCTTGGGTGTTTAACC/iSp18//iSp18//






iSp18//iSp18//iBNA-C//iBNA-C//iBNA-A//iBNA-C//iBNA-A/





ACTTCGTTCAGTTACGTATTGC/3Bio/





SEQ ID NO: 10



GGTTAAACACCCAAGCAGACGCCAAAAAAAAGG






SEQ ID NO: 11



/5phos/GCAATACGTAACTGAACGAAGT/iBNA-T//iBNA-G//iBNA-T//iBNA-






G//iBNA-G/





SEQ ID NO: 12



CCAAGCAGACGCC AAAAAAAAGG






SEQ ID NO: 13



333333333333333333333333333333CCTTTTTTTTGGCGTCTGCTTGGGTGTTT






AACC/[spacer sequence]/CCACAACTTCGTTCAGTTACGTATTGCT





SEQ ID NO: 14



333333333333333333333333333333CCTTTTTTTTGGCGTCTGCTTGGGTGTTTAACC






SEQ ID NO: 15



CCTTTTTTTTGGCGTCTGCTTGGGTGTTTAACC






SEQ ID NO: 16



CCACAACTTCGTTCAGTTACGTATTGCT






SEQ ID NO: 17



5phos/GCAATACGTAACTGAACGAAGTTGTGG






SEQ ID NO: 18



GGTTAAACACCCAAGCAGACGCCTTT






SEQ ID NO: 19



GGTTAAACACCCAAGCAGACGCCAAAAAAAAGG/3Cy5Sp/






Claims
  • 1. A method of loading a motor protein onto a polynucleotide adapter, the method comprising: i) providing a polynucleotide adapter comprising a spacer;ii) contacting the polynucleotide adapter with a motor protein; andiii) positioning the motor protein on the spacer;
  • 2. A method according to claim 1, comprising: i) providing a polynucleotide adapter comprising a spacer and a blocking moiety bound to the polynucleotide adapter;ii) contacting the polynucleotide adapter with a motor protein; andiii) positioning the motor protein on the spacer;
  • 3. A method of loading a motor protein onto a polynucleotide adapter, the method comprising: i) providing a polynucleotide adapter comprising a spacer;ii) contacting the polynucleotide adapter with a motor protein;iii) causing the motor protein to progress onto the spacer; andiv) binding a blocking moiety to the polynucleotide adapter, wherein the blocking moiety prevents the motor protein from moving off the spacer.
  • 4. A method according to claim 3, comprising: i) providing a polynucleotide adapter comprising a loading site connected to a spacer;ii) contacting the loading site with a motor protein;iii) causing the motor protein to progress from the loading site onto the spacer; andiv) binding a blocking moiety to the polynucleotide adapter, wherein the blocking moiety prevents the motor protein from moving off the spacer and onto the loading site;optionally whereinstep (ii) comprises contacting the loading site with a motor protein, wherein the motor protein engages with the loading site; andstep (iv) comprises binding a blocking moiety to the polynucleotide adapter, wherein the blocking moiety prevents the motor protein from moving off the spacer and re-engaging with the loading site.
  • 5.-9. (canceled)
  • 10. A method according to claim 1, wherein the polynucleotide adapter comprises a loading site connected to a spacer; the motor protein is a first motor protein and causing the first motor protein to progress from the loading site onto the spacer comprises loading a second motor protein onto the loading site and causing the second motor protein to progress from the loading site towards the spacer, wherein the second motor protein forces the first motor protein onto the spacer.
  • 11. A method according to claim 1, wherein binding the blocking moiety to the polynucleotide adapter forces the motor protein onto the spacer.
  • 12. A method according to claim 1, wherein the polynucleotide adapter comprises a loading site connected to a spacer and the blocking moiety binds to the loading site; optionally wherein the loading site is contiguous with the spacer and the blocking moiety binds to the loading site immediately adjacent to the spacer.
  • 13. (canceled)
  • 14. A method according to claim 1, wherein step (iii) comprises causing the motor protein to progress onto the spacer such that the spacer occupies the active site of the motor protein.
  • 15. A method according to claim 1, wherein the polynucleotide adapter comprises a loading site connected to a spacer and the loading site comprises a single-stranded or non-hybridised polynucleotide; optionally wherein the loading site comprises a single-stranded or non-hybridised polynucleotide having a length of between about 2 and about 1000 nucleotide units.
  • 16.-17. (canceled)
  • 18. A method according to claim 1, wherein binding the blocking moiety to the polynucleotide adapter sterically prevents the movement of the motor protein off the spacer.
  • 19. (canceled)
  • 20. A method according to claim 1, wherein (i) the loading moiety comprises a single-stranded or non-hybridised polynucleotide and the blocking moiety comprises a single-stranded or non-hybridised polynucleotide; and (ii) binding the blocking moiety to the loading site comprises hybridising the blocking moiety to the loading site.
  • 21. A method according to claim 1, wherein the blocking moiety comprises a single-stranded or non-hybridised polynucleotide having a length of between about 2 and about 1000 nucleotide units.
  • 22. A method according to claim 1, wherein the spacer comprises: i) one or more nitroindoles, one or more inosines, one or more acridines, one or more 2-aminopurines, one or more 2-6-diaminopurines, one or more 5-bromo-deoxyuridines, one or more inverted thymidines (inverted dTs), one or more inverted dideoxy-thymidines (ddTs), one or more dideoxy-cytidines (ddCs), one or more 5-methylcytidines, one or more 5-hydroxymethylcytidines, one or more 2′-O-Methyl RNA bases, one or more Iso-deoxycytidines (Iso-dCs), one or more Iso-deoxyguanosines (Iso-dGs), one or more C3 (OC3H6OPO3) groups, one or more photo-cleavable (PC) [OC3H6—C(O)NHCH2—C6H3NO2—CH(CH3)OPO3] groups, one or more hexandiol groups, one or more spacer 9 (iSp9) [(OCH2CH2)3OPO3] groups, or one or more spacer 18 (iSp18) [(OCH2CH2)6OPO3] groups;ii) one or more thiol connections;iii) one or more abasic nucleotides;iv) one or more nucleotides of different backbone structure to the loading site;v) one or more chemical groups which cause the one or more motor proteins to stall; and/orvi) a polymer, optionally wherein said polymer is a polypeptide or a polyethylene glycol (PEG);or wherein the spacer comprises one or more nucleotides, optionally wherein the spacer comprises one or more nucleotide islands.
  • 23. (canceled)
  • 24. A method according to claim 1, wherein: i) the polynucleotide adapter comprises a spacer comprising one or more nucleotides, preferably one or more nucleotide islands; and a blocking moiety bound to the polynucleotide adapter; andii) positioning the motor protein on the spacer comprises contacting the motor protein with the spacer and modifying the motor protein to prevent the motor protein disengaging from the spacer.
  • 25. A method according to claim 1 wherein the spacer comprises one or more nucleotides and wherein the spacer further comprises one or more moieties selected from: —S—N—S—N—S—N—S—; —S—N—N—S—N—N—S—N—N—S—; —S—S—S—S—S—S—N—N—S—S—;—S—S—S—S—S—N—N—S—N—N—S—S—S—; —S—S—S—N—N—S—N—N—S—S—N—N—S—;—S—S—S—S—S—N—N—S—N—N—S—S—N—N—S—; —S—S—S—N—N—S—N—N—S—N—N—S—;—N—N—S—S—N—N—S—S—S—S—S—; —S—N—N—S—S—N—N—S—S—S—S—;—S—S—N—N—S—S—N—N—S—S—S—; —S—S—S—S—N—N—S—S—N—N—S—; —N—N—S—N—N—S—S—S—S—S—S—;—S—N—N—S—N—N—S—S—S—S—S—; —S—S—N—N—S—N—N—S—S—S—S—; —S—S—S—N—N—S—N—N—S—S—S—: —S—S—S—S—N—N—S—N—N—S—S—; and —S—S—S—N—N—S—S—N—N—S—; wherein each S is a spacer unit and each N is a nucleotide.
  • 26. A method according to claim 1, wherein the motor protein is a helicase, a polymerase, an exonuclease, a topoisomerase, or a variant thereof: optionally wherein the motor protein is a helicase independently selected from a Hel308 helicase, a RecD helicase, a TraI helicase, a TrwC helicase, an XPD helicase, and a Dda helicase, or a variant thereof.
  • 27. A method according to claim 1, wherein the motor protein on the spacer of the polynucleotide adapter is modified to prevent the motor protein disengaging from the spacer.
  • 28.-29. (canceled)
  • 30. A method of controlling the movement of a target polynucleotide with respect to a transmembrane nanopore, comprising: i) providing (A) a target polynucleotide; (B) a polynucleotide adapter comprising a spacer; and (C) a motor protein;ii) carrying out a method according to any one of the preceding claims thereby stalling the motor protein on the spacer of the polynucleotide adapter;iii) contacting the target polynucleotide and the stalled motor protein on the spacer of the polynucleotide adapter with the nanopore; andiv) applying a potential across the transmembrane nanopore thereby causing the motor protein to move past the spacer onto the target polynucleotide thereby controlling the movement of the target polynucleotide with respect to the nanopore.
  • 31. A method according to claim 30 wherein: (ii the motor protein is stalled on the polynucleotide adapter before the polynucleotide adapter is attached to the target polynucleotide; or(ii) the polynucleotide adapter is attached to the target polynucleotide before the motor protein is stalled on the polynucleotide adapter.
  • 32. (canceled)
  • 33. A method of controlling the movement of a target polynucleotide with respect to a transmembrane nanopore, comprising: i) providing a target polynucleotide;ii) providing a polynucleotide adapter comprising a spacer and having a motor protein stalled thereon, wherein said polynucleotide adapter is obtained according to the method of claim 1;iii) contacting the target polynucleotide and the polynucleotide adapter with the nanopore; andiv) applying a potential across the transmembrane nanopore thereby causing the motor protein to move past the spacer onto the target polynucleotide thereby controlling the movement of the target polynucleotide with respect to the nanopore.
  • 34. A method of characterising a target polynucleotide, comprising: i) carrying out the method of claim 1; andii) taking one or more measurements as the target polynucleotide moves with respect to the nanopore, wherein the one or more measurements are indicative of one or more characteristics of the target polynucleotide, and thereby characterising the target polynucleotide as it moves with respect to the nanopore.
  • 35. A polynucleotide adapter comprising (i) a spacer; (ii) a motor protein stalled on the spacer, wherein the active site of the motor protein is occupied by the spacer; and (iii) a blocking moiety bound to the adapter, wherein the blocking moiety prevents the motor protein from moving off the spacer: optionally wherein (i) the adapter comprises a loading site connected to the spacer and the blocking moiety is bound to the loading site; and (ii) the blocking moiety prevents the motor protein from engaging with the loading site.
  • 36.-41. (canceled)
Priority Claims (1)
Number Date Country Kind
1907244.6 May 2019 GB national
RELATED APPLICATIONS

This application is a national stage filing under 35 U.S.C. § 371 of international application number PCT/GB2020/051260, filed May 22, 2020, which claims the benefit of the filing date of Great Britain application number GB 1907244.6, filed May 22, 2019, the entire contents of each of which are incorporated herein by reference.

PCT Information
Filing Document Filing Date Country Kind
PCT/GB2020/051260 5/22/2020 WO